#WARNING:no index is registered index "YP_009724397.2" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724397.2.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
CurrentView:HTML5 Change to:[JAVA] |
DOWNLOAD: [sequence-replaced 3D model] [for PyMOL] [3D template] [Modeller script]
ALL MOLECULES IN THE BIOLOGICAL UNIT: |
MOLECULES | contact sites | |||||
model | mark | query | asym_id oper (auth_asym_id) |
type | description | a(query A) |
1 | a | A(queryA) | C 1 (F) | polymer(polypeptide(L)) [106 aa] | Nucleocapsid protein :NCAP_IBVG | |
2 | b | D 1 (G) | polymer(polypeptide(L)) [113 aa] | Nucleocapsid protein :NCAP_IBVG | 261K 262R 263T 264A(I) 270V 274F 277R 281Q(G) 282T(K) 283Q(E) 284G 285N 286F 291L(M) 296T(I) 301W(V) 304I(M) 305A(L) 306Q(N) 307F(L) 308A(V) 309P 310S 311A(S) 312S(H) 313A 314F(C) 315F(L) 316G(F) 317M(G) 318S 319R 320I(V) 322M(P) 324V(L) 325T(Q) 326P 327S(D) 328G 329T(L) 330W(H) 331L 332T(K) 333Y(F) 334T(E) 335G(F) 336A(T) 337I(T) 338K(V) 339L(V) 340D(P) 341D(R) 343D 346F 357I(V) (identity: 34.5 %/29.1 %) |
ALIGNMENTS |
MODEL[1] Protein A "queryA" TEMPLATE:2ge8_C_1 identity=29.1% |
queryA 261:KRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY: 360 :*** * * * ** * ***** * ** * ** * * * ** * * * : 2ge8_C_1 10:KRTIPPGYKVDQVFGPR-TKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGV: 108 SecStr :G TT SHHHH S - SSSTT B HHHHHHGGGSHHHHHHTTSS HHHHHHHSEEEEEEETTEEEEEEE TT SSSHHHHHHHHHHBT T: ExpBur :eeeeeeeeebeebeeeb-beeeeeeebbbebbeebeebebbebbeebeeeeeeeeeebeeeeeeeeeeeeeeeeeeeeeeeeeeebeebeebeebbeebe: Contact :bbbb b b b bbbbbb b b b bbbbbbbbbbbbbbbbb b bbbbbbbbbbbbbbbbbb b b b queryA 361:KTFP: 364 : * *: 2ge8_C_1 109:GTRP: 112 SecStr :T : ExpBur :eeee: |