PSIBLAST 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           570,157 sequences; 206,173,379 total letters

Results from round 1


Query= sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens
OX=9606 GN=IKBKG PE=1 SV=2

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapie...  829     0.0  
sp|Q95KU9|NEMO_BOVIN NF-kappa-B essential modulator OS=Bos taurus...  701     0.0  
sp|A9QT41|NEMO_PIG NF-kappa-B essential modulator OS=Sus scrofa O...  700     0.0  
sp|O88522|NEMO_MOUSE NF-kappa-B essential modulator OS=Mus muscul...  697     0.0  
sp|Q6TMG5|NEMO_RAT NF-kappa-B essential modulator OS=Rattus norve...  693     0.0  
sp|Q5RI56|OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE...  138     9e-35
sp|Q5M7B7|OPTN_XENLA Optineurin OS=Xenopus laevis OX=8355 GN=optn...  127     6e-31
sp|Q90Z16|OPTN_CHICK Optineurin OS=Gallus gallus OX=9031 GN=OPTN ...  122     4e-29
sp|Q8K3K8|OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn ...  120     2e-28
sp|Q8R5M4|OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Op...  120     2e-28
sp|Q95KA2|OPTN_MACFA Optineurin OS=Macaca fascicularis OX=9541 GN...  119     4e-28
sp|Q861Q8|OPTN_MACMU Optineurin OS=Macaca mulatta OX=9544 GN=OPTN...  119     4e-28
sp|Q96CV9|OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN P...  116     5e-27
sp|Q7YS99|OPTN_PIG Optineurin OS=Sus scrofa OX=9823 GN=OPTN PE=1 ...  115     2e-26
sp|Q5R923|OPTN_PONAB Optineurin OS=Pongo abelii OX=9601 GN=OPTN P...  97.1    2e-20
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium d...  45.4    0.001
sp|Q8IDX6|RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=P...  44.3    0.002
sp|Q9GYV5|NEMO_DROME NF-kappa-B essential modulator OS=Drosophila...  43.5    0.002
sp|Q96KP6|TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapie...  43.1    0.003
sp|A1R0M2|MUTS_BORT9 DNA mismatch repair protein MutS OS=Borrelia...  43.5    0.003
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizos...  40.0    0.038
sp|P17594|POLG_EMCVD Genome polyprotein OS=Encephalomyocarditis v...  38.9    0.12 
sp|P17593|POLG_EMCVB Genome polyprotein OS=Encephalomyocarditis v...  38.9    0.12 
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein 1 OS=Plasmo...  38.5    0.14 
sp|Q15025|TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapie...  37.7    0.19 
sp|Q0J9V3|KN14H_ORYSJ Kinesin-like protein KIN-14H OS=Oryza sativ...  37.7    0.19 
sp|Q9WUU8|TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus muscul...  37.7    0.20 
sp|Q8ILR9|YPF17_PLAF7 Protein PF3D7_1417600 OS=Plasmodium falcipa...  37.7    0.25 
sp|Q66765|POLG_EMCVR Genome polyprotein OS=Encephalomyocarditis v...  37.4    0.30 
sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Saliniba...  37.4    0.30 
sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=...  37.4    0.35 
sp|P03304|POLG_EMCV Genome polyprotein OS=Encephalomyocarditis vi...  37.0    0.37 
sp|Q01202|MYSP_BRUMA Paramyosin OS=Brugia malayi OX=6279 PE=2 SV=2    37.0    0.37 
sp|Q02171|MYSP_ONCVO Paramyosin OS=Onchocerca volvulus OX=6282 PE...  37.0    0.38 
sp|P13392|MYSP_DIRIM Paramyosin (Fragment) OS=Dirofilaria immitis...  36.6    0.49 
sp|Q9KS12|MARTX_VIBCH Multifunctional-autoprocessing repeats-in-t...  36.6    0.58 
sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotog...  35.4    1.2  
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoi...  35.4    1.3  
sp|Q9C438|ATG11_PICPA Autophagy-related protein 11 (Fragment) OS=...  35.4    1.3  
sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus OX=...  35.0    1.8  
sp|A5A6M5|K1H1_PANTR Keratin, type I cuticular Ha1 OS=Pan troglod...  33.9    2.7  
sp|B4EV93|SYS_PROMH Serine--tRNA ligase OS=Proteus mirabilis (str...  33.9    3.0  
sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapien...  33.9    3.3  
sp|P08928|LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster OX=7227...  33.9    3.4  
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE...  33.9    3.8  
sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 G...  33.5    4.8  
sp|Q8BQP8|RFIP4_MOUSE Rab11 family-interacting protein 4 OS=Mus m...  33.1    5.0  
sp|Q91FL1|313L_IIV6 Putative KilA-N domain-containing protein 313...  32.7    6.2  
sp|P50748|KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo sa...  33.1    6.4  
sp|B3DGU2|RFP4B_DANRE Rab11 family-interacting protein 4B OS=Dani...  32.7    6.4  
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=...  33.1    6.4  
sp|P75310|Y474_MYCPN Uncharacterized protein MG328 homolog OS=Myc...  32.7    7.0  
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9...  33.1    7.3  
sp|Q8CP76|EBH_STAES Extracellular matrix-binding protein ebh OS=S...  32.7    7.8  
sp|Q5HPA2|EBH_STAEQ Extracellular matrix-binding protein ebh OS=S...  32.7    7.8  
sp|Q6PA15|CCD22_XENLA Coiled-coil domain-containing protein 22 OS...  32.7    8.0  


>sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens 
OX=9606 GN=IKBKG PE=1 SV=2
Length=419

 Score = 829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/419 (100%), Positives = 419/419 (100%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
Sbjct  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
Sbjct  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
Sbjct  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
            ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419


>sp|Q95KU9|NEMO_BOVIN NF-kappa-B essential modulator OS=Bos taurus 
OX=9913 GN=IKBKG PE=1 SV=1
Length=419

 Score = 701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/419 (86%), Positives = 382/419 (91%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+R  WKS LCEMVQPSG PA DQD+LGEES LGKPAMLH+PSEQG PET QRCLEENQE
Sbjct  1    MSRPPWKSPLCEMVQPSGSPAGDQDMLGEESSLGKPAMLHVPSEQGTPETFQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEEL HFQ +QREEK FLM KFQEAR LV RL LEK +L++Q+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELQHFQGNQREEKAFLMQKFQEARDLVVRLSLEKRELRQQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+EVE LK CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE QALE RAR ASE+
Sbjct  121  ALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEK  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
            ARQLESEREAL+Q+HSVQVDQL +Q +S+EAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  ARQLESEREALEQRHSVQVDQLVLQNESMEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNH+KSS+V SER RG+QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHMKSSMVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQAREKLAEKKE LQEQLEQLQREYS+LK SCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQ PL P PA+ S  L   SQRRSPP+EPP FCCPKCQYQAPD+DTLQIHVMECIE
Sbjct  361  VEVSQPPLAPGPAHHSFHLNPSSQRRSPPDEPPKFCCPKCQYQAPDIDTLQIHVMECIE  419


>sp|A9QT41|NEMO_PIG NF-kappa-B essential modulator OS=Sus scrofa 
OX=9823 GN=IKBKG PE=1 SV=1
Length=419

 Score = 700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/419 (89%), Positives = 389/419 (93%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+R  WKSQ CEMVQPSGGPA DQDVLGEES LGKP MLHLPSEQGAPET QRCLEENQE
Sbjct  1    MSRTPWKSQPCEMVQPSGGPAGDQDVLGEESSLGKPTMLHLPSEQGAPETFQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEEL  FQ SQREEKEFLM KF EAR+LVERL LEKL+L+RQ+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELQRFQGSQREEKEFLMQKFCEARRLVERLSLEKLELRRQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+EVE LK CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE QALE R RA SEQ
Sbjct  121  ALQEVELLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRVRATSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLE+EREALQQQHSVQVDQLR+Q QS+EAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  VRQLENEREALQQQHSVQVDQLRLQSQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNHIKSSVV SER RG+QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQARE+LAE+KELLQEQLEQLQREYS+LK SCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREQLAERKELLQEQLEQLQREYSRLKTSCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQ  LPPAPA+ S   ALPSQRRSPPEEPP+FCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  361  VEVSQPTLPPAPAHHSFHPALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE  419


>sp|O88522|NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus 
OX=10090 GN=Ikbkg PE=1 SV=2
Length=412

 Score = 697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/419 (87%), Positives = 382/419 (91%), Gaps = 7/419 (2%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            MN+H WK+QL EMVQPSGGPA DQD+LGEES LGKPAMLHLPSEQG PETLQRCLEENQE
Sbjct  1    MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEELLHFQ SQREEKEFLMCKFQEARKLVERL LEKLDL+ Q+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+E+E LK+CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK+ QALEGR RA SEQ
Sbjct  121  ALKELEQLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLESERE LQQQHSVQVDQLRMQ QSVEAALRMERQAASEEKRKLAQLQ AYHQLFQ+
Sbjct  181  VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YD+HIKSS       +GMQLEDL+QQLQQAEEALVAKQE+IDKLKEEAEQHKIVMETVPV
Sbjct  241  YDSHIKSS-------KGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV  293

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAER AREKL EKKE LQEQLEQLQRE++KLK  C ESARIEDMRKRH
Sbjct  294  LKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESARIEDMRKRH  353

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VE  Q PL PAPA+ S  LAL +QRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  354  VETPQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  412


>sp|Q6TMG5|NEMO_RAT NF-kappa-B essential modulator OS=Rattus norvegicus 
OX=10116 GN=Ikbkg PE=2 SV=1
Length=412

 Score = 693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/419 (87%), Positives = 385/419 (92%), Gaps = 7/419 (2%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+RHLWK+QL EMVQPSGGPA DQD+LGEES LGKPAMLHLPSEQG PETLQRCLEENQE
Sbjct  1    MSRHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEELLHFQ SQREEKEFLMCKFQEARKLVERL LEKLDL+RQ+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRRQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL ++EHLK+CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE Q LEGR RA SEQ
Sbjct  121  ALEDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRIRAVSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLESERE LQQQHSVQVDQLRMQ QSVEAALRMERQAASEEKRKLAQLQ AYHQLFQ+
Sbjct  181  VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YD+HIKSS       +GMQLEDL+QQLQQAEEALVAKQE+IDKLKEEAEQHKIVMETVPV
Sbjct  241  YDSHIKSS-------KGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV  293

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAER AREKL E+KELLQEQLEQLQRE++KLK  C ESARIEDMRKRH
Sbjct  294  LKAQADIYKADFQAERHAREKLVERKELLQEQLEQLQREFNKLKVGCHESARIEDMRKRH  353

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VE SQ PL PAPA+ S  LAL +QRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  354  VETSQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  412


>sp|Q5RI56|OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn 
PE=2 SV=2
Length=517

 Score = 138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 167/288 (58%), Gaps = 23/288 (8%)

Query  141  SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQV-  199
            +++ Q+  L  EL+++Q +L+ A    + L+ R +   +    L+++   L  +  VQ  
Sbjct  242  NLEDQLLKLCNELKQAQIKLDEAESMKRNLQDRCKDLEQDLGTLKTQ---LGDKQKVQAE  298

Query  200  -DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY-----DNHIKSSVVGSE  253
             D L++Q +S++AA+++E++   +EK  L QL+ AY +LF++Y     +   + S V  +
Sbjct  299  NDCLKVQMESLQAAIKLEQKKTQDEKNNLNQLKDAYTKLFEDYSELQEEKKKRESCVSKD  358

Query  254  RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ  313
                   ++L+ +   AE+AL  KQ+ ID++K E  Q +  +ET+ V +AQA+IY +DF 
Sbjct  359  -----DYDELQTRFATAEKALADKQQKIDEMKMELFQKEKDLETISVFQAQAEIYSSDFY  413

Query  314  AERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR--IEDMRKRHVEVSQAPLPPA  371
            AER AREK+ E+KE L  QLE ++++ S+L+   +   R  + +M++RHV     P  P 
Sbjct  414  AERAAREKIHEEKERLATQLEYVKKQNSQLQEEMESLGRHSMSEMQRRHVPRGANPQGP-  472

Query  372  PAYLSSPLALPSQRRSPPEEP-PDFCCPKCQYQAPDMDTLQIHVMECI  418
                ++P  LP  R    ++  PD  CPKC    PD+D+LQIH+M+CI
Sbjct  473  ----TAPNNLPGGRGEWQQQNIPDHACPKCGEVLPDLDSLQIHIMDCI  516


 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 51/80 (64%), Gaps = 4/80 (5%)

Query  42   PSEQGA-PETLQR---CLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKF  97
            P   G+  ETLQ+    ++EN++L++A++Q+N  ++ER E L  ++  Q+EE++FL  + 
Sbjct  13   PGNLGSLEETLQQMNTLIKENRDLKEALKQTNLSMKERFEGLSAWKEKQKEERDFLEQRL  72

Query  98   QEARKLVERLGLEKLDLKRQ  117
            +EAR  +  + +E   LK Q
Sbjct  73   EEARTRLNTMDVENEALKNQ  92


>sp|Q5M7B7|OPTN_XENLA Optineurin OS=Xenopus laevis OX=8355 GN=optn 
PE=2 SV=1
Length=532

 Score = 127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 154/282 (55%), Gaps = 19/282 (7%)

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ--V  199
            +K +V SL  ELQE+  +L  A +   +L+ +        ++L+  +  L+++ S++  +
Sbjct  264  LKEKVKSLNKELQETNDKLNEAKQFKNSLQEKCILLD---KRLQENQVDLEEKQSLRYSI  320

Query  200  DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ  259
             +L +Q +S E+ +++E+     EK +L  LQV+Y +L  EY    +  +   E+   ++
Sbjct  321  KKLELQVESQESEIKLEQNKTEAEKNQLGILQVSYDKLNSEYQ---ELRIREIEKVSKVE  377

Query  260  LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAR  319
              +L ++L   E+AL  KQ  ID+++E   +H+   ET+ +L+AQ D+Y ADF AER AR
Sbjct  378  FNELLEKLDVCEKALAKKQFEIDEMREMDTKHEEDKETIELLRAQVDVYCADFHAERSAR  437

Query  320  EKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
            E + ++KE L  +L  + +EY KLK        IE +++RH   S       P YL +  
Sbjct  438  ENIHQEKEQLATRLAYMIQEYEKLKEEMMGKQSIEQLQRRHGATSLLDASEGP-YLVA--  494

Query  380  ALPSQRRSPPEEPPD---FCCPKCQYQAPDMDTLQIHVMECI  418
                 R +   E P    + CPKC    PDMDTLQIHVM+CI
Sbjct  495  -----RGAANMEQPSITVYTCPKCNLTVPDMDTLQIHVMDCI  531


>sp|Q90Z16|OPTN_CHICK Optineurin OS=Gallus gallus OX=9031 GN=OPTN 
PE=1 SV=1
Length=556

 Score = 122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 163/295 (55%), Gaps = 36/295 (12%)

Query  141  SVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQ  193
            S+K Q+ +L  ELQE+  +L+ A        ++CQ LE    AA   A +LE      +Q
Sbjct  280  SLKKQICALFKELQEAHEKLKEAELIQKKLQEKCQTLEKVNSAA---ATELEE-----KQ  331

Query  194  QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SV  249
            Q    + +L +Q +SV+A +++E+    +EK + + LQ AY++L  E    +K+     V
Sbjct  332  QLIYTIKKLELQVESVQAEVKLEQAKTQDEKTRYSSLQDAYNKLLAELTEAMKTISEMKV  391

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
               +R   + +E+L  ++  AE+AL AKQ  +D++K+   + +  +ET+ VL+AQ ++Y 
Sbjct  392  KEHDRVDKVVVEELNAKVLLAEQALAAKQLQMDEMKQLIAKQEEDLETMAVLRAQMEVYC  451

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
            +DF AER AREK+ E+KE L  QL  L +E   L+   + S  + +M+ RH         
Sbjct  452  SDFHAERAAREKIHEEKEQLAVQLAYLLKEQQNLEDLGRSS--LAEMQNRHG-------A  502

Query  370  PAPAYLSSPLALPSQRRSPPEEPPD------FCCPKCQYQAPDMDTLQIHVMECI  418
             AP    SP  +  QR +  +E P+      + CPKC+   PD+DTLQIHVM+CI
Sbjct  503  RAPDREHSPRLV--QRGTGSQEWPEQRNISIYSCPKCEEILPDLDTLQIHVMDCI  555


 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 36/51 (71%), Gaps = 0/51 (0%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEAR  101
            ++  + EN EL++A++  NQ +++R EEL  ++  Q+EE+EF   KF+EA+
Sbjct  44   MKELITENNELKEAMKLHNQAMKDRYEELSIWREKQKEEREFYETKFKEAK  94


>sp|Q8K3K8|OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn 
PE=1 SV=1
Length=584

 Score = 120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 95/300 (32%), Positives = 162/300 (54%), Gaps = 20/300 (7%)

Query  130  RCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQAR  182
            + Q+ +  +  ++  QVTSL  ELQE+ ++L  A        ++CQALE +  A   +  
Sbjct  293  KGQESVGSEVETLSIQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELN  352

Query  183  QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
            +        +Q+      +L +Q +S+ + ++ME+    EEK +LA LQ  +++L QE++
Sbjct  353  E--------KQELVYSNKKLELQVESMRSEIKMEQAKTEEEKSRLATLQATHNKLLQEHN  404

Query  243  NHIKS----SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
              +K+    +   +E+   M L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+
Sbjct  405  KALKTIEELTKQQAEKVDKMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETM  464

Query  299  PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK  358
             VL+AQ ++Y +DF AER AREK+ E+KE L  QL  L +E + ++      + +E M+ 
Sbjct  465  AVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAILLKENNDIEEGGSRQSLME-MQC  523

Query  359  RHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
            RH   +         +         Q    P   P   CPKC    PD+DTLQIHVM+CI
Sbjct  524  RHGARTSDSDQQTYLFQRGAEDRSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCI  583


 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (44%), Gaps = 38/185 (21%)

Query  30   ESPLGKPA-MLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQILRERCEEL-----  79
            E+P   P+ M+H   +   PE L    +  L EN +L++A++ +NQ ++ R EEL     
Sbjct  18   ETPGNGPSNMVHPSLDTFTPEELLQQMKELLVENHQLKEAMKLNNQAMKGRFEELSAWTE  77

Query  80   ------LHFQASQREEKEFLMCKFQEARKLVERLG---------LEKL------------  112
                  L F+   +E KE L     E  +L E LG         LE L            
Sbjct  78   KQKEERLLFEMQSKEVKERLKALTHENERLKEELGKFKEKSEKPLEDLTGGYRYPRALEE  137

Query  113  DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
            ++++ K Q  +EVEHLK    ++  +KA +   V+ L  +L    S  E +  E +  EG
Sbjct  138  EVEKLKTQVEQEVEHLKIQVMRLRAEKADLLGIVSELQLKLNSGGSS-EDSFVEIRMTEG  196

Query  173  RARAA  177
                A
Sbjct  197  ETEGA  201


>sp|Q8R5M4|OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Optn 
PE=1 SV=3
Length=585

 Score = 120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 95/289 (33%), Positives = 158/289 (55%), Gaps = 20/289 (7%)

Query  141  SVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQ  193
            ++  QV SL  ELQE+ ++L  A        ++CQALE   R  S    +L  ++E +  
Sbjct  305  TLNVQVASLFKELQEAHTKLSEAELMKKRLQEKCQALE---RKNSATPSELNEKQELVYS  361

Query  194  QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SV  249
                   +L +Q +S+ + ++ME+    EEK +LA LQ  + +L QE++  +++    + 
Sbjct  362  NR-----KLELQVESMRSEIKMEQAKTEEEKSRLATLQATHDKLLQEHNKALRTIEELTK  416

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
              +E+   +QL++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y 
Sbjct  417  QQAEKVDKVQLQELSEKLELAEQALASKQLQMDEMKQTIAKQEEDLETMAVLRAQMEVYC  476

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
            +DF AER AREK+ E+KE L  QL  L +E +  +      + +E M+ RH   +     
Sbjct  477  SDFHAERAAREKIHEEKEQLALQLAILLKENNDFEDGGSRQSLME-MQCRHGARTSDSDQ  535

Query  370  PAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
             A  +      +  Q    P   P   CPKC    PD+DTLQIHVM+CI
Sbjct  536  QAYLFQRGAEDMSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCI  584


 Score = 40.8 bits (94),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 39/192 (20%)

Query  30   ESPLGKPA-MLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQILRERCEELLHFQA  84
            E+P   P+ M+H   +   PE L    +  L EN +L++A++ +NQ ++ R EEL  +  
Sbjct  18   ETPGNGPSNMVHPNLDTFTPEELLQQMKELLVENHQLKEAMKLNNQAMKGRFEELSAWTE  77

Query  85   SQREEKEFLMCKFQEARK-----------------------------LVERLGLEKLDLK  115
             Q+EE++    + +EA++                             +  R G  + DL+
Sbjct  78   KQKEERQLFEIQSKEAKERLKALSHENERLKEELGKLKEKSERPFEDITGRCGFPRTDLE  137

Query  116  RQKEQALR----EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
            ++ EQ  R    EVEHLK   +++  +KA +   V+ L  +L    S  E +  E +  E
Sbjct  138  QEVEQLKRQVEQEVEHLKIQVRRLQAEKADLLGIVSELQLKLNSGGSS-EDSFVEIRMTE  196

Query  172  GRARAASEQARQ  183
            G A  A ++ R 
Sbjct  197  GEAEGAMKEMRN  208


>sp|Q95KA2|OPTN_MACFA Optineurin OS=Macaca fascicularis OX=9541 
GN=OPTN PE=2 SV=2
Length=571

 Score = 119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 163/293 (56%), Gaps = 32/293 (11%)

Query  141  SVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQ  193
            ++  QVTSL  ELQE+ ++L  A        ++CQALE +  A   +  +        +Q
Sbjct  295  ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELNE--------KQ  346

Query  194  QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SV  249
            +      +L +Q +S+ + ++ME+    +EK KLA LQ+ +++L QE+++ +K+    + 
Sbjct  347  ELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLAMLQLTHNKLLQEHNHALKTIEELTR  406

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
              SE+     L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y 
Sbjct  407  KESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTVLRAQMEVYC  466

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
            +DF AER AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   ++   P
Sbjct  467  SDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRH--GARTSDP  522

Query  370  PAPAYL----SSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
               AYL    +       QR  P        CPKC    PD+DTLQIHVM+CI
Sbjct  523  DQQAYLVQRGTEDRDWQQQRNIPI-----HSCPKCGEVLPDIDTLQIHVMDCI  570


 Score = 40.8 bits (94),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 61/118 (52%), Gaps = 11/118 (9%)

Query  25   DVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQILRERCEELL  80
            D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ ++ R EEL 
Sbjct  14   DSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELS  73

Query  81   HFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAED  138
             +   Q+EE++F   + +EA+   ERL    + L  + E+   E+  LK   ++ +ED
Sbjct  74   AWTEKQKEERQFFETQSKEAK---ERL----MALSHENEKLKEELGKLKGKSERSSED  124


>sp|Q861Q8|OPTN_MACMU Optineurin OS=Macaca mulatta OX=9544 GN=OPTN 
PE=1 SV=1
Length=571

 Score = 119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 163/293 (56%), Gaps = 32/293 (11%)

Query  141  SVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQ  193
            ++  QVTSL  ELQE+ ++L  A        ++CQALE +  A   +  +        +Q
Sbjct  295  ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELNE--------KQ  346

Query  194  QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SV  249
            +      +L +Q +S+ + ++ME+    +EK KLA LQ+ +++L QE+++ +K+    + 
Sbjct  347  ELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLAMLQLTHNKLLQEHNHALKTIEELTR  406

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
              SE+     L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y 
Sbjct  407  KESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTVLRAQMEVYC  466

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
            +DF AER AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   ++   P
Sbjct  467  SDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRH--GARTSDP  522

Query  370  PAPAYL----SSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
               AYL    +       QR  P        CPKC    PD+DTLQIHVM+CI
Sbjct  523  DQQAYLVQRGTEDRDWQQQRNIPI-----HSCPKCGEVLPDIDTLQIHVMDCI  570


 Score = 40.8 bits (94),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 61/118 (52%), Gaps = 11/118 (9%)

Query  25   DVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQILRERCEELL  80
            D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ ++ R EEL 
Sbjct  14   DSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELS  73

Query  81   HFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAED  138
             +   Q+EE++F   + +EA+   ERL    + L  + E+   E+  LK   ++ +ED
Sbjct  74   AWTEKQKEERQFFETQSKEAK---ERL----MALSHENEKLKEELGKLKGKSERSSED  124


>sp|Q96CV9|OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN 
PE=1 SV=3
Length=577

 Score = 116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 160/289 (55%), Gaps = 24/289 (8%)

Query  141  SVKAQVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQ  193
            ++  QVTSL  ELQE+ ++L  A        ++CQALE +  A   +  +        +Q
Sbjct  301  ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE--------KQ  352

Query  194  QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SV  249
            +      +L +Q +S+ + ++ME+    +EK KL  LQ+ +++L QE++N +K+    + 
Sbjct  353  ELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTR  412

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
              SE+     L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ +L+AQ ++Y 
Sbjct  413  KESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYC  472

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
            +DF AER AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   ++    
Sbjct  473  SDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRH--GARTSDS  528

Query  370  PAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
               AYL    A     R      P   CPKC    PD+DTLQIHVM+CI
Sbjct  529  DQQAYLVQRGAEDRDWRQ-QRNIPIHSCPKCGEVLPDIDTLQIHVMDCI  576


 Score = 40.8 bits (94),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 11/128 (9%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP       +D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA+   ERL    + L  + E+   E+  LK 
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFEIQSKEAK---ERL----MALSHENEKLKEELGKLKG  116

Query  131  CQQQMAED  138
              ++ +ED
Sbjct  117  KSERSSED  124


>sp|Q7YS99|OPTN_PIG Optineurin OS=Sus scrofa OX=9823 GN=OPTN PE=1 
SV=1
Length=574

 Score = 115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 160/290 (55%), Gaps = 31/290 (11%)

Query  145  QVTSLLGELQESQSRLEAAT-------KECQALEGRARAASEQARQLESEREALQQQHSV  197
            QVT+L  ELQE+ ++L  A        ++CQALE   R  S    +L  ++E L      
Sbjct  299  QVTTLFKELQEAHTKLSEAELMKKRLQEKCQALE---RKNSATPSELNEKQELLYNNK--  353

Query  198  QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSE  253
               +L +Q +S+ + ++ME+    EEK KL  LQ+ +++L QEY+N +K+        SE
Sbjct  354  ---KLELQVESMRSEIKMEQAKTEEEKSKLTTLQLTHNRLLQEYNNALKTIEELKRRESE  410

Query  254  RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ  313
            +   + L++L  +L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF 
Sbjct  411  KVDKVVLQELNGKLEMAEKALASKQLQMDEMKQTIAKQEKDLETMAVLRAQMEVYCSDFH  470

Query  314  AERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
            AER AREK+ E+KE L  QL  L ++ +  +      + +E M+ RH   ++A      A
Sbjct  471  AERAAREKIHEEKEQLALQLAVLLKDDNAFEEGASRQSLME-MQSRH--GARASDADQQA  527

Query  374  YLSSPLA-----LPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
            +L    A     L  Q+++     P   CPKC    PD+DTL IHV +CI
Sbjct  528  FLVQRGAEDRNWLQQQQQN----IPIHSCPKCGEVLPDIDTLLIHVTDCI  573


 Score = 39.3 bits (90),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 51/97 (53%), Gaps = 4/97 (4%)

Query  25   DVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQILRERCEELL  80
            D   E +  G P + H   +   P  L    +  L EN +L++A++ +NQ ++ R EEL 
Sbjct  14   DSPTETTGNGPPTLAHPNLDTFTPHELLQQMRELLIENHQLKEAMKLNNQAMKGRFEELS  73

Query  81   HFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ  117
             +   Q+EE+ F   + +EA++ +  L LE   LK++
Sbjct  74   AWTEKQKEERLFFETQSKEAKERLTALSLENEKLKQE  110


>sp|Q5R923|OPTN_PONAB Optineurin OS=Pongo abelii OX=9601 GN=OPTN 
PE=2 SV=1
Length=527

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 116/200 (58%), Gaps = 9/200 (5%)

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
            EK KL  LQ+ +++L +E++N +K+    +   SE+     L++L ++L+ AE+AL +KQ
Sbjct  332  EKSKLTVLQMTHNKLLREHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEQALASKQ  391

Query  279  EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
              +D++K+   + +  +ET+ VL+AQ ++Y +DF AER AREK+ E+KE L  QL  L +
Sbjct  392  LQMDEMKQTIAKQEEDLETMTVLRAQMEVYCSDFHAERAAREKIHEQKEQLALQLAVLLK  451

Query  339  EYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCP  398
            E    +   ++S  + +M+ RH   ++       AYL    A     R      P   CP
Sbjct  452  ENDAFEDGGRQS--LMEMQSRH--GARTSGADQQAYLVQRGAEDRDWRQ-QRNIPIHSCP  506

Query  399  KCQYQAPDMDTLQIHVMECI  418
            KC    PD+DTLQIHVM+CI
Sbjct  507  KCGEVLPDIDTLQIHVMDCI  526


 Score = 40.8 bits (94),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 11/128 (9%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP       +D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKEDSPTESTGNGPPYLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA+   ERL    + L  + E+   E+  LK 
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFEIQSKEAK---ERL----MALSHENEKLKEELGKLKG  116

Query  131  CQQQMAED  138
              ++ +ED
Sbjct  117  KSERSSED  124


>sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium 
discoideum OX=44689 GN=kif8 PE=2 SV=1
Length=1873

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 94/200 (47%), Gaps = 11/200 (6%)

Query  99   EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            E  +L E    E  DL +   +   E+E + + +QQ  + K     +V  L  +L+E   
Sbjct  710  EGIELFENDSEELSDLNQYISEKEEELELISKTKQQYQQMKEQFDQKVKELQSQLEEVTV  769

Query  159  RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQ  218
              + A KE    + + +   ++ +  E E+  L Q +  ++++L+ Q      + + + Q
Sbjct  770  EKDQALKELDKDKDKDKDNKDKDQYYEDEKLRLTQHYEKKLNELKQQLDQHAGSNKKDYQ  829

Query  219  AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
               + KRK            +E  + ++  +  ++R++   L+ ++ +L++ ++A   + 
Sbjct  830  RLLDLKRK-----------SEEKIDSLQQDIKDTKRQKSDLLKKMRDELKKRDDAKQTQA  878

Query  279  EVIDKLKEEAEQHKIVMETV  298
            + +D LK EA + +++++ +
Sbjct  879  KELDALKREARKTEVIIDQL  898


 Score = 34.7 bits (78),  Expect = 2.4, Method: Composition-based stats.
 Identities = 38/195 (19%), Positives = 89/195 (46%), Gaps = 21/195 (11%)

Query  145  QVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRM  204
            +++ L   + E +  LE  +K  Q  +       ++ ++L+S+ E +  +    + +L  
Sbjct  721  ELSDLNQYISEKEEELELISKTKQQYQQMKEQFDQKVKELQSQLEEVTVEKDQALKELDK  780

Query  205  QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
                 +     ++    E+ R     +   ++L Q+ D H      GS +K   +L DLK
Sbjct  781  DKDKDKDNKDKDQYYEDEKLRLTQHYEKKLNELKQQLDQH-----AGSNKKDYQRLLDLK  835

Query  265  QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE----  320
            ++ ++  ++L  +Q++ D  +++++  K         K + ++ K D   + QA+E    
Sbjct  836  RKSEEKIDSL--QQDIKDTKRQKSDLLK---------KMRDELKKRDDAKQTQAKELDAL  884

Query  321  -KLAEKKELLQEQLE  334
             + A K E++ +QL+
Sbjct  885  KREARKTEVIIDQLK  899


 Score = 33.9 bits (76),  Expect = 3.6, Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 101/201 (50%), Gaps = 12/201 (6%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E + +  ++ Q++++   Q  + L+ + EE+   +    +E +    K ++ +   +   
Sbjct  737  ELISKTKQQYQQMKEQFDQKVKELQSQLEEVTVEKDQALKELDKDKDKDKDNKDKDQYYE  796

Query  109  LEKLDLKRQKEQALREVEHL--------KRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
             EKL L +  E+ L E++          K+  Q++ + K   + ++ SL  ++++++ + 
Sbjct  797  DEKLRLTQHYEKKLNELKQQLDQHAGSNKKDYQRLLDLKRKSEEKIDSLQQDIKDTKRQK  856

Query  161  EAATKECQ-ALEGRARAASEQARQLES-EREALQQQHSVQVDQLRMQGQSVEAALRMERQ  218
                K+ +  L+ R  A   QA++L++ +REA  ++  V +DQL+ Q +  +  L+ +  
Sbjct  857  SDLLKKMRDELKKRDDAKQTQAKELDALKREA--RKTEVIIDQLKNQSKKKDLLLQKKTD  914

Query  219  AASEEKRKLAQLQVAYHQLFQ  239
             +   K+KL +++V   ++ Q
Sbjct  915  ESESYKKKLKEIEVHKQRVIQ  935


>sp|Q8IDX6|RH2A_PLAF7 Reticulocyte-binding protein homolog 2a 
OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 
SV=1
Length=3130

 Score = 44.3 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 86/172 (50%), Gaps = 16/172 (9%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKL-------DLKRQKEQALREVEHLKRCQQQMA  136
             A +R+E+E L  + +  R+  ERL  EK        +LKRQ+++ L++ E LKR +Q+  
Sbjct  2738  ALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERL  2797

Query  137   EDKASVKAQVTSLLG-ELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH  195
             + +  +K Q    L  E QE   + E   ++ Q    +  A   Q ++   + E L++Q 
Sbjct  2798  QKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ-  2856

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS  247
                 +Q R++ + +E A   ER+   + K +   +++   +L +E D  IK+
Sbjct  2857  ----EQERLERKKIELA---EREQHIKSKLESDMVKIIKDELTKEKDEIIKN  2901


 Score = 40.0 bits (92),  Expect = 0.042, Method: Composition-based stats.
 Identities = 42/185 (23%), Positives = 85/185 (46%), Gaps = 19/185 (10%)

Query  114   LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGR  173
             LKRQ+++ L++ E LKR +Q+  E +   + Q    L   ++ + + E A K     E  
Sbjct  2739  LKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKR---QEQE  2795

Query  174   ARAASEQARQLESEREALQQQHSVQ-------VDQLRMQGQSVEAALRMERQAASEEKRK  226
                  E+ ++ E ER   ++Q  +Q        +Q R+Q +        ER    EE ++
Sbjct  2796  RLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKR  2855

Query  227   LAQLQVAYHQL-FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
               Q ++   ++   E + HIKS +          ++ +K +L + ++ ++  +++  KL+
Sbjct  2856  QEQERLERKKIELAEREQHIKSKLESD------MVKIIKDELTKEKDEIIKNKDI--KLR  2907

Query  286   EEAEQ  290
                EQ
Sbjct  2908  HSLEQ  2912


 Score = 38.9 bits (89),  Expect = 0.11, Method: Composition-based stats.
 Identities = 38/147 (26%), Positives = 78/147 (53%), Gaps = 17/147 (12%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             Q  L++ +EL+   ++  ++ RE+ E+L   +  +R+E+E L  +    R+  ERL  E+
Sbjct  2744  QERLQKEEELKR--QEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEE  2801

Query  112   LDLKRQK--------EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
              +LKRQ+        ++ L++ E LKR +Q+  + + ++K Q      E +  Q   E  
Sbjct  2802  -ELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQ------EQERLQKEEELK  2854

Query  164   TKECQALEGRARAASEQARQLESEREA  190
              +E + LE +    +E+ + ++S+ E+
Sbjct  2855  RQEQERLERKKIELAEREQHIKSKLES  2881


 Score = 36.6 bits (83),  Expect = 0.58, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 7/109 (6%)

Query  253   ERKRGMQLEDLKQ-QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
             +R+   +LE  KQ QLQ+ EE    +QE + K +    Q +  ++    LK Q       
Sbjct  2754  KRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQE----  2809

Query  312   FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
              + ER+ +E+L +++EL +++ E+LQ+E   LK   QE  + E+  KR 
Sbjct  2810  -RLEREKQEQLQKEEELKRQEQERLQKE-EALKRQEQERLQKEEELKRQ  2856


>sp|Q9GYV5|NEMO_DROME NF-kappa-B essential modulator OS=Drosophila 
melanogaster OX=7227 GN=key PE=1 SV=1
Length=387

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 71/266 (27%), Positives = 113/266 (42%), Gaps = 50/266 (19%)

Query  164  TKECQALEGRARAAS-EQARQLESEREALQQQHSVQV---DQLR---MQGQSVEAALRME  216
             KECQA     R  + E  R LE++ E ++  H++++   D+LR    + QS+   +R+E
Sbjct  160  VKECQAQIAILRVENQELKRDLETKIEQIEGVHTIRLKEQDELRKSVSEKQSLIDNMRVE  219

Query  217  RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
                     KL QL  ++ +   EY    KS     E  + MQL+     + + +   + 
Sbjct  220  ID-------KLKQLNHSF-EFVPEYATESKSQ----ELIKKMQLD-----INELKARDIQ  262

Query  277  KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
            KQEVI  L+                  Q DIY+ DF+ ER  REK A +K+     L  L
Sbjct  263  KQEVIKGLQ-----------------IQNDIYRRDFEMERADREKNAGEKDQYLMDLRSL  305

Query  337  QREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS---PLALPSQRRSPPEEPP  393
            QR   +L  +  ES +           + +PL  + + L     P+  P+   S   +  
Sbjct  306  QRRNQELIEALAESHKASKACS-----TASPLSSSRSNLREEQRPILDPTGASSRTSDTT  360

Query  394  DFCCPKCQYQAPDMDTLQIHVMECIE  419
               CP C      +  LQ HV +C++
Sbjct  361  -LRCPICSKSFNALSVLQSHVNDCLD  385


>sp|Q96KP6|TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens 
OX=9606 GN=TNIP3 PE=1 SV=2
Length=325

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 58/126 (46%), Gaps = 28/126 (22%)

Query  291  HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE----QLQREYSKLKAS  346
            H+ +   + VLK Q  IY+ DF+ ER  RE+L ++KE LQ+  E    QL R  S++KA 
Sbjct  190  HEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKAC  249

Query  347  CQESARIEDMRKRHVEVSQAPLPPA----------PAYLSSPLALPSQRRSPPEE-----  391
              E  ++E       ++ Q   PP           P   + P A+  QR  PP+      
Sbjct  250  QMEKEKLEK------QLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQWYAL  303

Query  392  ---PPD  394
               PPD
Sbjct  304  DQLPPD  309


>sp|A1R0M2|MUTS_BORT9 DNA mismatch repair protein MutS OS=Borrelia 
turicatae (strain 91E135) OX=314724 GN=mutS PE=3 SV=1
Length=860

 Score = 43.5 bits (101),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/160 (23%), Positives = 76/160 (48%), Gaps = 18/160 (11%)

Query  189  EALQQQHSVQVDQLR----MQGQSVEAALRMERQAASEEKRKLAQLQV--AYHQLFQEYD  242
            E +Q  ++ ++D+LR       + V+  L  ER  +     K+ ++ V   + ++ + Y 
Sbjct  415  ELIQHGYNFEIDRLREIKNNASKYVDDYLNFERNFSKISSLKIRRINVRGLFFEVTKSYY  474

Query  243  NHIKSSVVGSE------RKRGMQLEDLKQQLQQAEEALVA-KQEVIDKLKEEAEQHKIVM  295
              + S  + S+      R +  +L +L++ +  AE+ L+A +QEV D +  +  +H +V+
Sbjct  475  GQVPSHFIESQTLNSVKRYKTNKLIELERDINDAEDNLLALEQEVFDDIASKIVKHSVVI  534

Query  296  ETVPVLKAQADIYKADF----QAERQAREKLAEKKELLQE  331
            + +    A  D+  +DF    +     R  L   KE++ E
Sbjct  535  KKIANFFAYVDV-VSDFAYLAKKNEYVRPTLTNNKEIILE  573


>sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11E3.02c 
PE=4 SV=1
Length=1237

 Score = 40.0 bits (92),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 35/148 (24%), Positives = 60/148 (41%), Gaps = 22/148 (15%)

Query  266  QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL---  322
             L      L+ K E++   +    Q +  + + P+LK  + ++K  +       EKL   
Sbjct  195  HLDMYHSKLLNKSEILSTKRVNRGQDQFDLSSFPLLKVFSSVFKVAYSKALLDAEKLFPS  254

Query  323  ------AEKKELLQEQLE-------QLQREYSKLKASCQESAR----IEDMRKRHVEVSQ  365
                  AE   +L E LE           ++S  K+     AR    +E  RK  + +S 
Sbjct  255  IDEAAIAEDIGILIEDLESDACKFSHSVVDFSNYKSYSTWKARELQTLEQHRK--IMLSL  312

Query  366  APLPPAPAYLSSPLALPSQRRSPPEEPP  393
             PL  +P +   P+  P+ R++P   PP
Sbjct  313  IPLSSSPNHPIQPIGFPASRKTPTYVPP  340


>sp|P17594|POLG_EMCVD Genome polyprotein OS=Encephalomyocarditis 
virus (strain emc-d diabetogenic) OX=12106 PE=3 SV=2
Length=2292

 Score = 38.9 bits (89),  Expect = 0.12, Method: Composition-based stats.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query  255   KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             K G+Q  D + +       +++  +VI++     E+ K V+ TV  L AQA + +  F +
Sbjct  1476  KAGLQFRDNRTK------EILSLVDVIERAVARIERKKKVLTTVQTLVAQAPVDEVSFHS  1529

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
               Q   +L  ++E   EQLE+LQ  ++K +
Sbjct  1530  VVQ---QLKARQEATDEQLEELQEAFAKTQ  1556


>sp|P17593|POLG_EMCVB Genome polyprotein OS=Encephalomyocarditis 
virus (strain emc-b nondiabetogenic) OX=12105 PE=3 SV=1
Length=2292

 Score = 38.9 bits (89),  Expect = 0.12, Method: Composition-based stats.
 Identities = 26/90 (29%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query  255   KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             K G+Q  D + +       +++  +VI++     E+ K V+ TV  L AQA + +  F +
Sbjct  1476  KAGLQFRDNRTK------EILSLVDVIERAVARIERKKKVLTTVQTLVAQAPVDEVSFHS  1529

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
               Q   +L  ++E   EQLE+LQ  ++K +
Sbjct  1530  VVQ---QLKARQEATDEQLEELQEAFAKTQ  1556


>sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein 1 OS=Plasmodium 
falciparum (isolate 3D7) OX=36329 GN=MAL7P1.162 PE=1 
SV=3
Length=5065

 Score = 38.5 bits (88),  Expect = 0.14, Method: Composition-based stats.
 Identities = 36/158 (23%), Positives = 68/158 (43%), Gaps = 30/158 (19%)

Query  138   DKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV  197
             DK +VK Q +S      + + R+     + + +   +RAA   A+ +ES    L    +V
Sbjct  3557  DKKAVKPQTSS------QIKKRINNNDWDVERINKASRAAGPLAKWVESVITFLNILETV  3610

Query  198   Q-----VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
             Q     +++L+ + +  E     +R    E ++KL Q +  Y QL               
Sbjct  3611  QPLEKEIEKLQEETKVAEDQYNEQRDIICELEKKLVQYKNDYAQLIS-------------  3657

Query  253   ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
                   Q++++KQ+++  E  +     +ID LK E E+
Sbjct  3658  ------QVQNIKQEMEMVENKIKRSINLIDNLKSEKER  3689


>sp|Q15025|TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens 
OX=9606 GN=TNIP1 PE=1 SV=2
Length=636

 Score = 37.7 bits (86),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)

Query  300  VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
            +LK Q  I++ DFQ ER  RE++ E+KE L++Q+E+LQ
Sbjct  461  LLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQ  498


>sp|Q0J9V3|KN14H_ORYSJ Kinesin-like protein KIN-14H OS=Oryza sativa 
subsp. japonica OX=39947 GN=KIN14H PE=2 SV=1
Length=788

 Score = 37.7 bits (86),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 0/89 (0%)

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
            R KEQ ++EV+ L+    Q+ ED+    +QV +L  EL   +     +TK+C++L  +  
Sbjct  291  RMKEQLMKEVDCLRIELHQIREDRDQSVSQVNTLSAELANYKELAGKSTKDCESLSVKVS  350

Query  176  AASEQARQLESEREALQQQHSVQVDQLRM  204
            A  E     + + + LQ+Q +V  ++L++
Sbjct  351  AFEETCSMQQEQIQTLQKQLAVATNKLKL  379


>sp|Q9WUU8|TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus 
OX=10090 GN=Tnip1 PE=1 SV=1
Length=647

 Score = 37.7 bits (86),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)

Query  300  VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
            +LK Q  I++ DFQ ER  RE++ E+KE L++Q+E+LQ
Sbjct  474  LLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQ  511


>sp|Q8ILR9|YPF17_PLAF7 Protein PF3D7_1417600 OS=Plasmodium falciparum 
(isolate 3D7) OX=36329 GN=PF14_0175 PE=1 SV=1
Length=4662

 Score = 37.7 bits (86),  Expect = 0.25, Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 72/154 (47%), Gaps = 6/154 (4%)

Query  58    NQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ  117
             NQ+ R    Q  ++ +ER ++    Q  + +++     + Q+ R   ERL  E+L  +R 
Sbjct  4205  NQQER---LQQERLQQERLQQE-RLQQERLQQERLQQERLQQERLQQERLQQERLQQERL  4260

Query  118   KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA  177
             +++ L++    ++ QQ++ +   + K   T+     QE  +      +   A +   +  
Sbjct  4261  QQERLQQKWEQQKIQQELYQKSHNDKESETNNSSSYQELNN--HTLQENTIAKDSMRQHI  4318

Query  178   SEQARQLESEREALQQQHSVQVDQLRMQGQSVEA  211
               + RQ E+  + LQ+ HS Q+   +M+ Q + A
Sbjct  4319  FLKTRQQENIPKELQKMHSHQLQTEKMKTQQLSA  4352


>sp|Q66765|POLG_EMCVR Genome polyprotein OS=Encephalomyocarditis 
virus (strain Rueckert) OX=2870365 PE=1 SV=1
Length=2292

 Score = 37.4 bits (85),  Expect = 0.30, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query  255   KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             K G+Q  D + +       +++  +VI++     E+ K V+ TV  L AQ  + +  F +
Sbjct  1476  KAGLQFRDNRTK------EIISLVDVIERAVARIERKKKVLTTVQTLVAQGPVDEVSFHS  1529

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
               Q   +L  +++   EQLE+LQ  ++K++
Sbjct  1530  VVQ---QLKARQQATDEQLEELQEAFAKVQ  1556


>sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Salinibacter 
ruber (strain DSM 13855 / M31) OX=309807 GN=mutS PE=3 
SV=1
Length=908

 Score = 37.4 bits (85),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 97/213 (46%), Gaps = 44/213 (21%)

Query  186  SEREALQQQHSVQVDQLRM---QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY-  241
            SE   ++  +S ++D+LR    +G+   A L  E      E+  +  L+V ++++F  Y 
Sbjct  432  SEGGLIRDGYSEELDELRTIAQEGKDWVANLETEES----ERTDIPSLKVGFNKVFGYYI  487

Query  242  -----------DNHI-KSSVVGSERKRGMQLEDLKQQLQQAEEAL-VAKQEVIDKLKEEA  288
                       +++I K ++V SER    +L+++++++  AEE +   +QE+ ++L+ + 
Sbjct  488  EVTNTHADKVPEDYIRKQTLVDSERYVTPELKEMEEKILTAEEKIETLEQELFNELRSQI  547

Query  289  EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
             Q   +++    L A  D +             LAE  E         Q +Y+  + S  
Sbjct  548  AQQTGILQENAELLAHLDCFAG-----------LAEVAE---------QHDYT--RPSVD  585

Query  349  ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
            +   I+    RH  V Q  LPP   ++ + +AL
Sbjct  586  DGLTIDIEEGRHPVVEQT-LPPGDPFIPNDMAL  617


>sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus 
OX=10090 GN=Lama2 PE=1 SV=2
Length=3118

 Score = 37.4 bits (85),  Expect = 0.35, Method: Composition-based stats.
 Identities = 53/248 (21%), Positives = 110/248 (44%), Gaps = 36/248 (15%)

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
             E   +E++HL   Q+         +  V +L+ E  E  +R    T + +     A   +
Sbjct  1609  ENTTQELKHLLSPQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTN  1668

Query  179   EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
              +A  LE   + L Q      D   +  ++V+    +  Q  + E R L +LQ    ++ 
Sbjct  1669  SRAESLEEFIKGLVQ------DAEAINEKAVQLNETLGNQDKTAE-RNLEELQKEIDRML  1721

Query  239   QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
             +E                 ++ +DL+ Q + AE+ LVA + ++ ++      +K+  E  
Sbjct  1722  KE-----------------LRSKDLQTQKEVAEDELVAAEGLLKRV------NKLFGEP-  1757

Query  299   PVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
                +AQ +  + D Q +  + + KL +  +LL+E  ++  R+ ++L A+ Q++  I + +
Sbjct  1758  ---RAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDK-TRDANRLSAANQKNMTILETK  1813

Query  358   KRHVEVSQ  365
             K  +E S+
Sbjct  1814  KEAIEGSK  1821


>sp|P03304|POLG_EMCV Genome polyprotein OS=Encephalomyocarditis 
virus OX=12104 PE=1 SV=1
Length=2290

 Score = 37.0 bits (84),  Expect = 0.37, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query  255   KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             K G+Q  D + +       +++  +VI++     E+ K V+ TV  L AQ  + +  F +
Sbjct  1474  KAGLQFRDNRTK------EIISLVDVIERAVARIERKKKVLTTVQTLVAQGPVDEVSFHS  1527

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
               Q   +L  +++   EQLE+LQ  ++K++
Sbjct  1528  VVQ---QLKARQQATDEQLEELQEAFAKVQ  1554


>sp|Q01202|MYSP_BRUMA Paramyosin OS=Brugia malayi OX=6279 PE=2 
SV=2
Length=880

 Score = 37.0 bits (84),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 81/160 (51%), Gaps = 13/160 (8%)

Query  138  DKASVKAQVTSLLG----ELQESQSRLEAATKECQALEGRA-RAASEQARQLESEREALQ  192
            D  SV   +T++      EL  +Q+ L+ ATKE  A + RA RA ++ AR +E   E  +
Sbjct  648  DLVSVNNNLTAIKNKLETELSTAQADLDEATKELHAADERANRALADAARAVEQLHE--E  705

Query  193  QQHSVQVDQLRM----QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK--  246
            Q+HS+++D LR     Q + ++   R  ++     KR +A+L+     L    D   +  
Sbjct  706  QEHSMKIDALRKSLEEQVKQLQVQFRKLKRRLLGGKRVIAKLETRIRDLETALDEETRRH  765

Query  247  SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
                G+ RK+  ++++++ Q+ +  +  V  Q+  D+L E
Sbjct  766  KETQGALRKKDRRIKEVQMQVDEEHKMFVMAQDTADRLLE  805


>sp|Q02171|MYSP_ONCVO Paramyosin OS=Onchocerca volvulus OX=6282 
PE=2 SV=1
Length=879

 Score = 37.0 bits (84),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 82/167 (49%), Gaps = 26/167 (16%)

Query  138  DKASVKAQVTSLLG----ELQESQSRLEAATKECQALEGRA-RAASEQARQLESEREALQ  192
            D  S+   +T++      EL  +Q+ L+ ATKE  A + RA RA ++ AR +E   E  +
Sbjct  648  DLVSINNNLTAIKNKLETELSTAQADLDEATKELHAADERANRALADAARAVEQLHE--E  705

Query  193  QQHSVQVD-----------QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY  241
            Q+HS+++D           QL++Q Q  EAA      A    KR +A+L+     L    
Sbjct  706  QEHSMKIDALRKSLEEQVKQLQVQIQEAEAA------ALLGGKRVIAKLETRIRDLETAL  759

Query  242  DNHIK--SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
            D   +      G+ RK+  ++++++ Q+ +  +  V  Q+  D+L E
Sbjct  760  DEETRRHKETQGALRKKDRRIKEVQMQVDEEHKMFVMAQDTADRLLE  806


>sp|P13392|MYSP_DIRIM Paramyosin (Fragment) OS=Dirofilaria immitis 
OX=6287 PE=2 SV=2
Length=848

 Score = 36.6 bits (83),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 82/167 (49%), Gaps = 26/167 (16%)

Query  138  DKASVKAQVTSLLG----ELQESQSRLEAATKECQALEGRA-RAASEQARQLESEREALQ  192
            D  S+   +T++      EL  +Q+ L+ ATKE  A + RA RA ++ AR +E   E  +
Sbjct  621  DLVSINNNLTAIKNKLETELSTAQADLDEATKELHAADERANRALADAARAVEQLHE--E  678

Query  193  QQHSVQVD-----------QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY  241
            Q+HS+++D           QL++Q Q  EAA      A    KR +A+L+     L    
Sbjct  679  QEHSMKIDALRKSLEEQVKQLQVQIQEAEAA------ALLGGKRVIAKLETRIRDLETAL  732

Query  242  DNHIK--SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
            D   +      G+ RK+  ++++++ Q+ +  +  V  Q+  D+L E
Sbjct  733  DEETRRHKETQGALRKKDRRIKEVQMQVDEEHKMFVMAQDTADRLLE  779


>sp|Q9KS12|MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin 
OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / 
El Tor Inaba N16961) OX=243277 GN=rtxA PE=1 SV=2
Length=4558

 Score = 36.6 bits (83),  Expect = 0.58, Method: Composition-based stats.
 Identities = 47/183 (26%), Positives = 82/183 (45%), Gaps = 17/183 (9%)

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
             A + + +A   R R   E+ +QL++   +  Q  S     L   GQ+   A++ E +A +
Sbjct  1633  ALSDKERAEADRQRLEQEKQKQLDAVAGSQSQLESTDQQALENNGQAQRDAVKEESEAVT  1692

Query  222   EEKRKLAQ-LQV----AYH--QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
              E  KLAQ L V    A H  +   ++ N     ++   +    QL+D KQ     ++  
Sbjct  1693  AELAKLAQGLDVLDGQATHTGESGDQWRNDFAGGLLDGVQS---QLDDAKQLAN--DKIA  1747

Query  275   VAKQEVID---KLKEEAEQHKIVMETVPVLKA--QADIYKADFQAERQAREKLAEKKELL  329
              AKQ + D   K+KE   + +  +      +A  + DI  A   AE++  + LA+ K+  
Sbjct  1748  AAKQTLSDNNSKVKESVAKSEAGVAQGEQNRAGVEQDIADAQADAEKRKADALAKGKDAQ  1807

Query  330   QEQ  332
             Q +
Sbjct  1808  QAE  1810


>sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotoga 
mobilis (strain DSM 10674 / SJ95) OX=403833 GN=mutS PE=3 
SV=1
Length=817

 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 77/146 (53%), Gaps = 15/146 (10%)

Query  190  ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY--------  241
             +++  S ++D+ R    +++  L+ + +   +EK K++ L+V  ++++  Y        
Sbjct  414  VIKEGVSGELDEYRNLFNNLDGVLK-DIEKREKEKTKISSLKVGRNKIYGFYIEVSKAQS  472

Query  242  ----DNHI-KSSVVGSERKRGMQLEDLKQQLQQAEEAL-VAKQEVIDKLKEEAEQHKIVM  295
                DN++ K ++V +ER    +LE+++Q+L  +EE + V ++++ DK+     Q+   +
Sbjct  473  SKVPDNYVRKQTLVNTERYTIKELEEVEQRLALSEEKIKVIEKDIYDKVLTHLSQYVDKI  532

Query  296  ETVPVLKAQADIYKADFQAERQAREK  321
            E +    A+ D++++  +  R    K
Sbjct  533  EKLSNKIAELDVFRSFAEVSRVYNYK  558


>sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum 
OX=44689 GN=mhcA PE=1 SV=3
Length=2116

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 69/248 (28%), Positives = 116/248 (47%), Gaps = 44/248 (18%)

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV---TSLLGELQESQSRLEAATKECQA  169
             DL+ + E+A REV  + R ++++  D   +  Q+   T    ++++S+ +LE    E +A
Sbjct  1572  DLEAKVEEAQREVVTIDRLKKKLESDIIDLSTQLDTETKSRIKIEKSKKKLEQTLAERRA  1631

Query  170   LE-GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              E G ++AA E+ R+          Q   +VD+LR Q  S  AAL      ASE+K K  
Sbjct  1632  AEEGSSKAADEEIRK----------QVWQEVDELRAQLDSERAALN-----ASEKKIK--  1674

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED---LKQQLQQAEEAL-VAKQEVIDKL  284
                                S+V    +   QLED    K +L +A+ AL V  +EV D+L
Sbjct  1675  -------------------SLVAEVDEVKEQLEDEILAKDKLVKAKRALEVELEEVRDQL  1715

Query  285   KEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
             +EE +    + ++   L  + +  K  + AE +   KL E K+ L + ++ L+++    K
Sbjct  1716  EEEEDSRSELEDSKRRLTTEVEDIKKKYDAEVEQNTKLDEAKKKLTDDVDTLKKQLEDEK  1775

Query  345   ASCQESAR  352
                 ES R
Sbjct  1776  KKLNESER  1783


>sp|Q9C438|ATG11_PICPA Autophagy-related protein 11 (Fragment) 
OS=Komagataella pastoris OX=4922 GN=ATG11 PE=3 SV=1
Length=1313

 Score = 35.4 bits (80),  Expect = 1.3, Method: Composition-based stats.
 Identities = 48/202 (24%), Positives = 89/202 (44%), Gaps = 28/202 (14%)

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             LE+   +R  E+  +E+ HLK  ++   +++     ++  L+    + Q RLEA  K+ Q
Sbjct  838   LEQTSKERDDEREQKEILHLKLMKR---DEEGDEDEKINGLVAANHQLQIRLEALQKQNQ  894

Query  169   ALEG-RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME--------RQA  219
              L+  + R  +E     E E EAL++Q  VQ+ + + Q    +  L +          +A
Sbjct  895   ELQSLQERNNNEIHASQEREIEALKKQ-VVQLTEEKTQMSDEKDRLDLSNEHWKTQYEEA  953

Query  220   ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK---QQLQQAEEALVA  276
             A  +K  L  +     +   E + HIK            ++EDLK   + L+  E  L+ 
Sbjct  954   AMMKKDLLDNMTAQEQEYKNELNTHIK------------EVEDLKVKVENLEDEEANLIE  1001

Query  277   KQEVIDKLKEEAEQHKIVMETV  298
              +E  +    + E H   +E++
Sbjct  1002  IKENYESKLAQNESHFEELESI  1023


>sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus 
OX=10090 GN=Eea1 PE=1 SV=2
Length=1411

 Score = 35.0 bits (79),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 112/233 (48%), Gaps = 25/233 (11%)

Query  114   LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGR  173
             L+ Q E AL+E E LK+  ++  E    +K ++ S+ GE+ ++Q+ L+   K+ Q L+G 
Sbjct  901   LQVQAESALKEQEDLKKSLEKEKETSQQLKIELNSVKGEVSQAQNTLKQKEKDEQQLQGT  960

Query  174   ARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVA  233
                  + A Q + + EALQ +    V Q  +    ++       Q  + EK KL+ LQ  
Sbjct  961   INQLKQSAEQKKKQIEALQGEVKNAVSQKTVLENKLQQQSSQAAQELAAEKGKLSALQSN  1020

Query  234   YHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL-VAKQEVIDKLKEEAEQHK  292
             Y +   +    ++S + G E     +L   +Q L+  EE L +A++++I    +   Q+K
Sbjct  1021  YEKCQADL-KQLQSDLYGKES----ELLATRQDLKSVEEKLTLAQEDLISNRNQIGNQNK  1075

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKE-LLQEQ---LEQLQREYS  341
              + E                QA + + E+ + KKE LL+EQ   LE  QRE S
Sbjct  1076  SIQE---------------LQAAKASLEQDSAKKEALLKEQSKALEDAQREKS  1113


>sp|A5A6M5|K1H1_PANTR Keratin, type I cuticular Ha1 OS=Pan troglodytes 
OX=9598 GN=KRT31 PE=2 SV=1
Length=416

 Score = 33.9 bits (76),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 57/265 (22%), Positives = 117/265 (44%), Gaps = 37/265 (14%)

Query  81   HFQASQREEKEFLMCKFQEARKLVE----RLGLEKLDLKRQKEQALR-----EVEHLKRC  131
            +F+  +  +++ L  K + AR +V+    +L  +    K Q E +LR     ++  L+R 
Sbjct  106  YFKTIEELQQKILCTKSENARLVVQIDNAKLAADDFRTKYQTELSLRQLVESDINGLRRI  165

Query  132  QQQMAEDKASVKAQVTSLLGEL--QESQSRLEAATKECQ-----ALEGRARAASEQARQL  184
              ++   K+ ++AQV SL  EL   +S    E  T  CQ      +E  A    +  R L
Sbjct  166  LDELTLCKSDLEAQVESLKEELLCLKSNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNRVL  225

Query  185  -----------ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV-  232
                       E+ R  ++Q  + Q ++L  Q  S    L+  +    E +R +  L++ 
Sbjct  226  NETRSQYEALVETNRREVEQWFTTQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIE  285

Query  233  --AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              A H L    +N    ++  SE +   QL  ++  +   E  L    E+   L+ + ++
Sbjct  286  LQAQHNLRDSLEN----TLTESEARYSSQLSQVQSLITNVESQLA---EIRSDLERQNQE  338

Query  291  HKIVMETVPVLKAQADIYKADFQAE  315
            ++++++    L+ + + Y++  ++E
Sbjct  339  YQVLLDVRARLECEINTYRSLLESE  363


>sp|B4EV93|SYS_PROMH Serine--tRNA ligase OS=Proteus mirabilis 
(strain HI4320) OX=529507 GN=serS PE=3 SV=1
Length=429

 Score = 33.9 bits (76),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 48/88 (55%), Gaps = 4/88 (5%)

Query  212  ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
             L +E+    EE+RK+  LQV    L  E ++  KS  +G+ + RG  +E L+Q++ Q  
Sbjct  24   TLDVEKIRQQEERRKV--LQVETESLQAERNSRSKS--IGAAKARGEDIEPLRQEVNQLG  79

Query  272  EALVAKQEVIDKLKEEAEQHKIVMETVP  299
            E L A +  +DKL+ +   + + +  +P
Sbjct  80   EKLEAAKAELDKLQADIRDYALTLPNLP  107


>sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens 
OX=9606 GN=KRT31 PE=1 SV=3
Length=416

 Score = 33.9 bits (76),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 57/265 (22%), Positives = 117/265 (44%), Gaps = 37/265 (14%)

Query  81   HFQASQREEKEFLMCKFQEARKLVE----RLGLEKLDLKRQKEQALR-----EVEHLKRC  131
            +F+  +  +++ L  K + AR +V+    +L  +    K Q E +LR     ++  L+R 
Sbjct  106  YFKTIEELQQKILCTKSENARLVVQIDNAKLAADDFRTKYQTELSLRQLVESDINGLRRI  165

Query  132  QQQMAEDKASVKAQVTSLLGEL--QESQSRLEAATKECQ-----ALEGRARAASEQARQL  184
              ++   K+ ++AQV SL  EL   +S    E  T  CQ      +E  A    +  R L
Sbjct  166  LDELTLCKSDLEAQVESLKEELLCLKSNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNRVL  225

Query  185  -----------ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV-  232
                       E+ R  ++Q  + Q ++L  Q  S    L+  +    E +R +  L++ 
Sbjct  226  NETRSQYEALVETNRREVEQWFTTQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIE  285

Query  233  --AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              A H L    +N    ++  SE +   QL  ++  +   E  L    E+   L+ + ++
Sbjct  286  LQAQHNLRDSLEN----TLTESEARYSSQLSQVQSLITNVESQLA---EIRSDLERQNQE  338

Query  291  HKIVMETVPVLKAQADIYKADFQAE  315
            ++++++    L+ + + Y++  ++E
Sbjct  339  YQVLLDVRARLECEINTYRSLLESE  363


>sp|P08928|LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster OX=7227 
GN=Lam PE=1 SV=4
Length=622

 Score = 33.9 bits (76),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 43/98 (44%), Gaps = 6/98 (6%)

Query  89   EKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS  148
            E   L  + Q  R  V R   E  ++K   E  L E    +R     A D+A  +  +  
Sbjct  78   ENSRLTIEVQTTRDTVTR---ETTNIKNIFEAELLET---RRLLDDTARDRARAEIDIKR  131

Query  149  LLGELQESQSRLEAATKECQALEGRARAASEQARQLES  186
            L  E +E +++L+  TKEC   EG  R    +A +L +
Sbjct  132  LWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNN  169


>sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 
PE=1 SV=4
Length=1960

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 61/107 (57%), Gaps = 7/107 (7%)

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             Q+ +LK QL + EE L   Q  + +++EEA Q  + ++ +  L+ Q    + D ++ER +
Sbjct  1070  QIAELKMQLAKKEEEL---QAALARVEEEAAQKNMALKKIRELETQISELQEDLESERAS  1126

Query  319   REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR-KRHVEVS  364
             R K  ++K  L E+LE L+ E   L+ +   +A  +++R KR  EVS
Sbjct  1127  RNKAEKQKRDLGEELEALKTE---LEDTLDSTAAQQELRSKREQEVS  1170


>sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 
GN=MYH9 PE=2 SV=1
Length=1960

 Score = 33.5 bits (75),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 65/128 (51%), Gaps = 29/128 (23%)

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             Q+ +LK QL + EE L   Q  + +++EEA Q  + ++ +  L++Q    + D ++ER +
Sbjct  1070  QIAELKMQLAKKEEEL---QAALARVEEEATQKNMALKKIRELESQISELQEDLESERAS  1126

Query  319   REKLAEKKELLQEQLEQL---------------------QREYSKLKASCQESAR-----  352
             R K  ++K  L E+LE L                     ++E + LK + +E AR     
Sbjct  1127  RNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEARTHEAQ  1186

Query  353   IEDMRKRH  360
             I++MR++H
Sbjct  1187  IQEMRQKH  1194


>sp|Q8BQP8|RFIP4_MOUSE Rab11 family-interacting protein 4 OS=Mus 
musculus OX=10090 GN=Rab11fip4 PE=1 SV=1
Length=635

 Score = 33.1 bits (74),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 11/111 (10%)

Query  253  ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ--------HKIVMETVPVLKAQ  304
            ER++  +LE L  ++QQ EE     +  + +LK + E+           + +T   LK +
Sbjct  411  EREKSTELELLNTRVQQLEEENTDLRTTVARLKSQTEKLDEERQRMSDRLEDTSLRLKDE  470

Query  305  ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL---KASCQESAR  352
             D+YK      RQ R +  +++E  QE +E L+RE   L   K  C+   R
Sbjct  471  MDLYKRMMDKLRQNRLEFQKEREATQELIEDLRRELEHLQMYKLDCERPGR  521


>sp|Q91FL1|313L_IIV6 Putative KilA-N domain-containing protein 
313L OS=Invertebrate iridescent virus 6 OX=176652 GN=IIV6-313L 
PE=3 SV=1
Length=358

 Score = 32.7 bits (73),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 52/92 (57%), Gaps = 14/92 (15%)

Query  75   RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQ  134
            R +EL++  AS+R+E+  L     E+  L++ +G+E  D+K Q  + L EV  L+     
Sbjct  167  RIDELIY--ASKRQEQMLL-----ESHNLLKSMGIEVKDIKEQNNELLNEVGELR-----  214

Query  135  MAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
              ED   ++ QV ++  ++Q+ Q +LE + ++
Sbjct  215  --EDNNELQEQVENVQEQIQKVQVKLEISVED  244


>sp|P50748|KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo 
sapiens OX=9606 GN=KNTC1 PE=1 SV=1
Length=2209

 Score = 33.1 bits (74),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 19/125 (15%)

Query  275   VAKQEVIDKLKE-EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKEL--LQE  331
             +A QE  D  KE +A +  +   +V +LK   DI K + Q + +  E L   KE+  LQE
Sbjct  936   LALQEEPDHSKEGKAWRMSVAKTSVDILKILCDIQKDNLQKKDECEEMLKLFKEVASLQE  995

Query  332   QLEQLQR--EYSKLKASCQESARIEDMRKRHV---EVSQAPLPPAPAYLSSPLALPSQRR  386
               E      +YS        S+ + D+R++H+   EV+QA   P     S+P  + ++ R
Sbjct  996   NFEVFLSFEDYSN-------SSLVADLREQHIKAHEVAQAKHKPG----STPEPIAAEVR  1044

Query  387   SPPEE  391
             SP  E
Sbjct  1045  SPSME  1049


>sp|B3DGU2|RFP4B_DANRE Rab11 family-interacting protein 4B OS=Danio 
rerio OX=7955 GN=rab11fip4b PE=2 SV=1
Length=502

 Score = 32.7 bits (73),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 64/136 (47%), Gaps = 23/136 (17%)

Query  209  VEAALRMERQAASE-EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
            +E  LR  R A    EK K  Q+++  ++L Q  D + K +         M +  LK Q 
Sbjct  262  MEDELRRHRDAYIRLEKDKNTQIELLRNRLHQLEDENGKMA---------MNMNRLKSQT  312

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
            ++ +E    KQ + DKL++          T   LK + D+YK      RQ R++   +++
Sbjct  313  EKLDEE---KQRMTDKLED----------TSLRLKDEMDLYKKMMDKLRQNRQEFQRERD  359

Query  328  LLQEQLEQLQREYSKL  343
             +QE +E L+RE   L
Sbjct  360  TMQELIEDLRRELEHL  375


>sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 
PE=1 SV=4
Length=1960

 Score = 33.1 bits (74),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 62/107 (58%), Gaps = 7/107 (7%)

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             Q+ +LK QL + EE L   Q  + +++EEA Q  + ++ +  L++Q    + D ++ER +
Sbjct  1070  QIAELKMQLAKKEEEL---QAALARVEEEAAQKNMALKKIRELESQISELQEDLESERAS  1126

Query  319   REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR-KRHVEVS  364
             R K  ++K  L E+LE L+ E   L+ +   +A  +++R KR  EV+
Sbjct  1127  RNKAEKQKRDLGEELEALKTE---LEDTLDSTAAQQELRSKREQEVN  1170


>sp|P75310|Y474_MYCPN Uncharacterized protein MG328 homolog OS=Mycoplasma 
pneumoniae (strain ATCC 29342 / M129 / Subtype 1) 
OX=272634 GN=MPN_474 PE=4 SV=1
Length=1033

 Score = 32.7 bits (73),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 46/91 (51%), Gaps = 8/91 (9%)

Query  153  LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHS-----VQV-DQLRMQG  206
            LQES ++++A   E Q        A+ Q + L S  E LQ  H+     +QV +Q+ ++ 
Sbjct  831  LQESYNKVKAELNEIQI--TNLNEANAQYQDLLSAYELLQSNHNKLKQELQVLNQVNLEK  888

Query  207  QSVEAALRMERQAASEEKRKLAQLQVAYHQL  237
            Q +   L    Q+ S+   +L QLQ AY+ L
Sbjct  889  QQLAQKLHNTHQSLSQTHAELTQLQAAYNNL  919


>sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 
PE=1 SV=3
Length=1961

 Score = 33.1 bits (74),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 7/107 (7%)

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             Q+ +LK QL + EE L   Q  + +++EEA Q  + ++ +  L+ Q    + D ++ER  
Sbjct  1070  QIAELKMQLAKKEEEL---QAALARVEEEAAQKNMALKKIRELETQISELQEDLESERAC  1126

Query  319   REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR-KRHVEVS  364
             R K  ++K  L E+LE L+ E   L+ +   +A  +++R KR  EVS
Sbjct  1127  RNKAEKQKRDLGEELEALKTE---LEDTLDSTAAQQELRSKREQEVS  1170


>sp|Q8CP76|EBH_STAES Extracellular matrix-binding protein ebh 
OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) 
OX=176280 GN=ebh PE=4 SV=1
Length=9439

 Score = 32.7 bits (73),  Expect = 7.8, Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 92/231 (40%), Gaps = 34/231 (15%)

Query  153   LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
             LQ+S     + T   +A      A  ++A Q+      + +     V Q+  +   VE A
Sbjct  2752  LQQSLDNQPSTTGMTEATIQNYNAKRQKAEQVIQNANKIIENAQPSVQQVSDEKSKVEQA  2811

Query  213   LRMERQAASEEKRKLAQLQVAYHQL--------------------FQEYDNHIKSSVVGS  252
             L     A S  +    +LQ AY+QL                    +Q++ N + S+   +
Sbjct  2812  LSELNNAKSALRADKQELQQAYNQLIQPTDLNNKKPASITAYNQRYQQFSNELNSTKTNT  2871

Query  253   ERKRGMQ-------------LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP  299
             +R    Q             + +++Q+L +A  AL+  +E    L    EQ +  ++ VP
Sbjct  2872  DRILKEQNPSVADVNNALNKVREVQQKLNEA-RALLQNKEDNSALVRAKEQLQQAVDQVP  2930

Query  300   VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
               +      K D+ +++QA ++   K + + +  +   ++ S  K + + +
Sbjct  2931  STEGMTQQTKDDYNSKQQAAQQEISKAQQVIDNGDATTQQISNAKTNVERA  2981


>sp|Q5HPA2|EBH_STAEQ Extracellular matrix-binding protein ebh 
OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 
GN=ebh PE=1 SV=2
Length=9439

 Score = 32.7 bits (73),  Expect = 7.8, Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 92/231 (40%), Gaps = 34/231 (15%)

Query  153   LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
             LQ+S     + T   +A      A  ++A Q+      + +     V Q+  +   VE A
Sbjct  2752  LQQSLDNQPSTTGMTEATIQNYNAKRQKAEQVIQNANKIIENAQPSVQQVSDEKSKVEQA  2811

Query  213   LRMERQAASEEKRKLAQLQVAYHQL--------------------FQEYDNHIKSSVVGS  252
             L     A S  +    +LQ AY+QL                    +Q++ N + S+   +
Sbjct  2812  LSELNNAKSALRADKQELQQAYNQLIQPTDLNNKKPASITAYNQRYQQFSNELNSTKTNT  2871

Query  253   ERKRGMQ-------------LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP  299
             +R    Q             + +++Q+L +A  AL+  +E    L    EQ +  ++ VP
Sbjct  2872  DRILKEQNPSVADVNNALNKVREVQQKLNEA-RALLQNKEDNSALVRAKEQLQQAVDQVP  2930

Query  300   VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
               +      K D+ +++QA ++   K + + +  +   ++ S  K + + +
Sbjct  2931  STEGMTQQTKDDYNSKQQAAQQEISKAQQVIDNGDATTQQISNAKTNVERA  2981


>sp|Q6PA15|CCD22_XENLA Coiled-coil domain-containing protein 22 
OS=Xenopus laevis OX=8355 GN=ccdc22 PE=2 SV=1
Length=632

 Score = 32.7 bits (73),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (47%), Gaps = 32/137 (23%)

Query  251  GSERKRGMQL------------EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
            GS++K+G +               LK+Q+Q+A E L  K    D    +AEQ +I     
Sbjct  289  GSDQKKGSRFTRTQRFTYQQDPHTLKEQMQRAAEILPKK----DAQDADAEQQEI-----  339

Query  299  PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              L+ Q D  + + +        L+E  +LLQ  + Q++ E + +  SC+E A +  ++K
Sbjct  340  SSLQEQIDSIEQEIRG-------LSESNKLLQLTIGQVEGEVNDMHQSCEEKANVVRVKK  392

Query  359  RHVEVSQAPLPPAPAYL  375
            R VE+    LP A   L
Sbjct  393  RAVEL----LPDADNNL  405



Lambda      K        H        a         alpha
   0.313    0.126    0.343    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 40880945836
Results from round 2


Query= sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens
OX=9606 GN=IKBKG PE=1 SV=2

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value
Sequences used in model and found again:

sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapie...  396     7e-135
sp|Q95KU9|NEMO_BOVIN NF-kappa-B essential modulator OS=Bos taurus...  394     4e-134
sp|A9QT41|NEMO_PIG NF-kappa-B essential modulator OS=Sus scrofa O...  389     5e-132
sp|Q6TMG5|NEMO_RAT NF-kappa-B essential modulator OS=Rattus norve...  381     3e-129
sp|O88522|NEMO_MOUSE NF-kappa-B essential modulator OS=Mus muscul...  366     2e-123
sp|Q8K3K8|OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn ...  238     2e-71 
sp|Q8R5M4|OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Op...  234     8e-70 
sp|Q96CV9|OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN P...  232     4e-69 
sp|Q95KA2|OPTN_MACFA Optineurin OS=Macaca fascicularis OX=9541 GN...  229     3e-68 
sp|Q861Q8|OPTN_MACMU Optineurin OS=Macaca mulatta OX=9544 GN=OPTN...  228     8e-68 
sp|Q7YS99|OPTN_PIG Optineurin OS=Sus scrofa OX=9823 GN=OPTN PE=1 ...  226     5e-67 
sp|Q5RI56|OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn PE...  223     1e-66 
sp|Q5M7B7|OPTN_XENLA Optineurin OS=Xenopus laevis OX=8355 GN=optn...  214     7e-63 
sp|Q90Z16|OPTN_CHICK Optineurin OS=Gallus gallus OX=9031 GN=OPTN ...  205     5e-59 
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium d...  191     4e-52 
sp|Q5R923|OPTN_PONAB Optineurin OS=Pongo abelii OX=9601 GN=OPTN P...  177     5e-49 

Sequences not found previously or not previously below threshold:

sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta O...  69.9    2e-11
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=...  69.9    2e-11
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta O...  69.5    2e-11
sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=...  69.5    3e-11
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS...  67.9    9e-11
sp|Q92614|MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapien...  67.9    9e-11
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha ...  66.0    4e-10
sp|Q9JMH9|MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculu...  65.2    6e-10
sp|Q9GYV5|NEMO_DROME NF-kappa-B essential modulator OS=Drosophila...  63.7    8e-10
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma ...  63.7    2e-09
sp|D3ZFD0|MY18A_RAT Unconventional myosin-XVIIIa OS=Rattus norveg...  64.1    2e-09
sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis...  62.9    3e-09
sp|A2BGD5|CACO1_DANRE Calcium-binding and coiled-coil domain-cont...  62.5    3e-09
sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 ...  61.4    1e-08
sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus OX=10116 GN=My...  61.4    1e-08
sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus OX=9913 GN=MYH10 PE...  61.0    1e-08
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1...  61.0    1e-08
sp|A0A287B8J2|DCTN1_PIG Dynactin subunit 1 OS=Sus scrofa OX=9823 ...  60.6    2e-08
sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 ...  60.2    2e-08
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 ...  60.2    2e-08
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=...  60.2    2e-08
sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10...  60.2    2e-08
sp|O14157|MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosacchar...  60.2    2e-08
sp|P02469|LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=1...  60.2    2e-08
sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus OX=10090 GN=Myh14...  60.2    3e-08
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090...  59.9    3e-08
sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate ...  59.9    3e-08
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9...  59.9    3e-08
sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo s...  59.9    3e-08
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus OX=9031...  59.5    3e-08
sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800...  58.7    6e-08
sp|Q6P9Q6|FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX...  58.7    6e-08
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE...  58.7    6e-08
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus OX=9986 ...  58.7    7e-08
sp|Q60902|EP15R_MOUSE Epidermal growth factor receptor substrate ...  58.3    8e-08
sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 G...  58.3    9e-08
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec ...  58.3    1e-07
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=C...  58.3    1e-07
sp|Q5T1M5|FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX...  57.9    1e-07
sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX...  57.9    1e-07
sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle OS=...  57.9    1e-07
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan ...  57.5    2e-07
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=...  57.5    2e-07
sp|P49824|MYH7_CANLF Myosin-7 OS=Canis lupus familiaris OX=9615 G...  57.2    2e-07
sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE...  57.2    2e-07
sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 PE...  57.2    2e-07
sp|P07942|LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9...  57.2    2e-07
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10...  56.8    3e-07
sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculus...  56.8    3e-07
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Ca...  56.8    3e-07
sp|Q15025|TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapie...  56.4    3e-07
sp|O65272|KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=A...  56.4    3e-07
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7...  56.8    3e-07
sp|E9Q557|DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp ...  56.8    3e-07
sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B ...  56.4    3e-07
sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP P...  56.4    3e-07
sp|Q61897|KT33B_MOUSE Keratin, type I cuticular Ha3-II OS=Mus mus...  55.6    3e-07
sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus OX...  56.4    3e-07
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11...  56.4    4e-07
sp|P13538|MYSS_CHICK Myosin heavy chain, skeletal muscle, adult O...  56.0    5e-07
sp|Q00174|LAMA_DROME Laminin subunit alpha OS=Drosophila melanoga...  56.0    5e-07
sp|P25391|LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=...  55.6    6e-07
sp|P02565|MYH1B_CHICK Myosin-1B OS=Gallus gallus OX=9031 GN=MYH1B...  55.6    6e-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus re...  55.6    7e-07
sp|Q9JIR0|RIMB1_RAT Peripheral-type benzodiazepine receptor-assoc...  55.6    7e-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus mu...  55.6    7e-07
sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus OX=10090 GN=Myh8 PE...  55.6    7e-07
sp|Q7SZL5|MTUS1_XENLA Microtubule-associated tumor suppressor 1 h...  55.6    7e-07
sp|Q6A028|SWP70_MOUSE Switch-associated protein 70 OS=Mus musculu...  54.8    8e-07
sp|Q9JI55|PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=...  55.6    8e-07
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protei...  55.2    8e-07
sp|F1LMV6|DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 GN=D...  55.2    8e-07
sp|O95153|RIMB1_HUMAN Peripheral-type benzodiazepine receptor-ass...  55.2    9e-07
sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 ...  55.2    9e-07
sp|E9Q9R9|DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=100...  55.2    9e-07
sp|Q8NFZ5|TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapie...  54.5    9e-07
sp|F4IAR2|KN14O_ARATH Kinesin-like protein KIN-14O OS=Arabidopsis...  54.8    9e-07
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protei...  54.8    1e-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caball...  55.2    1e-06
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protei...  54.8    1e-06
sp|Q076A4|MYH8_CANLF Myosin-8 OS=Canis lupus familiaris OX=9615 G...  54.8    1e-06
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musc...  54.8    1e-06
sp|Q7TNF8|RIMB1_MOUSE Peripheral-type benzodiazepine receptor-ass...  54.8    1e-06
sp|Q9EP53|TSC1_MOUSE Hamartin OS=Mus musculus OX=10090 GN=Tsc1 PE...  54.8    1e-06
sp|Q076A3|MYH13_CANLF Myosin-13 OS=Canis lupus familiaris OX=9615...  54.5    1e-06
sp|Q6A163|K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sap...  54.1    1e-06
sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus OX=10036 GN...  54.5    1e-06
sp|A0A8M9PQ61|DESPB_DANRE Desmoplakin-B OS=Danio rerio OX=7955 GN...  54.5    1e-06
sp|Q8BWY9|CIP2A_MOUSE Protein CIP2A OS=Mus musculus OX=10090 GN=C...  54.1    2e-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus m...  54.5    2e-06
sp|Q6ZQQ6|WDR87_HUMAN WD repeat-containing protein 87 OS=Homo sap...  54.5    2e-06
sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus OX=10090 GN=Myh3 PE...  54.5    2e-06
sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus OX=10116 GN=Myh3...  54.5    2e-06
sp|Q9D180|CFA57_MOUSE Cilia- and flagella-associated protein 57 O...  54.1    2e-06
sp|Q8CGU1|CACO1_MOUSE Calcium-binding and coiled-coil domain-cont...  53.7    2e-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=I...  54.1    2e-06
sp|Q076A6|MYH1_CANLF Myosin-1 OS=Canis lupus familiaris OX=9615 G...  54.1    2e-06
sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus OX=9986 GN...  54.1    2e-06
sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6...  54.1    2e-06
sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis OX=835...  53.7    2e-06
sp|Q8TDM6|DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=960...  54.1    2e-06
sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens OX=9606 GN=MYH3 PE=...  54.1    2e-06
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculu...  53.7    2e-06
sp|Q9QYE6|GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus...  53.7    2e-06
sp|Q2KJ21|CACO1_BOVIN Calcium-binding and coiled-coil domain-cont...  53.7    2e-06
sp|P15800|LAMB2_RAT Laminin subunit beta-2 OS=Rattus norvegicus O...  53.7    2e-06
sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus OX=9913 GN=MYH2 PE=2 ...  53.7    3e-06
sp|Q8SS35|Y4A0_ENCCU Probable myosin heavy chain ECU04_1000 OS=En...  53.7    3e-06
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus OX=10090 GN=Myh11...  53.7    3e-06
sp|Q05070|Y4393_NOSS1 Uncharacterized protein alr4393 OS=Nostoc s...  53.3    3e-06
sp|Q9ZTZ7|KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=A...  53.7    3e-06
sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa OX=9823 GN=MYH1 PE=2 SV=1   53.7    3e-06
sp|Q66HR5|CACO1_RAT Calcium-binding and coiled-coil domain-contai...  53.3    3e-06
sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus OX=10090 GN=Myh6 PE...  53.7    3e-06
sp|A4IFI1|CC157_BOVIN Coiled-coil domain-containing protein 157 O...  53.3    3e-06
sp|Q8IDX6|RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=P...  53.7    3e-06
sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae OX=6238 ...  53.7    3e-06
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus OX=10090 GN=Myh4 PE...  53.7    3e-06
sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa OX=9823 GN=MYH4 PE=2 SV=1   53.3    3e-06
sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa OX=9823 GN=MYH2 PE=2 SV=1   53.3    3e-06
sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus OX=10116 GN=Myh4...  53.3    3e-06
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norveg...  53.3    3e-06
sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus OX=9796 GN=MYH1 P...  53.3    3e-06
sp|Q076A7|MYH2_CANLF Myosin-2 OS=Canis lupus familiaris OX=9615 G...  53.3    3e-06
sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus OX=10090 GN=Myh1 PE...  53.3    3e-06
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapien...  53.3    3e-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur maca...  53.3    3e-06
sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens OX=9606 GN=MYH2 PE=...  53.3    3e-06
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus nor...  53.3    4e-06
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musc...  53.3    4e-06
sp|P12882|MYH1_HUMAN Myosin-1 OS=Homo sapiens OX=9606 GN=MYH1 PE=...  53.3    4e-06
sp|Q1LWB0|TXB1A_DANRE Tax1-binding protein 1 homolog A OS=Danio r...  52.9    4e-06
sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus OX=9796 GN=MYH2 P...  53.3    4e-06
sp|Q6AW69|CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=...  53.3    4e-06
sp|Q9Z136|TSC1_RAT Hamartin OS=Rattus norvegicus OX=10116 GN=Tsc1...  52.9    4e-06
sp|Q076A5|MYH4_CANLF Myosin-4 OS=Canis lupus familiaris OX=9615 G...  52.9    4e-06
sp|Q54G21|FKBP5_DICDI FK506-binding protein 5 OS=Dictyostelium di...  52.9    4e-06
sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus ...  52.9    5e-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis neb...  52.9    5e-06
sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=...  52.9    5e-06
sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila mel...  52.9    5e-06
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda ...  52.5    5e-06
sp|Q92574|TSC1_HUMAN Hamartin OS=Homo sapiens OX=9606 GN=TSC1 PE=...  52.5    5e-06
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus ...  52.5    5e-06
sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus OX=9913 GN=MYH1 PE=2 ...  52.5    6e-06
sp|Q2QLB3|CTTB2_PLEMO Cortactin-binding protein 2 OS=Plecturocebu...  52.5    6e-06
sp|Q9BY12|SCAPE_HUMAN S phase cyclin A-associated protein in the ...  52.5    6e-06
sp|Q6DD09|CAO1B_XENLA Calcium-binding and coiled-coil domain-cont...  52.1    7e-06
sp|P15215|LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melan...  52.1    7e-06
sp|P25386|USO1_YEAST Intracellular protein transport protein USO1...  52.1    7e-06
sp|Q2KN93|CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1...  52.1    7e-06
sp|Q5AMN3|ATG11_CANAL Autophagy-related protein 11 OS=Candida alb...  52.1    7e-06
sp|Q5RD60|CACO1_PONAB Calcium-binding and coiled-coil domain-cont...  52.1    7e-06
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus...  52.1    7e-06
sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus O...  52.1    8e-06
sp|Q6IFX3|K1C40_MOUSE Keratin, type I cytoskeletal 40 OS=Mus musc...  51.8    8e-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries O...  52.1    8e-06
sp|Q0VF96|CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=...  52.1    8e-06
sp|Q0J9V3|KN14H_ORYSJ Kinesin-like protein KIN-14H OS=Oryza sativ...  51.8    8e-06
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela puto...  52.1    8e-06
sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens OX=9606 GN=MYH8 PE=...  52.1    8e-06
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizos...  52.1    8e-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix alb...  52.1    8e-06
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium d...  52.1    8e-06
sp|F4HWY6|MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 G...  52.1    8e-06
sp|Q2KN96|CYTSA_XENTR Cytospin-A OS=Xenopus tropicalis OX=8364 GN...  51.8    9e-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus ...  52.1    9e-06
sp|A7YWM2|K1C40_BOVIN Keratin, type I cytoskeletal 40 OS=Bos taur...  51.4    9e-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=I...  51.8    9e-06
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculu...  52.1    9e-06
sp|Q5I0B9|ATG16_XENTR Autophagy-related protein 16 OS=Xenopus tro...  51.8    9e-06
sp|Q99JG7|TNIP2_MOUSE TNFAIP3-interacting protein 2 OS=Mus muscul...  51.4    9e-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhync...  51.8    9e-06
sp|Q5JR59|MTUS2_HUMAN Microtubule-associated tumor suppressor can...  51.8    1e-05
sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens OX=9606 GN=MYH15 ...  51.8    1e-05
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 G...  51.8    1e-05
sp|Q5ZMJ7|CIP2A_CHICK Protein CIP2A homolog OS=Gallus gallus OX=9...  51.4    1e-05
sp|P24043|LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=...  51.8    1e-05
sp|Q9P1Z2|CACO1_HUMAN Calcium-binding and coiled-coil domain-cont...  51.4    1e-05
sp|Q6A162|K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sap...  51.0    1e-05
sp|P60469|LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=...  51.4    1e-05
sp|E9PSL7|CTRO_RAT Citron rho-interacting kinase OS=Rattus norveg...  51.8    1e-05
sp|F4K0J3|KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis t...  51.4    1e-05
sp|Q6IFW2|K1C40_RAT Keratin, type I cytoskeletal 40 OS=Rattus nor...  51.0    1e-05
sp|Q5XI63|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegic...  51.4    1e-05
sp|Q9WUU8|TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus muscul...  51.0    1e-05
sp|Q5XK92|CIP2A_XENLA Protein CIP2A homolog OS=Xenopus laevis OX=...  51.4    1e-05
sp|Q6DFL0|C102A_XENLA Coiled-coil domain-containing protein 102A ...  51.0    1e-05
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ...  51.4    1e-05
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus...  51.4    1e-05
sp|O00291|HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sap...  51.0    1e-05
sp|P28739|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidu...  51.0    1e-05
sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus...  51.4    2e-05
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boli...  51.0    2e-05
sp|O75145|LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=P...  51.0    2e-05
sp|Q9DEX1|CAO1A_XENLA Calcium-binding and coiled-coil domain-cont...  50.6    2e-05
sp|Q8VDC1|FYCO1_MOUSE FYVE and coiled-coil domain-containing prot...  51.0    2e-05
sp|Q91Z79|LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 ...  51.0    2e-05
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate ...  51.0    2e-05
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha ...  51.0    2e-05
sp|Q0VC16|TGO1_BOVIN Transport and Golgi organization protein 1 h...  51.0    2e-05
sp|G5EG17|SMC6_CAEEL Structural maintenance of chromosomes protei...  51.0    2e-05
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus ...  51.0    2e-05
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii...  51.0    2e-05
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gori...  51.0    2e-05
sp|Q9Y623|MYH4_HUMAN Myosin-4 OS=Homo sapiens OX=9606 GN=MYH4 PE=...  51.0    2e-05
sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces c...  51.0    2e-05
sp|P24790|VIM4_XENLA Vimentin-4 OS=Xenopus laevis OX=8355 GN=vim4...  50.2    2e-05
sp|P05783|K1C18_HUMAN Keratin, type I cytoskeletal 18 OS=Homo sap...  50.2    2e-05
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halotherm...  50.6    2e-05
sp|Q96MR6|CFA57_HUMAN Cilia- and flagella-associated protein 57 O...  50.6    2e-05
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus...  50.6    2e-05
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protei...  50.6    2e-05
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protei...  50.6    2e-05
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protei...  50.6    2e-05
sp|B1AVY7|KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus...  50.6    2e-05
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protei...  50.6    2e-05
sp|Q62839|GOGA2_RAT Golgin subfamily A member 2 OS=Rattus norvegi...  50.6    2e-05
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix j...  50.6    2e-05
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens...  50.6    2e-05
sp|E9Q7G0|NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus ...  50.6    2e-05
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens...  50.6    2e-05
sp|Q5R9I1|MTUS1_PONAB Microtubule-associated tumor suppressor 1 h...  50.6    3e-05
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis...  50.6    3e-05
sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Dan...  50.2    3e-05
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa...  50.2    3e-05
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoff...  50.2    3e-05
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guer...  50.2    3e-05
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sap...  50.2    3e-05
sp|Q9ESK9|RBCC1_MOUSE RB1-inducible coiled-coil protein 1 OS=Mus ...  50.2    3e-05
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protei...  50.2    3e-05
sp|P31393|PLST_CARAU Plasticin OS=Carassius auratus OX=7957 PE=2 ...  49.5    3e-05
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14...  49.8    3e-05
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus nove...  50.2    3e-05
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster O...  50.2    3e-05
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta af...  50.2    3e-05
sp|P05659|MYSN_ACACA Myosin-2 heavy chain, non muscle OS=Acantham...  50.2    3e-05
sp|P02566|MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans OX=6239 G...  50.2    3e-05
sp|P12844|MYO3_CAEEL Myosin-3 OS=Caenorhabditis elegans OX=6239 G...  50.2    4e-05
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes prote...  49.8    4e-05
sp|Q7Z406|MYH14_HUMAN Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 ...  50.2    4e-05
sp|Q674X7|KAZRN_HUMAN Kazrin OS=Homo sapiens OX=9606 GN=KAZN PE=1...  49.8    4e-05
sp|Q9ZQX8|NET1C_ARATH Protein NETWORKED 1C OS=Arabidopsis thalian...  49.8    4e-05
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma ...  49.8    4e-05
sp|P34237|CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (st...  49.5    4e-05
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leu...  49.8    4e-05
sp|Q0DV28|KINUA_ORYSJ Kinesin-like protein KIN-UA OS=Oryza sativa...  49.8    4e-05
sp|P42567|EPS15_MOUSE Epidermal growth factor receptor substrate ...  49.8    4e-05
sp|F4HRT5|CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis tha...  49.8    4e-05
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein ...  49.8    4e-05
sp|A4D0S4|LAMB4_HUMAN Laminin subunit beta-4 OS=Homo sapiens OX=9...  49.8    5e-05
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes prote...  49.5    5e-05
sp|Q6P132|TXB1B_DANRE Tax1-binding protein 1 homolog B OS=Danio r...  49.5    5e-05
sp|Q5VU43|MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4D...  49.5    5e-05
sp|P09654|VIME_CHICK Vimentin OS=Gallus gallus OX=9031 GN=VIM PE=...  49.1    5e-05
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 ...  49.1    5e-05
sp|Q5JRA6|TGO1_HUMAN Transport and Golgi organization protein 1 h...  49.5    5e-05
sp|Q7NBF9|PLPA_MYCGA Fibronectin-binding protein PlpA OS=Mycoplas...  49.1    6e-05
sp|P77338|MSCK_ECOLI Mechanosensitive channel MscK OS=Escherichia...  49.1    6e-05
sp|O45420|PLHD1_CAEEL Pleckstrin homology domain-containing famil...  49.1    6e-05
sp|Q9UKX3|MYH13_HUMAN Myosin-13 OS=Homo sapiens OX=9606 GN=MYH13 ...  49.5    6e-05
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcu...  49.1    6e-05
sp|Q54KI4|EPS15_DICDI Epidermal growth factor receptor substrate ...  49.1    6e-05
sp|O75334|LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=P...  49.1    6e-05
sp|P16952|SSPB_STRGN Agglutinin receptor OS=Streptococcus gordoni...  49.1    6e-05
sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racem...  49.1    6e-05
sp|Q8K0Y2|KT33A_MOUSE Keratin, type I cuticular Ha3-I OS=Mus musc...  48.7    6e-05
sp|F4K5J1|MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 G...  49.1    7e-05
sp|Q0KHQ5|TAO_DROME Serine/threonine-protein kinase Tao OS=Drosop...  49.1    7e-05
sp|B9FAF3|KN14E_ORYSJ Kinesin-like protein KIN-14E OS=Oryza sativ...  49.1    7e-05
sp|Q86Z98|KINH_GIBMO Kinesin heavy chain OS=Gibberella moniliform...  49.1    7e-05
sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila...  49.1    7e-05
sp|Q8TDY2|RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo...  49.1    7e-05
sp|Q9BE39|MYH7_BOVIN Myosin-7 OS=Bos taurus OX=9913 GN=MYH7 PE=1 ...  49.1    8e-05
sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa OX=9823 GN=MYH7 PE=1 SV=2   49.1    8e-05
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancym...  49.1    8e-05
sp|Q6VGS5|DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=C...  49.1    8e-05
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai1...  48.7    8e-05
sp|Q3UHD3|MTUS2_MOUSE Microtubule-associated tumor suppressor can...  48.7    9e-05
sp|Q68CZ1|FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPG...  48.7    9e-05
sp|A0A125S9M6|CYTAR_HYPEX Cytotardin OS=Hypsibius exemplaris OX=2...  48.3    9e-05
sp|Q2KN99|CYTSA_RAT Cytospin-A OS=Rattus norvegicus OX=10116 GN=S...  48.7    9e-05
sp|Q69ZS8|KAZRN_MOUSE Kazrin OS=Mus musculus OX=10090 GN=Kazn PE=...  48.7    9e-05
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protei...  48.7    9e-05
sp|Q8C0J2|A16L1_MOUSE Autophagy-related protein 16-1 OS=Mus muscu...  48.3    1e-04
sp|A5A6P3|KT33A_PANTR Keratin, type I cuticular Ha3-I OS=Pan trog...  47.9    1e-04
sp|A0A2R8QCI3|DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN...  48.7    1e-04
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sap...  48.7    1e-04
sp|Q15147|PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate pho...  48.3    1e-04
sp|Q9BXL7|CAR11_HUMAN Caspase recruitment domain-containing prote...  48.3    1e-04
sp|Q9PTG8|TACC3_XENLA Transforming acidic coiled-coil-containing ...  48.3    1e-04
sp|P19524|MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain...  48.3    1e-04
sp|Q0P5J7|KRT35_BOVIN Keratin, type I cuticular Ha5 OS=Bos taurus...  47.9    1e-04
sp|Q9LD43|ACCA_ARATH Acetyl-coenzyme A carboxylase carboxyl trans...  48.3    1e-04
sp|Q91ZV0|MIA2_MOUSE Melanoma inhibitory activity protein 2 OS=Mu...  48.3    1e-04
sp|Q8BIJ7|RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS...  47.9    1e-04
sp|Q2KN94|CYTSA_TAKRU Cytospin-A OS=Takifugu rubripes OX=31033 GN...  48.3    1e-04
sp|Q9ULD2|MTUS1_HUMAN Microtubule-associated tumor suppressor 1 O...  48.3    1e-04
sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=...  48.3    1e-04
sp|Q69ZB0|LRCC1_MOUSE Leucine-rich repeat and coiled-coil domain-...  48.3    1e-04
sp|Q13136|LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=P...  47.9    1e-04
sp|O60296|TRAK2_HUMAN Trafficking kinesin-binding protein 2 OS=Ho...  47.9    1e-04
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Cae...  47.9    1e-04
sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus OX=10036 GN...  48.3    1e-04
sp|A0JP86|LAMC1_XENTR Laminin subunit gamma-1 OS=Xenopus tropical...  47.9    1e-04
sp|Q6P3P1|TAXB1_XENTR Tax1-binding protein 1 homolog OS=Xenopus t...  47.9    1e-04
sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapi...  47.5    1e-04
sp|Q61292|LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=1...  47.9    1e-04
sp|Q94LW7|KN4B_ARATH Kinesin-like protein KIN-4B OS=Arabidopsis t...  47.9    1e-04
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapien...  47.9    1e-04
sp|Q02916|NFL_COTJA Neurofilament light polypeptide OS=Coturnix j...  47.5    2e-04
sp|Q6ZWJ1|STXB4_HUMAN Syntaxin-binding protein 4 OS=Homo sapiens ...  47.5    2e-04
sp|Q9QW07|PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosp...  47.9    2e-04
sp|Q13137|CACO2_HUMAN Calcium-binding and coiled-coil domain-cont...  47.5    2e-04
sp|Q5HZI1|MTUS1_MOUSE Microtubule-associated tumor suppressor 1 h...  47.9    2e-04
sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens...  47.9    2e-04
sp|Q21065|IFA3_CAEEL Intermediate filament protein ifa-3 OS=Caeno...  47.5    2e-04
sp|Q54T01|Y2105_DICDI Probable protein phosphatase DDB_G0282105 O...  47.5    2e-04
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35...  47.5    2e-04
sp|Q09857|USO1_SCHPO Intracellular protein transport protein uso1...  47.5    2e-04
sp|P24733|MYS_ARGIR Myosin heavy chain, striated muscle OS=Argope...  47.9    2e-04
sp|Q08014|MEDB_GIAIN Median body protein OS=Giardia intestinalis ...  47.5    2e-04
sp|Q5FWS6|KAZRN_RAT Kazrin OS=Rattus norvegicus OX=10116 GN=Kazn ...  47.5    2e-04
sp|Q8MJU9|MYH7_HORSE Myosin-7 OS=Equus caballus OX=9796 GN=MYH7 P...  47.5    2e-04
sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus...  47.5    2e-04
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus OX=10116 GN=R...  47.5    2e-04
sp|Q3TRJ4|K1C26_MOUSE Keratin, type I cytoskeletal 26 OS=Mus musc...  47.1    2e-04
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protei...  47.5    2e-04
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacte...  47.5    2e-04
sp|Q6GNT7|GOGA5_XENLA Golgin subfamily A member 5 OS=Xenopus laev...  47.5    2e-04
sp|C4Z417|MUTS2_LACE2 Endonuclease MutS2 OS=Lachnospira eligens (...  47.5    2e-04
sp|Q6PCR7|EIF3A_DANRE Eukaryotic translation initiation factor 3 ...  47.5    2e-04
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protei...  47.5    2e-04
sp|Q8IUG5|MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapien...  47.5    2e-04
sp|Q5RAC9|A16L1_PONAB Autophagy-related protein 16-1 OS=Pongo abe...  47.1    2e-04
sp|Q676U5|A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapi...  47.1    2e-04
sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens OX...  47.5    2e-04
sp|Q9Z2T6|KRT85_MOUSE Keratin, type II cuticular Hb5 OS=Mus muscu...  47.1    2e-04
sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapien...  47.1    2e-04
sp|Q61765|K1H1_MOUSE Keratin, type I cuticular Ha1 OS=Mus musculu...  46.8    2e-04
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomon...  47.5    2e-04
sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding protei...  47.1    2e-04
sp|Q07722|PLCB4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate pho...  47.1    2e-04
sp|Q92764|KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapie...  46.8    2e-04
sp|Q84TD8|FLXL2_ARATH Protein FLX-like 2 OS=Arabidopsis thaliana ...  46.8    2e-04
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoi...  47.5    2e-04
sp|A0JN62|CE120_BOVIN Centrosomal protein of 120 kDa OS=Bos tauru...  47.1    3e-04
sp|Q9PTD7|CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE...  47.1    3e-04
sp|O94488|MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosac...  47.1    3e-04
sp|Q8BSS9|LIPA2_MOUSE Liprin-alpha-2 OS=Mus musculus OX=10090 GN=...  47.1    3e-04
sp|A0A098D065|ATG11_GIBZE Autophagy-related protein 11 OS=Gibbere...  47.1    3e-04
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens...  47.1    3e-04
sp|Q8AWF4|NUF2A_XENLA Kinetochore protein Nuf2-A OS=Xenopus laevi...  46.8    3e-04
sp|Q7SXE4|GOGA5_DANRE Golgin subfamily A member 5 OS=Danio rerio ...  47.1    3e-04
sp|Q27IK6|KN12D_ARATH Kinesin-like protein KIN-12D OS=Arabidopsis...  47.1    3e-04
sp|Q8C9S4|CC186_MOUSE Coiled-coil domain-containing protein 186 O...  47.1    3e-04
sp|A2AQP0|MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b...  47.1    3e-04
sp|B1WBU8|PLHD1_RAT Pleckstrin homology domain-containing family ...  46.8    3e-04
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protei...  47.1    3e-04
sp|Q9LIQ9|BLI_ARATH Protein BLISTER OS=Arabidopsis thaliana OX=37...  46.8    3e-04
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protei...  47.1    3e-04
sp|B2RPU2|PLHD1_MOUSE Pleckstrin homology domain-containing famil...  46.8    3e-04
sp|O76009|KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sap...  46.4    3e-04
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 ...  46.8    3e-04
sp|Q6GQ71|NUF2B_XENLA Kinetochore protein Nuf2-B OS=Xenopus laevi...  46.4    3e-04
sp|P25691|K2M3_SHEEP Keratin, type II microfibrillar, component 5...  46.8    3e-04
sp|Q2KNA0|CYTSA_CANLF Cytospin-A OS=Canis lupus familiaris OX=961...  46.8    3e-04
sp|Q8K1N2|PHLB2_MOUSE Pleckstrin homology-like domain family B me...  46.8    3e-04
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protei...  46.8    3e-04
sp|Q8K2J4|CCD14_MOUSE Coiled-coil domain-containing protein 14 OS...  46.8    4e-04
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=IT...  46.8    4e-04
sp|Q2KN98|CYTSA_MOUSE Cytospin-A OS=Mus musculus OX=10090 GN=Spec...  46.8    4e-04
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7...  46.8    4e-04
sp|Q69YQ0|CYTSA_HUMAN Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC...  46.8    4e-04
sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sa...  46.4    4e-04
sp|Q2KNA1|CYTSA_PANTR Cytospin-A OS=Pan troglodytes OX=9598 GN=SP...  46.8    4e-04
sp|B1AQ75|KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus muscul...  46.4    4e-04
sp|B1LC69|MUTS2_THESQ Endonuclease MutS2 OS=Thermotoga sp. (strai...  46.4    4e-04
sp|A5IMS8|MUTS2_THEP1 Endonuclease MutS2 OS=Thermotoga petrophila...  46.4    4e-04
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=IT...  46.8    4e-04
sp|Q8GS71|KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis t...  46.4    4e-04
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegi...  46.8    4e-04
sp|G5EEK3|NOCA1_CAEEL Non-centrosomal microtubule array protein 1...  46.4    4e-04
sp|Q5UR33|YR555_MIMIV Uncharacterized protein R555 OS=Acanthamoeb...  46.4    4e-04
sp|Q6IFW3|K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus nor...  46.0    4e-04
sp|P39880|CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens ...  46.4    4e-04
sp|Q61789|LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus OX=...  46.8    4e-04
sp|Q8BX46|SKOR1_MOUSE SKI family transcriptional corepressor 1 OS...  46.4    4e-04
sp|Q7Z3E2|CC186_HUMAN Coiled-coil domain-containing protein 186 O...  46.4    5e-04
sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogast...  46.4    5e-04
sp|Q9Y250|LZTS1_HUMAN Leucine zipper putative tumor suppressor 1 ...  46.0    5e-04
sp|P02567|MYO1_CAEEL Myosin-1 OS=Caenorhabditis elegans OX=6239 G...  46.4    5e-04
sp|P84551|SKOR1_RAT SKI family transcriptional corepressor 1 OS=R...  46.4    5e-04
sp|A3GG92|ATG11_PICST Autophagy-related protein 11 OS=Scheffersom...  46.4    5e-04
sp|Q0WN69|KN14P_ARATH Kinesin-like protein KIN-14P OS=Arabidopsis...  46.4    5e-04
sp|Q569K6|CC157_HUMAN Coiled-coil domain-containing protein 157 O...  46.0    5e-04
sp|Q9X105|MUTS2_THEMA Endonuclease MutS2 OS=Thermotoga maritima (...  46.0    5e-04
sp|Q7TSP2|KIF15_RAT Kinesin-like protein KIF15 OS=Rattus norvegic...  46.4    5e-04
sp|A6PWD2|FHAD1_MOUSE Forkhead-associated domain-containing prote...  46.4    5e-04
sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila m...  46.0    5e-04
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus m...  46.0    5e-04
sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapie...  46.0    5e-04
sp|F4HZB5|NET1D_ARATH Protein NETWORKED 1D OS=Arabidopsis thalian...  46.4    5e-04
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS...  46.0    5e-04
sp|Q9QWT9|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus ...  46.0    5e-04
sp|F1PT61|MYH16_CANLF Myosin-16 OS=Canis lupus familiaris OX=9615...  46.4    5e-04
sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora cras...  46.4    6e-04
sp|Q58718|RAD50_METJA DNA double-strand break repair Rad50 ATPase...  46.0    6e-04
sp|B0LKP1|KRT35_SHEEP Keratin, type I cuticular Ha5 OS=Ovis aries...  45.6    6e-04
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taur...  46.0    6e-04
sp|Q9X1E2|MCP4_THEMA Methyl-accepting chemotaxis protein 4 OS=The...  46.0    6e-04
sp|P02543|VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2    45.6    6e-04
sp|Q5M775|CYTSB_HUMAN Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC...  46.0    6e-04
sp|F4I8I0|SUN4_ARATH SUN domain-containing protein 4 OS=Arabidops...  46.0    6e-04
sp|Q2KN97|CYTSA_CHICK Cytospin-A OS=Gallus gallus OX=9031 GN=SPEC...  46.0    6e-04
sp|Q6CVG9|ATG11_KLULA Autophagy-related protein 11 OS=Kluyveromyc...  46.0    6e-04
sp|A2AL36|CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntr...  46.0    6e-04
sp|O43790|KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapi...  45.6    6e-04
sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX...  46.0    6e-04
sp|Q10411|SPO15_SCHPO Sporulation-specific protein 15 OS=Schizosa...  46.0    6e-04
sp|Q585H6|FAZ1_TRYB2 Flagellar attachment zone protein 1 OS=Trypa...  46.0    6e-04
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus ...  46.0    6e-04
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur gar...  46.0    6e-04
sp|O25943|RECN_HELPY DNA repair protein RecN OS=Helicobacter pylo...  45.6    7e-04
sp|A6NEE1|PLHD1_HUMAN Pleckstrin homology domain-containing famil...  45.6    7e-04
sp|Q8CG73|FTM_MOUSE Protein fantom OS=Mus musculus OX=10090 GN=Rp...  46.0    7e-04
sp|Q7Z7A1|CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL...  46.0    7e-04
sp|Q92351|PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosacc...  46.0    7e-04
sp|Q9D646|KRT34_MOUSE Keratin, type I cuticular Ha4 OS=Mus muscul...  45.2    7e-04
sp|Q5R7H1|CACO2_PONAB Calcium-binding and coiled-coil domain-cont...  45.6    7e-04
sp|Q08379|GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens...  46.0    7e-04
sp|Q9ULJ8|NEB1_HUMAN Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9...  46.0    7e-04
sp|P54697|MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoi...  46.0    7e-04
sp|Q7ZVT3|SAS6_DANRE Spindle assembly abnormal protein 6 homolog ...  45.6    7e-04
sp|Q6PVZ1|K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus g...  45.2    7e-04
sp|Q8CIM1|LRC45_MOUSE Leucine-rich repeat-containing protein 45 O...  45.6    7e-04
sp|Q62036|CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus muscu...  45.6    7e-04
sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing prot...  45.6    8e-04
sp|A0A068FIK2|KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium...  45.6    8e-04
sp|Q4R4X4|VIME_MACFA Vimentin OS=Macaca fascicularis OX=9541 GN=V...  45.2    8e-04
sp|P84198|VIME_CHLAE Vimentin OS=Chlorocebus aethiops OX=9534 GN=...  45.2    8e-04
sp|Q8R4C2|RUFY2_MOUSE RUN and FYVE domain-containing protein 2 OS...  45.2    8e-04
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocent...  45.6    8e-04
sp|Q9LPC6|KINUB_ARATH Kinesin-like protein KIN-UB OS=Arabidopsis ...  45.6    8e-04
sp|Q96KP6|TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapie...  44.8    8e-04
sp|Q14980|NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo...  45.6    9e-04
sp|P60853|LZTS1_MOUSE Leucine zipper putative tumor suppressor 1 ...  45.2    0.001
sp|Q8RHQ8|CLPB_FUSNN Chaperone protein ClpB OS=Fusobacterium nucl...  45.2    0.001
sp|Q8HZQ5|EZRI_RABIT Ezrin OS=Oryctolagus cuniculus OX=9986 GN=EZ...  45.2    0.001
sp|Q8C115|PKHH2_MOUSE Pleckstrin homology domain-containing famil...  45.6    0.001
sp|P34216|EDE1_YEAST EH domain-containing and endocytosis protein...  45.6    0.001
sp|Q27IK7|KN12C_ARATH Kinesin-like protein KIN-12C OS=Arabidopsis...  45.6    0.001
sp|F4JZY1|CIP1_ARATH COP1-interactive protein 1 OS=Arabidopsis th...  45.6    0.001
sp|F3Y5P4|GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=...  45.2    0.001
sp|P48616|VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3  44.8    0.001
sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapi...  44.8    0.001
sp|G5EBL8|SAS7_CAEEL Spindle assembly abnormal protein 7 OS=Caeno...  45.2    0.001
sp|Q03427|LAMC_DROME Lamin-C OS=Drosophila melanogaster OX=7227 G...  45.2    0.001
sp|Q497I4|KRT35_MOUSE Keratin, type I cuticular Ha5 OS=Mus muscul...  44.8    0.001
sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus ...  45.2    0.001
sp|F4JTJ2|EREL1_ARATH PX domain-containing protein EREL1 OS=Arabi...  45.2    0.001
sp|Q7TSG1|CE120_MOUSE Centrosomal protein of 120 kDa OS=Mus muscu...  45.2    0.001
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norv...  45.2    0.001
sp|Q8TCG1|CIP2A_HUMAN Protein CIP2A OS=Homo sapiens OX=9606 GN=CI...  45.2    0.001
sp|O18737|CACO2_BOVIN Calcium-binding and coiled-coil domain-cont...  44.8    0.001
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermopla...  45.2    0.001
sp|Q3ZU82|GOGA5_RAT Golgin subfamily A member 5 OS=Rattus norvegi...  44.8    0.001
sp|Q2UEA0|NUF2_ASPOR Probable kinetochore protein nuf2 OS=Aspergi...  44.8    0.001
sp|Q6PA69|DEFI6_XENLA Differentially expressed in FDCP 6 homolog ...  44.8    0.001
sp|Q9FHN8|KN14E_ARATH Kinesin-like protein KIN-14E OS=Arabidopsis...  45.2    0.001
sp|Q9P219|DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CC...  45.2    0.001
sp|P02534|K1M1_SHEEP Keratin, type I microfibrillar 48 kDa, compo...  44.4    0.001
sp|Q0VF22|CC138_MOUSE Coiled-coil domain-containing protein 138 O...  44.8    0.001
sp|A0A1L8EYB2|DAAF8_XENLA Dynein axonemal assembly factor 8 OS=Xe...  45.2    0.001
sp|Q9SV36|KINUC_ARATH Kinesin-like protein KIN-UC OS=Arabidopsis ...  44.8    0.001
sp|O07116|SPH1_HALSI Smc-like protein Sph1 OS=Halobacterium salin...  44.8    0.001
sp|Q555I8|KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium d...  44.8    0.001
sp|Q9HHM7|SPH1_HALSA Smc-like protein Sph1 OS=Halobacterium salin...  44.8    0.001
sp|B0R9X9|SPH1_HALS3 Smc-like protein Sph1 OS=Halobacterium salin...  44.8    0.001
sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX...  44.8    0.001
sp|Q8TXI4|RAD50_METKA DNA double-strand break repair Rad50 ATPase...  44.8    0.001
sp|A5A6M5|K1H1_PANTR Keratin, type I cuticular Ha1 OS=Pan troglod...  44.4    0.001
sp|P46660|AINX_MOUSE Alpha-internexin OS=Mus musculus OX=10090 GN...  44.4    0.001
sp|Q6IFU7|K1C42_RAT Keratin, type I cytoskeletal 42 OS=Rattus nor...  44.4    0.001
sp|Q9JKY5|HIP1R_MOUSE Huntingtin-interacting protein 1-related pr...  44.8    0.001
sp|Q9P2M7|CING_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1...  44.8    0.001
sp|O75146|HIP1R_HUMAN Huntingtin-interacting protein 1-related pr...  44.8    0.001
sp|A8AUS0|SSPA_STRGC Streptococcal surface protein A OS=Streptoco...  44.8    0.001
sp|Q9BXL6|CAR14_HUMAN Caspase recruitment domain-containing prote...  44.8    0.001
sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapien...  44.4    0.001
sp|Q8CIS0|CAR11_MOUSE Caspase recruitment domain-containing prote...  44.8    0.001
sp|A9X1A5|CING_PAPAN Cingulin OS=Papio anubis OX=9555 GN=CGN PE=3...  44.8    0.002
sp|Q12527|ATG11_YEAST Autophagy-related protein 11 OS=Saccharomyc...  44.8    0.002
sp|Q5RHB5|IRAG2_DANRE Inositol 1,4,5-triphosphate receptor associ...  44.8    0.002
sp|Q91Z80|LIPA4_RAT Liprin-alpha-4 (Fragment) OS=Rattus norvegicu...  44.8    0.002
sp|Q29RL0|TBC31_BOVIN TBC1 domain family member 31 OS=Bos taurus ...  44.8    0.002
sp|Q6LFN2|ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium ...  44.4    0.002
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus...  44.8    0.002
sp|Q9LMH6|FDM4_ARATH Factor of DNA methylation 4 OS=Arabidopsis t...  44.4    0.002
sp|Q9HHY2|SPH2_HALSA Smc-like protein Sph2 OS=Halobacterium salin...  44.4    0.002
sp|B0R9L6|SPH2_HALS3 Smc-like protein Sph2 OS=Halobacterium salin...  44.4    0.002
sp|Q4WVA0|NUF2_ASPFU Probable kinetochore protein nuf2 OS=Aspergi...  44.1    0.002
sp|H2LP95|TBC31_ORYLA TBC1 domain family member 31 OS=Oryzias lat...  44.4    0.002
sp|P08670|VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1...  44.1    0.002
sp|Q9CS72|FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musc...  44.4    0.002
sp|Q757M3|NUF2_ASHGO Probable kinetochore protein NUF2 OS=Ashbya ...  44.1    0.002
sp|Q9P6L5|SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomy...  44.4    0.002
sp|Q21952|NUF2_CAEEL Kinetochore protein Nuf2 homolog OS=Caenorha...  44.1    0.002
sp|P40457|MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (st...  44.4    0.002
sp|Q9BPU3|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium d...  44.4    0.002
sp|P85120|DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=...  44.4    0.002
sp|A6ZWU0|ATG11_YEAS7 Autophagy-related protein 11 OS=Saccharomyc...  44.4    0.002
sp|Q5SXY1|CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Spec...  44.4    0.002
sp|Q7SYB5|DEFI6_DANRE Differentially expressed in FDCP 6 homolog ...  44.1    0.002
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanoca...  44.4    0.002
sp|Q6NXY1|TBC31_MOUSE TBC1 domain family member 31 OS=Mus musculu...  44.4    0.002
sp|Q5R1W8|VIME_PANTR Vimentin OS=Pan troglodytes OX=9598 GN=VIM P...  44.1    0.002
sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens ...  44.4    0.002
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus muscu...  44.4    0.002
sp|Q5ZIB2|FBF1_CHICK Fas-binding factor 1 homolog OS=Gallus gallu...  44.4    0.002
sp|Q5SNZ0|GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a P...  44.4    0.002
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protei...  44.4    0.002
sp|Q12234|RUD3_YEAST GRIP domain-containing protein RUD3 OS=Sacch...  44.1    0.002
sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7...  44.4    0.002
sp|Q5BH14|NUF2_EMENI Probable kinetochore protein nuf2 OS=Emerice...  44.1    0.002
sp|Q86V48|LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX...  44.1    0.002
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abe...  44.1    0.002
sp|Q9Z331|K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus mus...  44.1    0.002
sp|O76011|KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapie...  43.7    0.002
sp|Q08378|GOGA3_HUMAN Golgin subfamily A member 3 OS=Homo sapiens...  44.4    0.002
sp|Q49A88|CCD14_HUMAN Coiled-coil domain-containing protein 14 OS...  44.1    0.002
sp|Q8CFC9|LZTS1_RAT Leucine zipper putative tumor suppressor 1 OS...  44.1    0.002
sp|Q9UPV0|CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapi...  44.1    0.002


>sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens 
OX=9606 GN=IKBKG PE=1 SV=2
Length=419

 Score = 396 bits (1017),  Expect = 7e-135, Method: Composition-based stats.
 Identities = 419/419 (100%), Positives = 419/419 (100%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
Sbjct  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
Sbjct  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
Sbjct  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
            ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419


>sp|Q95KU9|NEMO_BOVIN NF-kappa-B essential modulator OS=Bos taurus 
OX=9913 GN=IKBKG PE=1 SV=1
Length=419

 Score = 394 bits (1012),  Expect = 4e-134, Method: Composition-based stats.
 Identities = 359/419 (86%), Positives = 382/419 (91%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+R  WKS LCEMVQPSG PA DQD+LGEES LGKPAMLH+PSEQG PET QRCLEENQE
Sbjct  1    MSRPPWKSPLCEMVQPSGSPAGDQDMLGEESSLGKPAMLHVPSEQGTPETFQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEEL HFQ +QREEK FLM KFQEAR LV RL LEK +L++Q+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELQHFQGNQREEKAFLMQKFQEARDLVVRLSLEKRELRQQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+EVE LK CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE QALE RAR ASE+
Sbjct  121  ALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEK  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
            ARQLESEREAL+Q+HSVQVDQL +Q +S+EAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  ARQLESEREALEQRHSVQVDQLVLQNESMEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNH+KSS+V SER RG+QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHMKSSMVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQAREKLAEKKE LQEQLEQLQREYS+LK SCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQ PL P PA+ S  L   SQRRSPP+EPP FCCPKCQYQAPD+DTLQIHVMECIE
Sbjct  361  VEVSQPPLAPGPAHHSFHLNPSSQRRSPPDEPPKFCCPKCQYQAPDIDTLQIHVMECIE  419


>sp|A9QT41|NEMO_PIG NF-kappa-B essential modulator OS=Sus scrofa 
OX=9823 GN=IKBKG PE=1 SV=1
Length=419

 Score = 389 bits (998),  Expect = 5e-132, Method: Composition-based stats.
 Identities = 373/419 (89%), Positives = 389/419 (93%), Gaps = 0/419 (0%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+R  WKSQ CEMVQPSGGPA DQDVLGEES LGKP MLHLPSEQGAPET QRCLEENQE
Sbjct  1    MSRTPWKSQPCEMVQPSGGPAGDQDVLGEESSLGKPTMLHLPSEQGAPETFQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEEL  FQ SQREEKEFLM KF EAR+LVERL LEKL+L+RQ+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELQRFQGSQREEKEFLMQKFCEARRLVERLSLEKLELRRQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+EVE LK CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE QALE R RA SEQ
Sbjct  121  ALQEVELLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRVRATSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLE+EREALQQQHSVQVDQLR+Q QS+EAALRMERQAASEEKRKLAQLQVAYHQLFQE
Sbjct  181  VRQLENEREALQQQHSVQVDQLRLQSQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YDNHIKSSVV SER RG+QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
Sbjct  241  YDNHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAERQARE+LAE+KELLQEQLEQLQREYS+LK SCQESARIEDMRKRH
Sbjct  301  LKAQADIYKADFQAERQAREQLAERKELLQEQLEQLQREYSRLKTSCQESARIEDMRKRH  360

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VEVSQ  LPPAPA+ S   ALPSQRRSPPEEPP+FCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  361  VEVSQPTLPPAPAHHSFHPALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE  419


>sp|Q6TMG5|NEMO_RAT NF-kappa-B essential modulator OS=Rattus norvegicus 
OX=10116 GN=Ikbkg PE=2 SV=1
Length=412

 Score = 381 bits (979),  Expect = 3e-129, Method: Composition-based stats.
 Identities = 366/419 (87%), Positives = 385/419 (92%), Gaps = 7/419 (2%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            M+RHLWK+QL EMVQPSGGPA DQD+LGEES LGKPAMLHLPSEQG PETLQRCLEENQE
Sbjct  1    MSRHLWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEELLHFQ SQREEKEFLMCKFQEARKLVERL LEKLDL+RQ+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRRQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL ++EHLK+CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE Q LEGR RA SEQ
Sbjct  121  ALEDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRIRAVSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLESERE LQQQHSVQVDQLRMQ QSVEAALRMERQAASEEKRKLAQLQ AYHQLFQ+
Sbjct  181  VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YD+HIKSS       +GMQLEDL+QQLQQAEEALVAKQE+IDKLKEEAEQHKIVMETVPV
Sbjct  241  YDSHIKSS-------KGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV  293

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAER AREKL E+KELLQEQLEQLQRE++KLK  C ESARIEDMRKRH
Sbjct  294  LKAQADIYKADFQAERHAREKLVERKELLQEQLEQLQREFNKLKVGCHESARIEDMRKRH  353

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VE SQ PL PAPA+ S  LAL +QRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  354  VETSQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  412


>sp|O88522|NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus 
OX=10090 GN=Ikbkg PE=1 SV=2
Length=412

 Score = 366 bits (940),  Expect = 2e-123, Method: Composition-based stats.
 Identities = 363/419 (87%), Positives = 382/419 (91%), Gaps = 7/419 (2%)

Query  1    MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE  60
            MN+H WK+QL EMVQPSGGPA DQD+LGEES LGKPAMLHLPSEQG PETLQRCLEENQE
Sbjct  1    MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE  60

Query  61   LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ  120
            LRDAIRQSNQ+LRERCEELLHFQ SQREEKEFLMCKFQEARKLVERL LEKLDL+ Q+EQ
Sbjct  61   LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQ  120

Query  121  ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            AL+E+E LK+CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK+ QALEGR RA SEQ
Sbjct  121  ALKELEQLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQ  180

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             RQLESERE LQQQHSVQVDQLRMQ QSVEAALRMERQAASEEKRKLAQLQ AYHQLFQ+
Sbjct  181  VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD  240

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            YD+HIKSS       +GMQLEDL+QQLQQAEEALVAKQE+IDKLKEEAEQHKIVMETVPV
Sbjct  241  YDSHIKSS-------KGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV  293

Query  301  LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH  360
            LKAQADIYKADFQAER AREKL EKKE LQEQLEQLQRE++KLK  C ESARIEDMRKRH
Sbjct  294  LKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESARIEDMRKRH  353

Query  361  VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
            VE  Q PL PAPA+ S  LAL +QRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sbjct  354  VETPQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  412


>sp|Q8K3K8|OPTN_MOUSE Optineurin OS=Mus musculus OX=10090 GN=Optn 
PE=1 SV=1
Length=584

 Score = 238 bits (606),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 101/342 (30%), Positives = 180/342 (53%), Gaps = 10/342 (3%)

Query  83   QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLK--RCQQQMAEDKA  140
            + +Q+ E+  L    +EA++ +     +       ++Q  R  +  K  + Q+ +  +  
Sbjct  246  EGNQKVER--LEVALREAKERISDFEKKANGHSSTEKQTARRADREKEDKGQESVGSEVE  303

Query  141  SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD  200
            ++  QVTSL  ELQE+ ++L  A    + L+ + +A   +     SE    +Q+      
Sbjct  304  TLSIQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSE-LNEKQELVYSNK  362

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKR  256
            +L +Q +S+ + ++ME+    EEK +LA LQ  +++L QE++  +K+    +   +E+  
Sbjct  363  KLELQVESMRSEIKMEQAKTEEEKSRLATLQATHNKLLQEHNKALKTIEELTKQQAEKVD  422

Query  257  GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER  316
             M L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER
Sbjct  423  KMLLQELSEKLELAEQALASKQLQMDEMKQTLAKQEEDLETMAVLRAQMEVYCSDFHAER  482

Query  317  QAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLS  376
             AREK+ E+KE L  QL  L +E + ++      + +E M+ RH   +         +  
Sbjct  483  AAREKIHEEKEQLALQLAILLKENNDIEEGGSRQSLME-MQCRHGARTSDSDQQTYLFQR  541

Query  377  SPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
                   Q    P   P   CPKC    PD+DTLQIHVM+CI
Sbjct  542  GAEDRSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCI  583


 Score = 46.4 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 39/176 (22%), Positives = 74/176 (42%), Gaps = 8/176 (5%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP        D   E    G   M+H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKGDSPCETPGNGPSNMVHPSLDTFTPEELLQQMKELLVENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ----KEQALREVE  126
             ++ R EEL  +   Q+EE+     + +E ++ ++ L  E   LK +    KE++ + +E
Sbjct  64   AMKGRFEELSAWTEKQKEERLLFEMQSKEVKERLKALTHENERLKEELGKFKEKSEKPLE  123

Query  127  HLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
             L    +     +  V+   T +  E++  + ++     E   L G       +  
Sbjct  124  DLTGGYRYPRALEEEVEKLKTQVEQEVEHLKIQVMRLRAEKADLLGIVSELQLKLN  179


>sp|Q8R5M4|OPTN_RAT Optineurin OS=Rattus norvegicus OX=10116 GN=Optn 
PE=1 SV=3
Length=585

 Score = 234 bits (596),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 99/341 (29%), Positives = 180/341 (53%), Gaps = 8/341 (2%)

Query  83   QASQREEK-EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKAS  141
            + +Q+ E+ E  + + +E     E+       ++ Q E + ++ E   +  + +  +  +
Sbjct  247  EGNQKVERLEIALREAKERISDFEKKANGHSAIETQTEGSTQKEEE-DKDPESVGIEVET  305

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
            +  QV SL  ELQE+ ++L  A    + L+ + +A   +     SE    +Q+      +
Sbjct  306  LNVQVASLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSE-LNEKQELVYSNRK  364

Query  202  LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRG  257
            L +Q +S+ + ++ME+    EEK +LA LQ  + +L QE++  +++    +   +E+   
Sbjct  365  LELQVESMRSEIKMEQAKTEEEKSRLATLQATHDKLLQEHNKALRTIEELTKQQAEKVDK  424

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
            +QL++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER 
Sbjct  425  VQLQELSEKLELAEQALASKQLQMDEMKQTIAKQEEDLETMAVLRAQMEVYCSDFHAERA  484

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
            AREK+ E+KE L  QL  L +E +  +      + +E M+ RH   +      A  +   
Sbjct  485  AREKIHEEKEQLALQLAILLKENNDFEDGGSRQSLME-MQCRHGARTSDSDQQAYLFQRG  543

Query  378  PLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
               +  Q    P   P   CPKC    PD+DTLQIHVM+CI
Sbjct  544  AEDMSWQHGQQPRSIPIHSCPKCGEVLPDIDTLQIHVMDCI  584


 Score = 48.7 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 73/162 (45%), Gaps = 5/162 (3%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP        D   E    G   M+H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKGDSSCETPGNGPSNMVHPNLDTFTPEELLQQMKELLVENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEH-LK  129
             ++ R EEL  +   Q+EE++    + +EA++ ++ L  E   LK +  +   + E   +
Sbjct  64   AMKGRFEELSAWTEKQKEERQLFEIQSKEAKERLKALSHENERLKEELGKLKEKSERPFE  123

Query  130  RCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
                +    +  ++ +V  L  ++++    L+   +  QA +
Sbjct  124  DITGRCGFPRTDLEQEVEQLKRQVEQEVEHLKIQVRRLQAEK  165


>sp|Q96CV9|OPTN_HUMAN Optineurin OS=Homo sapiens OX=9606 GN=OPTN 
PE=1 SV=3
Length=577

 Score = 232 bits (590),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 101/341 (30%), Positives = 185/341 (54%), Gaps = 11/341 (3%)

Query  83   QASQREEK-EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKAS  141
            + +Q+ E+ E  + + +E     E+    + +++ Q E +  +    ++  + +  +  +
Sbjct  242  EGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEA  301

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
            +  QVTSL  ELQE+ ++L  A    + L+ + +A   +   + SE    +Q+      +
Sbjct  302  LNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSE-LNEKQELVYTNKK  360

Query  202  LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRG  257
            L +Q +S+ + ++ME+    +EK KL  LQ+ +++L QE++N +K+    +   SE+   
Sbjct  361  LELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR  420

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
              L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ +L+AQ ++Y +DF AER 
Sbjct  421  AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERA  480

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
            AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   ++       AYL  
Sbjct  481  AREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRHG--ARTSDSDQQAYLVQ  536

Query  378  PLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
              A     R      P   CPKC    PD+DTLQIHVM+CI
Sbjct  537  RGAEDRDWRQ-QRNIPIHSCPKCGEVLPDIDTLQIHVMDCI  576


 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 60/345 (17%), Positives = 120/345 (35%), Gaps = 24/345 (7%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP       +D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA++ +  L  E   LK        E+  LK 
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLK-------EELGKLKG  116

Query  131  CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREA  190
              ++ +ED                +S+     A +E   L  +      +   L      
Sbjct  117  KSERSSEDPT-------------DDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSE  163

Query  191  LQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV  250
            LQ + +          +   A    E      +        V+      +Y +       
Sbjct  164  LQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAK  223

Query  251  GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKA  310
                   + +  L   L++  + +   +  + + KE     +        ++ Q +    
Sbjct  224  NYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTE  283

Query  311  DFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
                E +  E +  + E L  Q+  L +E  +      E+  ++ 
Sbjct  284  KENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKK  328


>sp|Q95KA2|OPTN_MACFA Optineurin OS=Macaca fascicularis OX=9541 
GN=OPTN PE=2 SV=2
Length=571

 Score = 229 bits (584),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 100/341 (29%), Positives = 183/341 (54%), Gaps = 11/341 (3%)

Query  83   QASQREEK-EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKAS  141
            + +Q+ E+ E  + + +E     E+    + +++ Q E +  +    ++  + +  +  +
Sbjct  236  EGNQKVERLEIALKEAKERVSDFEKKASNRSEIETQTEGSTEKENEEEKGPETVGSEVEA  295

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
            +  QVTSL  ELQE+ ++L  A    + L+ + +A   +     SE    +Q+      +
Sbjct  296  LNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSE-LNEKQELVYTNKK  354

Query  202  LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRG  257
            L +Q +S+ + ++ME+    +EK KLA LQ+ +++L QE+++ +K+    +   SE+   
Sbjct  355  LELQVESMLSEIKMEQAKTEDEKSKLAMLQLTHNKLLQEHNHALKTIEELTRKESEKVDR  414

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
              L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER 
Sbjct  415  AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTVLRAQMEVYCSDFHAERA  474

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
            AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   +  P   A      
Sbjct  475  AREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRHGARTSDPDQQAYLVQRG  532

Query  378  PLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
                  Q+       P   CPKC    PD+DTLQIHVM+CI
Sbjct  533  TEDRDWQQ---QRNIPIHSCPKCGEVLPDIDTLQIHVMDCI  570


 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 68/150 (45%), Gaps = 12/150 (8%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP        D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKGDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA++ +  L  E   LK +  +   + E    
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFETQSKEAKERLMALSHENEKLKEELGKLKGKSERSSE  123

Query  131  C--------QQQMAEDKASVKAQVTSLLGE  152
                     + +  ++K  ++ QVT L  E
Sbjct  124  DPTGDSRLPRAEAEQEKDQLRTQVTRLQAE  153


>sp|Q861Q8|OPTN_MACMU Optineurin OS=Macaca mulatta OX=9544 GN=OPTN 
PE=1 SV=1
Length=571

 Score = 228 bits (581),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 100/341 (29%), Positives = 183/341 (54%), Gaps = 11/341 (3%)

Query  83   QASQREEK-EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKAS  141
            + +Q+ E+ E  + + +E     E+    + +++ Q E +  +    ++  + +  +  +
Sbjct  236  EGNQKVERLEIALKEAKERVSDFEKKASNRSEIETQTEGSTEKENEEEKGPETVGSEVEA  295

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
            +  QVTSL  ELQE+ ++L  A    + L+ + +A   +     SE    +Q+      +
Sbjct  296  LNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSE-LNEKQELVYTNKK  354

Query  202  LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRG  257
            L +Q +S+ + ++ME+    +EK KLA LQ+ +++L QE+++ +K+    +   SE+   
Sbjct  355  LELQVESMLSEIKMEQAKTEDEKSKLAMLQLTHNKLLQEHNHALKTIEELTRKESEKVDR  414

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
              L++L ++L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER 
Sbjct  415  AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTVLRAQMEVYCSDFHAERA  474

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
            AREK+ E+KE L  QL  L +E    +   ++S  + +M+ RH   +  P   A      
Sbjct  475  AREKIHEEKEQLALQLAVLLKENDAFEDGGRQS--LMEMQSRHGARTSDPDQQAYLVQRG  532

Query  378  PLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
                  Q+       P   CPKC    PD+DTLQIHVM+CI
Sbjct  533  TEDRDWQQ---QRNIPIHSCPKCGEVLPDIDTLQIHVMDCI  570


 Score = 51.8 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 68/150 (45%), Gaps = 12/150 (8%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP        D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKGDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA++ +  L  E   LK +  +   + E    
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFETQSKEAKERLMALSHENEKLKEELGKLKGKSERSSE  123

Query  131  C--------QQQMAEDKASVKAQVTSLLGE  152
                     + +  ++K  ++ QVT L  E
Sbjct  124  DPTDDSRLPRAEAEQEKDQLRTQVTRLQAE  153


>sp|Q7YS99|OPTN_PIG Optineurin OS=Sus scrofa OX=9823 GN=OPTN PE=1 
SV=1
Length=574

 Score = 226 bits (576),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 98/342 (29%), Positives = 180/342 (53%), Gaps = 10/342 (3%)

Query  83   QASQREEK-EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKAS  141
            + +Q+ E+ E  + + +E     E+   ++ + + Q E+   + +  ++  + +  +   
Sbjct  236  EGNQKVERLEIALKEAKERILDFEKKAKDRSETETQTEEHKEQEKEEEKSPETVGSEVEM  295

Query  142  VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
            +  QVT+L  ELQE+ ++L  A    + L+ + +A   +     SE    +Q+      +
Sbjct  296  LNLQVTTLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSE-LNEKQELLYNNKK  354

Query  202  LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRG  257
            L +Q +S+ + ++ME+    EEK KL  LQ+ +++L QEY+N +K+        SE+   
Sbjct  355  LELQVESMRSEIKMEQAKTEEEKSKLTTLQLTHNRLLQEYNNALKTIEELKRRESEKVDK  414

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
            + L++L  +L+ AE+AL +KQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER 
Sbjct  415  VVLQELNGKLEMAEKALASKQLQMDEMKQTIAKQEKDLETMAVLRAQMEVYCSDFHAERA  474

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
            AREK+ E+KE L  QL  L ++ +  +      + +E M+ RH   +        A+L  
Sbjct  475  AREKIHEEKEQLALQLAVLLKDDNAFEEGASRQSLME-MQSRHGARA--SDADQQAFLVQ  531

Query  378  PLALPSQR-RSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
              A      +   +  P   CPKC    PD+DTL IHV +CI
Sbjct  532  RGAEDRNWLQQQQQNIPIHSCPKCGEVLPDIDTLLIHVTDCI  573


 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 76/405 (19%), Positives = 152/405 (38%), Gaps = 65/405 (16%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAP----ETLQRCLEENQELRDAIRQSNQ  70
            QP        D   E +  G P + H   +   P    + ++  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKGDSPTETTGNGPPTLAHPNLDTFTPHELLQQMRELLIENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-------------  117
             ++ R EEL  +   Q+EE+ F   + +EA++ +  L LE   LK++             
Sbjct  64   AMKGRFEELSAWTEKQKEERLFFETQSKEAKERLTALSLENEKLKQELGKLKGKTERSFE  123

Query  118  ---------KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL------QESQSRLEA  162
                     K +A +EVE LK    ++  +KA +   V+ L  +L      ++S   +  
Sbjct  124  DLTGDPRVPKAEAEQEVEQLKTQVARLQAEKADLLGIVSELQLKLNSGGPSEDSFVEIRM  183

Query  163  ATKECQALEGRARAAS--------------EQARQLESEREALQQQHSVQVDQLRMQGQS  208
            A  E  A     + +               E  R      E    Q  + + +   + + 
Sbjct  184  AEGEADAAMKEIKTSPGPIRTDSIDTSKSAEGTRNYLEFEELTVSQLLLCLREGNQKVER  243

Query  209  VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM----------  258
            +E AL+  ++   + ++K         Q  +  +   +           +          
Sbjct  244  LEIALKEAKERILDFEKKAKDRSETETQTEEHKEQEKEEEKSPETVGSEVEMLNLQVTTL  303

Query  259  --QLEDLKQQLQQAEEALVAKQEVIDKLKE-------EAEQHKIVMETVPVLKAQADIYK  309
              +L++   +L +AE      QE    L+        E  + + ++     L+ Q +  +
Sbjct  304  FKELQEAHTKLSEAELMKKRLQEKCQALERKNSATPSELNEKQELLYNNKKLELQVESMR  363

Query  310  ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIE  354
            ++ + E+   E+   K   LQ    +L +EY+    + +E  R E
Sbjct  364  SEIKMEQAKTEEEKSKLTTLQLTHNRLLQEYNNALKTIEELKRRE  408


>sp|Q5RI56|OPTN_DANRE Optineurin OS=Danio rerio OX=7955 GN=optn 
PE=2 SV=2
Length=517

 Score = 223 bits (569),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 104/344 (30%), Positives = 185/344 (54%), Gaps = 14/344 (4%)

Query  78   ELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAE  137
            +LL    ++ +EKE L    QEAR  +  L  +          +  +       +   + 
Sbjct  184  QLLRSLRAETDEKERLQLTLQEARGRIAELESKLEH-----ADSSAQTSLPSAAETNAST  238

Query  138  DKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV  197
            +  +++ Q+  L  EL+++Q +L+ A    + L+ R +   +    L++ +   +Q+   
Sbjct  239  EVKNLEDQLLKLCNELKQAQIKLDEAESMKRNLQDRCKDLEQDLGTLKT-QLGDKQKVQA  297

Query  198  QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG  257
            + D L++Q +S++AA+++E++   +EK  L QL+ AY +LF++Y    +           
Sbjct  298  ENDCLKVQMESLQAAIKLEQKKTQDEKNNLNQLKDAYTKLFEDYSELQEEKKKRESCVSK  357

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
               ++L+ +   AE+AL  KQ+ ID++K E  Q +  +ET+ V +AQA+IY +DF AER 
Sbjct  358  DDYDELQTRFATAEKALADKQQKIDEMKMELFQKEKDLETISVFQAQAEIYSSDFYAERA  417

Query  318  AREKLAEKKELLQEQLEQLQREYSKLKASCQESAR--IEDMRKRHVEVSQAPLPPAPAYL  375
            AREK+ E+KE L  QLE ++++ S+L+   +   R  + +M++RHV     P  P     
Sbjct  418  AREKIHEEKERLATQLEYVKKQNSQLQEEMESLGRHSMSEMQRRHVPRGANPQGP-----  472

Query  376  SSPLALPSQRRSPPEE-PPDFCCPKCQYQAPDMDTLQIHVMECI  418
            ++P  LP  R    ++  PD  CPKC    PD+D+LQIH+M+CI
Sbjct  473  TAPNNLPGGRGEWQQQNIPDHACPKCGEVLPDLDSLQIHIMDCI  516


 Score = 80.7 bits (197),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 48/268 (18%), Positives = 107/268 (40%), Gaps = 12/268 (4%)

Query  42   PSEQGA-PETLQR---CLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKF  97
            P   G+  ETLQ+    ++EN++L++A++Q+N  ++ER E L  ++  Q+EE++FL  + 
Sbjct  13   PGNLGSLEETLQQMNTLIKENRDLKEALKQTNLSMKERFEGLSAWKEKQKEERDFLEQRL  72

Query  98   QEARKLVERLGLEKLDLKRQKEQALR--------EVEHLKRCQQQMAEDKASVKAQVTSL  149
            +EAR  +  + +E   LK Q ++  +        E+E L+    ++  +K  + A  + L
Sbjct  73   EEARTRLNTMDVENEALKNQVKELEKSGAECLHTELEALRGQILRIQAEKNDLVAMNSEL  132

Query  150  LGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV  209
              ++ +               + +         +  +      +     V QL    ++ 
Sbjct  133  QLKMGQGSPSNSFIEIRIADDDLKVTKDLSSVPEASAFSMPKAESEEQTVRQLLRSLRAE  192

Query  210  EAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
                   +    E + ++A+L+             + S+   +       LED   +L  
Sbjct  193  TDEKERLQLTLQEARGRIAELESKLEHADSSAQTSLPSAAETNASTEVKNLEDQLLKLCN  252

Query  270  AEEALVAKQEVIDKLKEEAEQHKIVMET  297
              +    K +  + +K   +     +E 
Sbjct  253  ELKQAQIKLDEAESMKRNLQDRCKDLEQ  280


>sp|Q5M7B7|OPTN_XENLA Optineurin OS=Xenopus laevis OX=8355 GN=optn 
PE=2 SV=1
Length=532

 Score = 214 bits (545),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 100/339 (29%), Positives = 170/339 (50%), Gaps = 22/339 (6%)

Query  93   LMCKFQEARKLVERLGLEKLDLKRQKEQALREV-EHLKRCQQQ------------MAEDK  139
            L+   +E  + VERL  E     ++  +  ++  E   +  Q             ++ + 
Sbjct  202  LLRSLREETQKVERLEKELFSANKRLAELEKQTSEFCDKGVQTEQESEQSQSEVIISSEV  261

Query  140  ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQV  199
              +K +V SL  ELQE+  +L  A +   +L+ +     ++ ++ + + E  +Q     +
Sbjct  262  DILKEKVKSLNKELQETNDKLNEAKQFKNSLQEKCILLDKRLQENQVDLEE-KQSLRYSI  320

Query  200  DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ  259
             +L +Q +S E+ +++E+     EK +L  LQV+Y +L  EY    +  +   E+   ++
Sbjct  321  KKLELQVESQESEIKLEQNKTEAEKNQLGILQVSYDKLNSEYQ---ELRIREIEKVSKVE  377

Query  260  LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAR  319
              +L ++L   E+AL  KQ  ID+++E   +H+   ET+ +L+AQ D+Y ADF AER AR
Sbjct  378  FNELLEKLDVCEKALAKKQFEIDEMREMDTKHEEDKETIELLRAQVDVYCADFHAERSAR  437

Query  320  EKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
            E + ++KE L  +L  + +EY KLK        IE +++RH   S       P YL +  
Sbjct  438  ENIHQEKEQLATRLAYMIQEYEKLKEEMMGKQSIEQLQRRHGATSLLDASEGP-YLVARG  496

Query  380  ALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
            A   +          + CPKC    PDMDTLQIHVM+CI
Sbjct  497  AANME----QPSITVYTCPKCNLTVPDMDTLQIHVMDCI  531


 Score = 33.7 bits (75),  Expect = 3.7, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 127/319 (40%), Gaps = 15/319 (5%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQ----REEKEFLMCKFQEARKLV  104
            E +++ L EN  L++ ++Q NQ ++ER EELL              E L  + Q  ++ +
Sbjct  36   EQIKQLLMENNNLKETMKQMNQEMKERLEELLKRHNQHLLDLNSANEVLRKELQSLKEKI  95

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL----QESQSRL  160
                           +   E + LK    ++  +KA +   ++ L  +L    ++S   +
Sbjct  96   ATSNQGSAVCST--SEEASENKQLKNQLTRLQAEKADLLGLISELQLKLGSFSEDSFVEI  153

Query  161  EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
              + +E   +    +A    +    S R    ++     +   +    +  +LR E Q  
Sbjct  154  GFSERESGEIVNEEKANKILSDHNISYRTNSIKEEGGGTEPEEVAISRLLRSLREETQKV  213

Query  221  SEEKRKL----AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
               +++L     +L     Q  +  D  +++     + +  + +      L++  ++L  
Sbjct  214  ERLEKELFSANKRLAELEKQTSEFCDKGVQTEQESEQSQSEVIISSEVDILKEKVKSLNK  273

Query  277  K-QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
            + QE  DKL E  +    + E   +L  +    + D + ++  R  + + +  ++ Q  +
Sbjct  274  ELQETNDKLNEAKQFKNSLQEKCILLDKRLQENQVDLEEKQSLRYSIKKLELQVESQESE  333

Query  336  LQREYSKLKASCQESARIE  354
            ++ E +K +A   +   ++
Sbjct  334  IKLEQNKTEAEKNQLGILQ  352


>sp|Q90Z16|OPTN_CHICK Optineurin OS=Gallus gallus OX=9031 GN=OPTN 
PE=1 SV=1
Length=556

 Score = 205 bits (520),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 96/338 (28%), Positives = 174/338 (51%), Gaps = 14/338 (4%)

Query  85   SQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKA  144
            ++ + +E L  + Q+ ++ + ++  E  +      Q  +E E      + +  +  S+K 
Sbjct  228  NETQRREKLEKELQDHKERLSKMENETSNCLESGTQTNQEEE----SSEAIGSEVESLKK  283

Query  145  QVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRM  204
            Q+ +L  ELQE+  +L+ A    + L+ + +   E+     +     +QQ    + +L +
Sbjct  284  QICALFKELQEAHEKLKEAELIQKKLQEKCQTL-EKVNSAAATELEEKQQLIYTIKKLEL  342

Query  205  QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRGMQL  260
            Q +SV+A +++E+    +EK + + LQ AY++L  E    +K+     V   +R   + +
Sbjct  343  QVESVQAEVKLEQAKTQDEKTRYSSLQDAYNKLLAELTEAMKTISEMKVKEHDRVDKVVV  402

Query  261  EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE  320
            E+L  ++  AE+AL AKQ  +D++K+   + +  +ET+ VL+AQ ++Y +DF AER ARE
Sbjct  403  EELNAKVLLAEQALAAKQLQMDEMKQLIAKQEEDLETMAVLRAQMEVYCSDFHAERAARE  462

Query  321  KLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
            K+ E+KE L  QL  L +E   L+   + S  + +M+ RH   +  P       L     
Sbjct  463  KIHEEKEQLAVQLAYLLKEQQNLEDLGRSS--LAEMQNRHGARA--PDREHSPRLVQRGT  518

Query  381  LPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECI  418
               +          + CPKC+   PD+DTLQIHVM+CI
Sbjct  519  GSQEWPE-QRNISIYSCPKCEEILPDLDTLQIHVMDCI  555


 Score = 50.2 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 55/311 (18%), Positives = 138/311 (44%), Gaps = 22/311 (7%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            + ++  + EN EL++A++  NQ +++R EEL  ++  Q+EE+EF   KF+EA++ +    
Sbjct  42   QQMKELITENNELKEAMKLHNQAMKDRYEELSIWREKQKEEREFYETKFKEAKQCLLAKC  101

Query  109  LEKLDLKRQKEQ---------------ALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL  153
            +E   L++Q +                  +E   LK   Q++  +KA + A ++ L  +L
Sbjct  102  VENEQLQQQLQSLKEREEGAEMEGCATPEKEARQLKSKVQRLQAEKADLLAIISELQVKL  161

Query  154  -----QESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
                 ++S   +    +  +        +SE A  +     +     S  ++   +    
Sbjct  162  NIASAEDSFVEIGMNEEVNRTARENQDNSSEMASNIAVYIRSKSADESKNLESEELTVSQ  221

Query  209  VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQ  268
            +   LR E Q   + +++L   +    ++  E  N ++S    ++ +     E +  +++
Sbjct  222  LLCCLRNETQRREKLEKELQDHKERLSKMENETSNCLESGTQTNQEEESS--EAIGSEVE  279

Query  269  QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKEL  328
              ++ + A  + + +  E+ ++ +++ + +       +   +    E + +++L    + 
Sbjct  280  SLKKQICALFKELQEAHEKLKEAELIQKKLQEKCQTLEKVNSAAATELEEKQQLIYTIKK  339

Query  329  LQEQLEQLQRE  339
            L+ Q+E +Q E
Sbjct  340  LELQVESVQAE  350


>sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium 
discoideum OX=44689 GN=kif8 PE=2 SV=1
Length=1873

 Score = 191 bits (485),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 94/200 (47%), Gaps = 11/200 (6%)

Query  99   EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            E  +L E    E  DL +   +   E+E + + +QQ  + K     +V  L  +L+E   
Sbjct  710  EGIELFENDSEELSDLNQYISEKEEELELISKTKQQYQQMKEQFDQKVKELQSQLEEVTV  769

Query  159  RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQ  218
              + A KE    + + +   ++ +  E E+  L Q +  ++++L+ Q      + + + Q
Sbjct  770  EKDQALKELDKDKDKDKDNKDKDQYYEDEKLRLTQHYEKKLNELKQQLDQHAGSNKKDYQ  829

Query  219  AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
               + KRK            +E  + ++  +  ++R++   L+ ++ +L++ ++A   + 
Sbjct  830  RLLDLKRK-----------SEEKIDSLQQDIKDTKRQKSDLLKKMRDELKKRDDAKQTQA  878

Query  279  EVIDKLKEEAEQHKIVMETV  298
            + +D LK EA + +++++ +
Sbjct  879  KELDALKREARKTEVIIDQL  898


>sp|Q5R923|OPTN_PONAB Optineurin OS=Pongo abelii OX=9601 GN=OPTN 
PE=2 SV=1
Length=527

 Score = 177 bits (449),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 95/316 (30%), Positives = 155/316 (49%), Gaps = 19/316 (6%)

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
            R  E A   +EH +    Q+         +V  L   L+E++ R+    K+         
Sbjct  217  RSAEGAKNYLEHEELTVSQLLLCLREGNQKVERLEIALKEAKERVSDFEKKASNRSEIET  276

Query  176  AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE---------EKRK  226
                   +   E + L+   S +V+ L +Q  S+   L+      SE         EK K
Sbjct  277  QTEGSTEKENDEEKGLETVGS-EVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKSK  335

Query  227  LAQLQVAYHQLFQEYDNHIKS----SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
            L  LQ+ +++L +E++N +K+    +   SE+     L++L ++L+ AE+AL +KQ  +D
Sbjct  336  LTVLQMTHNKLLREHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEQALASKQLQMD  395

Query  283  KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
            ++K+   + +  +ET+ VL+AQ ++Y +DF AER AREK+ E+KE L  QL  L +E   
Sbjct  396  EMKQTIAKQEEDLETMTVLRAQMEVYCSDFHAERAAREKIHEQKEQLALQLAVLLKENDA  455

Query  343  LKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQY  402
             +   ++S  + +M+ RH   ++       AYL    A     R      P   CPKC  
Sbjct  456  FEDGGRQS--LMEMQSRHG--ARTSGADQQAYLVQRGAEDRDWRQ-QRNIPIHSCPKCGE  510

Query  403  QAPDMDTLQIHVMECI  418
              PD+DTLQIHVM+CI
Sbjct  511  VLPDIDTLQIHVMDCI  526


 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 66/357 (18%), Positives = 129/357 (36%), Gaps = 27/357 (8%)

Query  15   QPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETL----QRCLEENQELRDAIRQSNQ  70
            QP       +D   E +  G P + H   +   PE L    +  L EN +L++A++ +NQ
Sbjct  4    QPLSCLTEKEDSPTESTGNGPPYLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQ  63

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
             ++ R EEL  +   Q+EE++F   + +EA++ +  L  E   LK        E+  LK 
Sbjct  64   AMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLK-------EELGKLKG  116

Query  131  CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREA  190
              ++ +ED                +S+     A +E   L  +      +   L      
Sbjct  117  KSERSSEDPT-------------DDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSE  163

Query  191  LQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV  250
            LQ + +          +   A    E      +        V+  +   +Y +       
Sbjct  164  LQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTSRALSKYRSRSAEGAK  223

Query  251  GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKA  310
                   + +  L   L++  + +   +  + + KE     +        ++ Q +    
Sbjct  224  NYLEHEELTVSQLLLCLREGNQKVERLEIALKEAKERVSDFEKKASNRSEIETQTEGSTE  283

Query  311  DFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAP  367
                E +  E +  + E L  Q+  L +E   L+ +  + +  E M+KR  E S+  
Sbjct  284  KENDEEKGLETVGSEVEALNLQVTSLFKE---LQEAHTKLSEAELMKKRLQEKSKLT  337


>sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta 
OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
Length=1711

 Score = 69.9 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 64/312 (21%), Positives = 128/312 (41%), Gaps = 20/312 (6%)

Query  55   LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
            LE   E   A+RQ  +   +R   L       R+EKE L  +  EA + ++    E  D 
Sbjct  507  LERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQAKELKDA  566

Query  115  KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             +Q++ AL+E   L     ++   K  V  Q+     E++ +  +++A  +E +  E   
Sbjct  567  HQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLR  626

Query  175  RAASEQARQL---ESEREALQQQHSVQVDQLRMQGQSV--------EAALRMERQAASEE  223
            +    Q        S+   L++       Q+  + +++          A    +Q  S+ 
Sbjct  627  KELEAQLDDAVAEASKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKI  686

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
            K +L +  + Y    +E      S V+  +  +    +    QL   +E L+ K + ++K
Sbjct  687  KSELEKKVLFYE---EELVRREASHVLEVKNVKKEVHDSESHQLALQKEILMLKDK-LEK  742

Query  284  LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
             K E  +H  + E V  +K + +  +A    E    +KL  + E L   +++L  +  +L
Sbjct  743  SKRE--RHNEMEEAVGTIKDKYERERAMLFDE---NKKLTAENEKLCSFVDKLTAQNRQL  797

Query  344  KASCQESARIED  355
            +   Q+ A  ++
Sbjct  798  EDELQDLAAKKE  809


 Score = 65.6 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 59/318 (19%), Positives = 139/318 (44%), Gaps = 18/318 (6%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQR--------EEKEFLMCKFQE  99
               ++R  +E  EL   +++S Q ++           S R        EE E L  K  +
Sbjct  444  ERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKLNEEIERLKNKIAD  503

Query  100  ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
            +   +ER   + + L++++E + + +  L++  + + ++K  +  Q+      L+     
Sbjct  504  S-NRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQAKE  562

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
            L+ A ++ +         +E+  +L ++++ + +Q   + +++ +  Q V+A +R E + 
Sbjct  563  LKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDA-MRQEMRR  621

Query  220  ASEEKRKL-AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK-QQLQQAEEALVAK  277
            A + +++L AQL  A  +  +E    ++       ++   +LE LK +Q  +   A +  
Sbjct  622  AEKLRKELEAQLDDAVAEASKE--RKLREHSENFCKQMESELEALKVKQGGRGAGATLEH  679

Query  278  QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
            Q+ I K+K E E+  +  E   V +  + +     + +   +E    +   L  Q E L 
Sbjct  680  QQEISKIKSELEKKVLFYEEELVRREASHV----LEVKNVKKEVHDSESHQLALQKEILM  735

Query  338  REYSKLKASCQESARIED  355
             +    K+  +    +E+
Sbjct  736  LKDKLEKSKRERHNEMEE  753


 Score = 59.1 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 64/331 (19%), Positives = 130/331 (39%), Gaps = 54/331 (16%)

Query  39   LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILR--------ERCEELLHFQASQR---  87
            LHLP   G   T + C  +   L+ +I QSN + +        E   ++  ++   R   
Sbjct  394  LHLPF-IGFTFTTESCFSDRGSLK-SIMQSNTLTKDEDVQRDLEHSLQMEAYERRIRRLE  451

Query  88   EEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVT  147
            +EK  L  K QE+ + V+ L      L                         ++   ++ 
Sbjct  452  QEKLELSRKLQESTQTVQSLHGSSRALSN-----------------------SNRDKEIK  488

Query  148  SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
             L  E++  ++++  + +  + LE       E+    +  R   +Q   V+ ++  +  Q
Sbjct  489  KLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQ  548

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
             VEA+ R++ Q A E K    Q ++A  Q F E +  +       ++    QL D ++++
Sbjct  549  LVEASERLKSQ-AKELKDAHQQRKLAL-QEFSELNERMAELRAQKQKVSR-QLRDKEEEM  605

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
            + A +        +D +++E  + +        L+ + +    D  AE     KL E  E
Sbjct  606  EVATQ-------KVDAMRQEMRRAEK-------LRKELEAQLDDAVAEASKERKLREHSE  651

Query  328  LLQEQLEQLQREYSKLKASCQESARIEDMRK  358
               +Q+E    E  K+K   + +    + ++
Sbjct  652  NFCKQMESEL-EALKVKQGGRGAGATLEHQQ  681


>sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta 
OS=Rattus norvegicus OX=10116 GN=Cdc42bpb PE=1 SV=1
Length=1713

 Score = 69.9 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 67/312 (21%), Positives = 136/312 (44%), Gaps = 20/312 (6%)

Query  55   LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
            LE   E    +RQ ++   +R + L       R+EKE L  +  EA + ++    E  D 
Sbjct  507  LERQLEDTVTLRQEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDA  566

Query  115  KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE-------AATKEC  167
             +Q+++AL+E   L     ++   K  V  Q+     E++ +  +++        + K  
Sbjct  567  HQQRKRALQEFSELNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDSMRQDIRKSEKSR  626

Query  168  QALEGRARAA---SEQARQLESEREALQQQHSVQVDQLRM-QGQSVEAALRMERQAASEE  223
            + LE R   A   + + R+L    E+  +Q   +++ L++ QG     A    +Q  S+ 
Sbjct  627  KELEARLEDAVAEASKERKLREHSESFSKQMERELETLKVKQGGRGPGATLEHQQEISKI  686

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
            + +L +  + Y    +E      S V+  +  +    E    QL   +E L+ K + ++K
Sbjct  687  RSELEKKVLFYE---EELVRREASHVLEVKNVKKEVHESESHQLALQKEVLMLKDK-LEK  742

Query  284  LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
             K E  +H  + E +  +K + +  +A    E    +KL  + E L   +++L  +  +L
Sbjct  743  SKRE--RHSEMEEAIGAMKDKYERERAMLFDE---NKKLTAENEKLCSFVDKLTAQNRQL  797

Query  344  KASCQESARIED  355
            +   Q+ A  ++
Sbjct  798  EDELQDLASKKE  809


 Score = 64.9 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 50/321 (16%), Positives = 133/321 (41%), Gaps = 24/321 (7%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQR--------EEKEFLMCKFQE  99
               ++R  +E  EL   +++S Q ++           S R        EE E +  K  +
Sbjct  444  ERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSKMAD  503

Query  100  ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
            +   +ER   + + L+++ E + + ++ L++  +   ++K  +  Q+      L+     
Sbjct  504  S-NRLERQLEDTVTLRQEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKE  562

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR---MQGQSVEAALRME  216
            L+ A ++ +         +E+  +L S+++ + +Q   + +++     +  S+   +R  
Sbjct  563  LKDAHQQRKRALQEFSELNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDSMRQDIRKS  622

Query  217  RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK-QQLQQAEEALV  275
             ++  E + +L        +     +  ++       ++   +LE LK +Q  +   A +
Sbjct  623  EKSRKELEARLEDAVAEASK-----ERKLREHSESFSKQMERELETLKVKQGGRGPGATL  677

Query  276  AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAE-KKELLQEQLE  334
              Q+ I K++ E E+  +  E   V +  + + +      +  ++++ E +   L  Q E
Sbjct  678  EHQQEISKIRSELEKKVLFYEEELVRREASHVLEV-----KNVKKEVHESESHQLALQKE  732

Query  335  QLQREYSKLKASCQESARIED  355
             L  +    K+  +  + +E+
Sbjct  733  VLMLKDKLEKSKRERHSEMEE  753


 Score = 59.5 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 59/358 (16%), Positives = 133/358 (37%), Gaps = 22/358 (6%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEAR  101
            Q   ++ QR     ++ R A ++  ++ ++  E     ++  +E K+    +    QE  
Sbjct  519  QEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFS  578

Query  102  KLVERLGL---EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            +L ER+     +K  + RQ      E+E   +    M +D    +     L   L+++ +
Sbjct  579  ELNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDSMRQDIRKSEKSRKELEARLEDAVA  638

Query  159  RLEAATKECQALEGRARAASEQARQLESER--------EALQQQHSVQVDQLRMQGQSVE  210
                  K  +  E  ++    +   L+ ++           QQ+ S    +L  +    E
Sbjct  639  EASKERKLREHSESFSKQMERELETLKVKQGGRGPGATLEHQQEISKIRSELEKKVLFYE  698

Query  211  AAL-RMERQAASEEKR--KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              L R E     E K   K      ++    Q+    +K  +  S+R+R  ++E+    +
Sbjct  699  EELVRREASHVLEVKNVKKEVHESESHQLALQKEVLMLKDKLEKSKRERHSEMEEAIGAM  758

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
            +  ++    +  + D+ K+   +++ +   V  L AQ    + + Q     +E +A  + 
Sbjct  759  K--DKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLASKKESVAHWEA  816

Query  328  LLQEQLEQLQREYSK---LKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALP  382
             + E ++ +  E      L+A   +     +  +     S+   P      S  L + 
Sbjct  817  QIAEIIQWVSDEKDARGYLQALASKMTEELETLRSSSLGSRTLDPLWKVRRSQKLDMS  874


 Score = 59.1 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 50/229 (22%), Positives = 99/229 (43%), Gaps = 11/229 (5%)

Query  140  ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA-----SEQARQLESEREALQQQ  194
             + + ++  L  E  E   +L+ +T+  Q+L G  RA       ++ ++L  E E ++ +
Sbjct  441  EAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSK  500

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
             +   ++L  Q +         RQ   +  ++L  L+  Y    QE +   K  V  SER
Sbjct  501  MA-DSNRLERQLEDTVTL----RQEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASER  555

Query  255  KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             +  Q ++LK   QQ + AL    E+ +++ E   Q + V   +   + + ++      +
Sbjct  556  LKS-QTKELKDAHQQRKRALQEFSELNERMAELRSQKQKVSRQLRDKEEEMEVAMQKIDS  614

Query  315  ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEV  363
             RQ   K  + ++ L+ +LE    E SK +   + S       +R +E 
Sbjct  615  MRQDIRKSEKSRKELEARLEDAVAEASKERKLREHSESFSKQMERELET  663


 Score = 57.5 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 50/309 (16%), Positives = 111/309 (36%), Gaps = 41/309 (13%)

Query  50   TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
            +L+  ++ N   +D   Q +     + E          +EK  L  K QE+ + V+ L  
Sbjct  414  SLKSMIQSNTLTKDEDVQRDLENSLQIEAYERRIRRLEQEKLELSRKLQESTQTVQSLHG  473

Query  110  EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
                L             +KR  +++   K+ +               +RLE   ++   
Sbjct  474  STRALGNSNRDKE-----IKRLNEELERMKSKMAD------------SNRLERQLEDTVT  516

Query  170  LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQ  229
            L      ++++ + LE +    +Q+      QL    + +++  +  + A  + KR L  
Sbjct  517  LRQEHEDSTQRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRAL--  574

Query  230  LQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
                  Q F E +  +       ++        L+ + ++ E A+      ID ++++  
Sbjct  575  ------QEFSELNERMAELRSQKQKVSR----QLRDKEEEMEVAMQ----KIDSMRQDIR  620

Query  290  QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
            + +         + + +    D  AE     KL E  E   +Q+E+   E  K+K   + 
Sbjct  621  KSEKS-------RKELEARLEDAVAEASKERKLREHSESFSKQMEREL-ETLKVKQGGRG  672

Query  350  SARIEDMRK  358
                 + ++
Sbjct  673  PGATLEHQQ  681


>sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta 
OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
Length=1713

 Score = 69.5 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/312 (19%), Positives = 130/312 (42%), Gaps = 20/312 (6%)

Query  55   LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
            LE   E    +RQ ++    R + L       R+EKE L  +  EA + ++    E  D 
Sbjct  507  LERQLEDTVTLRQEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDA  566

Query  115  KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             +Q+++AL+E   L     ++   K  V  Q+     E++ +  ++++  ++ +  E   
Sbjct  567  HQQRKRALQEFSELNERMSELRSLKQKVSRQLRDKEEEMEVAMQKIDSMRQDLRKSEKSR  626

Query  175  RAASEQARQLESE---REALQQQHSVQVDQLRMQGQSVE--------AALRMERQAASEE  223
            +    +     +E      L++       Q+  + ++++         A    +Q  S+ 
Sbjct  627  KELEARLEDAAAEASKERKLREHSESFCKQMERELEALKVKQGGRGPGAASEHQQEISKI  686

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
            + +L +  + Y    +E      S V+  +  +    +    QL   +E L+ K + ++K
Sbjct  687  RSELEKKVLFYE---EELVRREASHVLEVKNVKKEVHDSESHQLALQKEVLMLKDK-LEK  742

Query  284  LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
             K E  +H  + E +  +K + +  +A    E    +KL  + E L   +++L  +  +L
Sbjct  743  SKRE--RHSEMEEAIGTVKDKYERERAMLFDE---NKKLTAENEKLCSFVDKLTAQNRQL  797

Query  344  KASCQESARIED  355
            +   Q+ A  ++
Sbjct  798  EDELQDLASKKE  809


 Score = 62.5 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 53/322 (16%), Positives = 129/322 (40%), Gaps = 26/322 (8%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQR--------EEKEFLMCKFQE  99
               ++R  +E  EL   +++S Q ++           S R        EE E +  K  +
Sbjct  444  ERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSKMAD  503

Query  100  ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
            +   +ER   + + L+++ E +   ++ L++  +   ++K  +  Q+      L+     
Sbjct  504  S-NRLERQLEDTVTLRQEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKE  562

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR---MQGQSVEAALRME  216
            L+ A ++ +         +E+  +L S ++ + +Q   + +++     +  S+   LR  
Sbjct  563  LKDAHQQRKRALQEFSELNERMSELRSLKQKVSRQLRDKEEEMEVAMQKIDSMRQDLRKS  622

Query  217  RQAASEEKRKL--AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
             ++  E + +L  A  + +  +  +E+           ER    +LE LK +        
Sbjct  623  EKSRKELEARLEDAAAEASKERKLREHSESF---CKQMER----ELEALKVKQGGRGPGA  675

Query  275  VAK-QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQL  333
             ++ Q+ I K++ E E+  +  E   V +  + +     + +   +E    +   L  Q 
Sbjct  676  ASEHQQEISKIRSELEKKVLFYEEELVRREASHV----LEVKNVKKEVHDSESHQLALQK  731

Query  334  EQLQREYSKLKASCQESARIED  355
            E L  +    K+  +  + +E+
Sbjct  732  EVLMLKDKLEKSKRERHSEMEE  753


 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 55/359 (15%), Positives = 134/359 (37%), Gaps = 24/359 (7%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEAR  101
            Q   ++  R     ++ R A ++  ++ ++  E     ++  +E K+    +    QE  
Sbjct  519  QEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFS  578

Query  102  KLVERLGLEKLDLKR----QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
            +L ER+  E   LK+    Q      E+E   +    M +D    +     L   L+++ 
Sbjct  579  ELNERMS-ELRSLKQKVSRQLRDKEEEMEVAMQKIDSMRQDLRKSEKSRKELEARLEDAA  637

Query  158  SRLEAATKECQALEGRARAASEQARQLESEREALQ----QQHSVQVDQLRMQGQS-----  208
            +      K  +  E   +    +   L+ ++         +H  ++ ++R + +      
Sbjct  638  AEASKERKLREHSESFCKQMERELEALKVKQGGRGPGAASEHQQEISKIRSELEKKVLFY  697

Query  209  VEAALRMERQAASEEKRKLAQLQV--AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
             E  +R E     E K    ++    ++    Q+    +K  +  S+R+R  ++E+    
Sbjct  698  EEELVRREASHVLEVKNVKKEVHDSESHQLALQKEVLMLKDKLEKSKRERHSEMEEAIGT  757

Query  267  LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
            ++  ++    +  + D+ K+   +++ +   V  L AQ    + + Q     +E +A  +
Sbjct  758  VK--DKYERERAMLFDENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLASKKESVAHWE  815

Query  327  ELLQEQLEQLQREYSK---LKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALP  382
              + E ++ +  E      L+A   +     +  +     S+   P      S  L + 
Sbjct  816  AQIAEIIQWVSDEKDARGYLQALASKMTEELETLRSSSLGSRTLDPLWKVRRSQKLDMS  874


 Score = 56.0 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 54/258 (21%), Positives = 105/258 (41%), Gaps = 12/258 (5%)

Query  140  ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA-----SEQARQLESEREALQQQ  194
             + + ++  L  E  E   +L+ +T+  Q+L G  RA       ++ ++L  E E ++ +
Sbjct  441  EAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGNSNRDKEIKRLNEELERMKSK  500

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
             +   ++L  Q +         RQ   +   +L  L+  Y    QE +   K  V  SER
Sbjct  501  MA-DSNRLERQLEDTVTL----RQEHEDSTHRLKGLEKQYRLARQEKEELHKQLVEASER  555

Query  255  KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             +  Q ++LK   QQ + AL    E+ +++ E     + V   +   + + ++      +
Sbjct  556  LKS-QTKELKDAHQQRKRALQEFSELNERMSELRSLKQKVSRQLRDKEEEMEVAMQKIDS  614

Query  315  ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI-EDMRKRHVEVSQAPLPPAPA  373
             RQ   K  + ++ L+ +LE    E SK +   + S    + M +    +        P 
Sbjct  615  MRQDLRKSEKSRKELEARLEDAAAEASKERKLREHSESFCKQMERELEALKVKQGGRGPG  674

Query  374  YLSSPLALPSQRRSPPEE  391
              S      S+ RS  E+
Sbjct  675  AASEHQQEISKIRSELEK  692


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 62/331 (19%), Positives = 122/331 (37%), Gaps = 54/331 (16%)

Query  39   LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRER-----CEELLHFQASQR------  87
            LHLP   G   T + C  +   L+ ++ QSN + ++       E  L  +A +R      
Sbjct  394  LHLPF-IGFTFTTESCFSDRGSLK-SMTQSNTLTKDEDVQRDLENSLQIEAYERRIRRLE  451

Query  88   EEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVT  147
            +EK  L  K QE+ + V+ L      L                         ++   ++ 
Sbjct  452  QEKLELSRKLQESTQTVQSLHGSTRALGN-----------------------SNRDKEIK  488

Query  148  SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
             L  EL+  +S++  + +  + LE            L  E E    +      Q R+  Q
Sbjct  489  RLNEELERMKSKMADSNRLERQLEDTV--------TLRQEHEDSTHRLKGLEKQYRLARQ  540

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              E   +   +A+   K +  +L+ A+ Q  +      + +   SE       + + +QL
Sbjct  541  EKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSELNERMSEL--RSLKQKVSRQL  598

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
            +  EE +    + ID ++++  + +         + + +    D  AE     KL E  E
Sbjct  599  RDKEEEMEVAMQKIDSMRQDLRKSEKS-------RKELEARLEDAAAEASKERKLREHSE  651

Query  328  LLQEQLEQLQREYSKLKASCQESARIEDMRK  358
               +Q+E+   E  K+K   +      + ++
Sbjct  652  SFCKQMEREL-EALKVKQGGRGPGAASEHQQ  681


>sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus 
OX=10090 GN=Lama2 PE=1 SV=2
Length=3118

 Score = 69.5 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 61/318 (19%), Positives = 126/318 (40%), Gaps = 35/318 (11%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q A  T  R  E  +E    + Q  + + E+  +L     +Q +  E      +E +K +
Sbjct  1662  QDAERTNSRA-ESLEEFIKGLVQDAEAINEKAVQLNETLGNQDKTAE---RNLEELQKEI  1717

Query  105   ERLGLEKL--DLKRQKEQALREV----EHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
             +R+  E    DL+ QKE A  E+      LKR  +   E +A  +     L  +L E ++
Sbjct  1718  DRMLKELRSKDLQTQKEVAEDELVAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKN  1777

Query  159   RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQ  218
             +L+ A    +    + R A+  +   +     L+ +    ++  + Q ++       E  
Sbjct  1778  KLDDAWDLLREATDKTRDANRLSAANQKNMTILETKKE-AIEGSKRQIENTL----KEGN  1832

Query  219   AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
                +E  +L    +       +Y + IK+ +     +   +++DL Q+++  +  L  K 
Sbjct  1833  DILDEANRL----LGEINSVIDYVDDIKTKLPPMSEELSDKIDDLAQEIK--DRRLAEKV  1886

Query  279   EVIDKLKEEAEQHKIVMETV------------PVLKAQADIYKADFQAERQARE--KLAE  324
                +    +      V++ +               +A ++I     +AE+ ARE  +LA+
Sbjct  1887  FQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFRAYSNIKDYIDEAEKVAREAKELAQ  1946

Query  325   KKELLQEQLEQLQREYSK  342
                 L    + L +E +K
Sbjct  1947  GATKLATSPQGLLKEDAK  1964


>sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha 
OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
Length=1732

 Score = 67.9 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 51/324 (16%), Positives = 133/324 (41%), Gaps = 22/324 (7%)

Query  64   AIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALR  123
            ++++  + LR++  E+ H    Q EE   +  +  +A + ++    +   L++++E+  +
Sbjct  491  SLKEEIEKLRKQVAEVNHL-EQQLEEANSVRRELDDAFRQIKAFEKQIKTLQQEREELNK  549

Query  124  EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
            E+       +  +++      Q    + E  E   RL     + Q L    R   E+   
Sbjct  550  ELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDL  609

Query  184  LESEREALQQQH---SVQVDQLRMQGQSVEAALRMER----------QAASEEKRKLAQL  230
            +  + E+L+Q+         +L +  +++ A    +R          +    E   L Q 
Sbjct  610  VMQKAESLRQELRRAERAKKELEVHTEALIAEASKDRKLREQSRHYSKQLENELEGLKQK  669

Query  231  QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI-DKLKEEAE  289
            Q++Y       ++  + + + ++ ++     +  +++ + E    ++ + +  +L +   
Sbjct  670  QISYSPGICSIEHQQEITKLKTDLEKKSIFYE--EEISKREGIHASEIKNLKKELHDSEG  727

Query  290  QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
            Q   + + + VLK + +  + + Q+ER+  E   E K+  + +   L  E  KL +   +
Sbjct  728  QQLALNKEIMVLKDKLEKTRRESQSEREEFEN--EFKQQYEREKVLLTEENKKLTSELDK  785

Query  350  SARIED---MRKRHVEVSQAPLPP  370
               + +   +R +H+E     L  
Sbjct  786  LTSLYESLSLRNQHLEEEVKDLAD  809


>sp|Q92614|MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens 
OX=9606 GN=MYO18A PE=1 SV=3
Length=2054

 Score = 67.9 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 74/378 (20%), Positives = 153/378 (40%), Gaps = 42/378 (11%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             +   LQ+  ++ Q L   ++ +   L  +       +  QR     L    +EA    +R
Sbjct  1421  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEA----QR  1476

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
               L++  L+R+K+  L E   LK+  ++   D A    +V SL  ELQ+  S+       
Sbjct  1477  EKLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEAS  1536

Query  167   CQALEGRARAASEQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                ++ + R    + +  E    E+    Q       +L M+ + +      E ++  EE
Sbjct  1537  LAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEE  1596

Query  224   --------KRKLAQLQVAYHQLFQEYDNHIKSSVV----------GSERKRGMQLEDLKQ  265
                     ++KL Q++V   + +++    ++                 R+     + L++
Sbjct  1597  VEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRK  1656

Query  266   QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE-----  320
              L++ +  L   Q ++D LK  A   + + +    L+ +++   A     R+A E     
Sbjct  1657  DLKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLE-ESEFTCAAAVKARKAMEVEIED  1715

Query  321   ------KLAEKKELLQEQLEQLQREYSKLKASCQE-SARIEDMRKRHVEVSQAPLPPAPA  373
                    +A+ K  L+EQL +LQRE ++++   +E    + ++ K+H    +A +  A  
Sbjct  1716  LHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKH----KAAVAQASR  1771

Query  374   YLSSPLALPSQRRSPPEE  391
              L+    L +Q     +E
Sbjct  1772  DLAQINDLQAQLEEANKE  1789


 Score = 50.2 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 82/196 (42%), Gaps = 16/196 (8%)

Query  102   KLVERLGLEKLDLKRQKEQALREV-EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
             + + RL  EK +++ + E+   ++ E +K+ +  +A+    + AQ+  L  +L+E+    
Sbjct  1732  EQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDL-AQINDLQAQLEEANKEK  1790

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             +   ++ QAL+ +     +         ++L  +   ++ +L  + +     ++     A
Sbjct  1791  QELQEKLQALQSQVEFLEQSM-----VDKSLVSRQEAKIRELETRLEFERTQVKRLESLA  1845

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             S  K  +        +L +E D  I +     E+ + +Q +    + +  E  L  K+  
Sbjct  1846  SRLKENM-------EKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGE--LARKEAE  1896

Query  281   IDKLKEEAEQHKIVME  296
               + K E E     +E
Sbjct  1897  ASRKKHELEMDLESLE  1912


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 111/270 (41%), Gaps = 34/270 (13%)

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ--------VTSLLGELQESQSRLEAAT  164
             + + + E+A+REV+  K+  QQ  EDK  V+ Q        +  L  + +ESQ  L+   
Sbjct  1370  EWRLKYERAVREVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLK  1429

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             K+CQ L    +         +     L+++      +L    +  +   +++R+    EK
Sbjct  1430  KKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQRE-KLQREKLQREK  1488

Query  225   RKLAQLQVAYHQLFQEYD-------------NHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
               L     +  Q  +E D                   +   E K    L  +K+QL+  E
Sbjct  1489  DMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLE  1548

Query  272   EALVAKQEVIDK-------LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAE  324
               +  ++E +D+       L++   + ++ ME +    ++ ++   D + E +AR+   +
Sbjct  1549  AKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSK-EMESRDEEVE-EARQSCQK  1606

Query  325   KKELLQEQLEQLQREYSKLKASCQESARIE  354
             K + ++ QLE    EY   +   +E   +E
Sbjct  1607  KLKQMEVQLE---EEYEDKQKVLREKRELE  1633


 Score = 48.7 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 44/286 (15%), Positives = 116/286 (41%), Gaps = 18/286 (6%)

Query  83    QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASV  142
             Q  + +E+   +   ++A+  +E   +E   +++   + +   +      +++ E + S 
Sbjct  1554  QEEELDEQAGTIQMLEQAKLRLE---MEMERMRQTHSKEMESRD------EEVEEARQSC  1604

Query  143   KAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQL  202
             + ++  +  +L+E     +   +E + LEG+    S+Q  + + E E   ++   +   L
Sbjct  1605  QKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKAL  1664

Query  203   RMQGQSVEAALRMERQAASEEKRKLAQLQVAY---------HQLFQEYDNHIKSSVVGSE  253
                 Q +   L+    +  E  +   QL+ +           +  +     +   +    
Sbjct  1665  LADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIA  1724

Query  254   RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ  313
             + +    E L +  ++  E     +E  + + E  ++HK  +       AQ +  +A  +
Sbjct  1725  KAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLE  1784

Query  314   AERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
                + +++L EK + LQ Q+E L++         ++ A+I ++  R
Sbjct  1785  EANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETR  1830


 Score = 39.4 bits (90),  Expect = 0.066, Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 91/241 (38%), Gaps = 12/241 (5%)

Query  22    ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLH  81
              DQ+ + E     K A+     +      LQ  LEE  + +  +++  Q L+ + E    
Sbjct  1750  EDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVE----  1805

Query  82    FQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQA---LREVEHLKRCQQQMAED  138
             F      +K  +  +  + R+L  RL  E+  +KR +  A      +E L   + Q    
Sbjct  1806  FLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAA  1865

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ  198
             +   K Q   L  +L++++  +    ++      +          LE+  ++LQ    + 
Sbjct  1866  ENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQADLKLA  1925

Query  199   VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
               +       ++AA+  E ++   E   +  LQ    +  +  +     S V SE +  +
Sbjct  1926  FKR----IGDLQAAIEDEMESDENE-DLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRV  1980

Query  259   Q  259
              
Sbjct  1981  D  1981


 Score = 33.3 bits (74),  Expect = 5.3, Method: Composition-based stats.
 Identities = 41/243 (17%), Positives = 96/243 (40%), Gaps = 46/243 (19%)

Query  143   KAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQ---------  193
             + Q+ +   E+Q+ +S+LE A KE   L   +     +  +L SE    +          
Sbjct  1253  EEQIRNKDEEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLL  1312

Query  194   --------QHSVQVDQLRMQGQSVEAALRMERQAASEEK---------------------  224
                     +   ++ +L+ Q  +++  + +      E +                     
Sbjct  1313  DAETAERLRAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWR  1372

Query  225   ----RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                 R + ++     +L QE+++ ++     ++R+   +L DL+   ++++ AL   ++ 
Sbjct  1373  LKYERAVREVDFTKKRLQQEFEDKLEVE-QQNKRQLERRLGDLQADSEESQRALQQLKKK  1431

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREY  340
               +L  E +  K+ +E   V   + +  +  F +E     +  E+ +  + Q E+LQRE 
Sbjct  1432  CQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELS---QAHEEAQREKLQREKLQREK  1488

Query  341   SKL  343
               L
Sbjct  1489  DML  1491


>sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha 
OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
Length=1719

 Score = 66.0 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 50/324 (15%), Positives = 133/324 (41%), Gaps = 22/324 (7%)

Query  64   AIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALR  123
            ++++  + LR++  E+ H    Q EE   +  +  +A + ++    +   L++++E+  +
Sbjct  491  SLKEEIEKLRKQVAEVNHL-EQQLEEANSVRRELDDAFRQIKASEKQIKTLQQEREELNK  549

Query  124  EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
            E+       +  +++      Q    + E  E   RL     + Q L    R   E+   
Sbjct  550  ELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDL  609

Query  184  LESEREALQQQH---SVQVDQLRMQGQSVEAALRMER----------QAASEEKRKLAQL  230
            +  + E+L+Q+         +L +  +++ A    ++          +    E   L Q 
Sbjct  610  VMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLENELEGLKQK  669

Query  231  QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI-DKLKEEAE  289
            Q++Y       ++  + + + ++ ++     +  +++ + E    ++ + +  +L +   
Sbjct  670  QISYSPGICSIEHQQEITKLKTDLEKKSIFYE--EEISKREGIHASEIKNLKKELHDSEG  727

Query  290  QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
            Q   + + + VLK + +  + + Q+ER+  E   E K+  + +   L  E  KL +   +
Sbjct  728  QQLALNKEILVLKDKLEKTRRESQSEREEFEN--EFKQQYEREKVLLTEENKKLTSELDK  785

Query  350  SARIED---MRKRHVEVSQAPLPP  370
               + +   +R +H+E     L  
Sbjct  786  LTSLYESLSLRNQHLEEEVKDLAD  809


>sp|Q9JMH9|MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus 
OX=10090 GN=Myo18a PE=1 SV=2
Length=2050

 Score = 65.2 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 66/344 (19%), Positives = 138/344 (40%), Gaps = 39/344 (11%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEEL--------LHFQASQREEKEF---  92
             EQ +   L+R L + Q   D  +++ Q L+++C+ L        LH +  Q    E    
Sbjct  1396  EQQSRRQLERRLGDLQADSDESQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKK  1455

Query  93    ---LMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSL  149
                   +  +A +  +R  L++  L+R+K+  L E   LK+  ++   D A    +V SL
Sbjct  1456  QRRFDSELSQAHEETQREKLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSL  1515

Query  150   LGELQESQSRLEAATKECQALEGRARAASEQARQLE---SEREALQQQHSVQVDQLRMQG  206
               ELQ+  S+          ++ + R    + +  E    E+    Q       +L M+ 
Sbjct  1516  EAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGSIQMLEQAKLRLEMEM  1575

Query  207   QSVEAALRMERQAASEE--------KRKLAQLQVAYHQLFQEYDNHIKSSVV--------  250
             + +      E ++  EE        ++KL Q++V   + +++    ++            
Sbjct  1576  ERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKALREKRELESKLSTL  1635

Query  251   --GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIY  308
                  ++     + L++ L++ +  L   Q ++D LK  A   +     +  LK Q +  
Sbjct  1636  SDQVNQRDFESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKRE----IAQLKNQLEES  1691

Query  309   KADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
             +    A  +AR+ +  + E L  Q++ + +  + L+       R
Sbjct  1692  EFTCAAAVKARKAMEVEMEDLHLQIDDIAKAKTALEEQLSRLQR  1735


 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 48/297 (16%), Positives = 118/297 (40%), Gaps = 15/297 (5%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             ++++  +L      Q EE +      Q   +   RL +E   +++   + +   +     
Sbjct  1536  VKKQLRDLEAKVKDQEEELDEQAGSIQMLEQAKLRLEMEMERMRQTHSKEMESRD-----  1590

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREAL  191
              +++ E + S + ++  +  +L+E     + A +E + LE +    S+Q  Q + E E  
Sbjct  1591  -EEVEEARQSCQKKLKQMEVQLEEEYEDKQKALREKRELESKLSTLSDQVNQRDFESEKR  1649

Query  192   QQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY---------HQLFQEYD  242
              ++   +   L    Q +   L+    +  E  +   QL+ +           +  +   
Sbjct  1650  LRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEM  1709

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
               +   +    + +    E L +  ++  E     +E  + + E  ++HK  +       
Sbjct  1710  EDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDM  1769

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
             AQ +  +A  +   + +++L EK + LQ Q+E L++         ++ A+I ++  R
Sbjct  1770  AQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETR  1826


 Score = 46.4 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 51/280 (18%), Positives = 109/280 (39%), Gaps = 37/280 (13%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             + +  QR  E  + LR  ++++  +L +    L H + +   ++E    K Q     +E 
Sbjct  1636  SDQVNQRDFESEKRLRKDLKRTKALLADAQIMLDHLKNNAPSKREIAQLKNQ-----LEE  1690

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
                      + ++    E+E L      +A+ K +++ Q++ L  E  E Q+RLE   ++
Sbjct  1691  SEFTCAAAVKARKAMEVEMEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQED  1750

Query  167   CQALEGRARAASEQARQLESEREALQ----------QQHSVQVDQLRMQGQSVEA-----  211
                L  + +AA  QA +  ++   LQ          Q+   ++  L+ Q + +E      
Sbjct  1751  MNELMKKHKAAVAQASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVEFLEQSMVDK  1810

Query  212   -------------ALRMERQAAS--EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
                            R+E +       +   ++L+    +L +E D    +     E+ +
Sbjct  1811  SLVSRQEAKIRELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAAENREKEQNK  1870

Query  257   GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
              +Q +    + + +E  L  K+    + K E E     +E
Sbjct  1871  RLQRQLRDTKEEMSE--LARKEAEASRKKHELEMDLESLE  1908


 Score = 42.5 bits (98),  Expect = 0.009, Method: Composition-based stats.
 Identities = 43/241 (18%), Positives = 92/241 (38%), Gaps = 12/241 (5%)

Query  22    ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLH  81
              DQ+ + E     K A+     +      LQ  +EE+ + +  +++  Q L+ + E    
Sbjct  1746  EDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQIEESNKEKQELQEKLQALQSQVE----  1801

Query  82    FQASQREEKEFLMCKFQEARKLVERLGLEKLD---LKRQKEQALREVEHLKRCQQQMAED  138
             F      +K  +  +  + R+L  RL  EK     L+    +    +E L   + Q A  
Sbjct  1802  FLEQSMVDKSLVSRQEAKIRELETRLEFEKTQVKRLENLASRLKETMEKLTEERDQRAAA  1861

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ  198
             +   K Q   L  +L++++  +    ++      +          LE+  ++LQ    + 
Sbjct  1862  ENREKEQNKRLQRQLRDTKEEMSELARKEAEASRKKHELEMDLESLEAANQSLQADLKLA  1921

Query  199   VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
               +       ++AA+  E ++   E   +  LQ    +  ++ +     S V SE +  +
Sbjct  1922  FKR----IGDLQAAIEDEMESDENE-DLINSLQDMVTKYQKKKNKLEGDSDVDSELEDRV  1976

Query  259   Q  259
              
Sbjct  1977  D  1977


>sp|Q9GYV5|NEMO_DROME NF-kappa-B essential modulator OS=Drosophila 
melanogaster OX=7227 GN=key PE=1 SV=1
Length=387

 Score = 63.7 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 63/292 (22%), Positives = 114/292 (39%), Gaps = 25/292 (9%)

Query  146  VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ  205
            + SL G  +E   +L+    E  AL+      ++      +  +  +Q+ + +  Q +  
Sbjct  101  LCSLQGSAEEV-VKLQNMMTEYLALKSTLDKVNQTMLNYHNLTQQWRQEAADREHQYKEH  159

Query  206  GQSVEAALRMERQAASEEKR----KLAQLQVAYHQLFQEYDN-----HIKSSVVGSERKR  256
             +  +A + + R    E KR    K+ Q++  +    +E D        K S++ + R  
Sbjct  160  VKECQAQIAILRVENQELKRDLETKIEQIEGVHTIRLKEQDELRKSVSEKQSLIDNMRVE  219

Query  257  GMQLEDLKQQLQ---------QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADI  307
              +L+ L    +         +++E +   Q  I++LK    Q + V++    L+ Q DI
Sbjct  220  IDKLKQLNHSFEFVPEYATESKSQELIKKMQLDINELKARDIQKQEVIKG---LQIQNDI  276

Query  308  YKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAP  367
            Y+ DF+ ER  REK A +K+     L  LQR   +L  +  ES +           S   
Sbjct  277  YRRDFEMERADREKNAGEKDQYLMDLRSLQRRNQELIEALAESHKASKACS---TASPLS  333

Query  368  LPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE  419
               +         L     S         CP C      +  LQ HV +C++
Sbjct  334  SSRSNLREEQRPILDPTGASSRTSDTTLRCPICSKSFNALSVLQSHVNDCLD  385


>sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma 
OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
Length=1551

 Score = 63.7 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 79/395 (20%), Positives = 152/395 (38%), Gaps = 39/395 (10%)

Query  16   PSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRER  75
            P+G P  D D+  E   L +         Q   + L R   + +EL   ++++ +  RE 
Sbjct  477  PAGSPGQDSDLRQELDRLHRELAEGRAGLQAQEQELCRAQGQQEELLQRLQEAQE--REA  534

Query  76   CEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR-----  130
                     S + E+     +  EA+  V  L  +   L+ Q EQ L E    K      
Sbjct  535  ATASQTRALSSQLEEARAAQRELEAQ--VSSLSRQVTQLQGQWEQRLEESSQAKTIHTAS  592

Query  131  -----CQQQMAEDKASVKAQVTSLLGELQESQS-RLEAATKECQALEGRARAASEQARQL  184
                    +    +A ++ +V +L  +L+++ S R     +    L+   R  S +  +L
Sbjct  593  ETNGMGPPEGGPQEAQLRKEVAALREQLEQAHSHRPSGKEEALCQLQEENRRLSREQERL  652

Query  185  ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS------EEKRKLAQLQVAYHQLF  238
            E+E   L Q+      + R++G+  E     E Q A       +EK     LQ    ++ 
Sbjct  653  EAE---LAQEQE---SKQRLEGERRETESNWEAQLADILSWVNDEKVSRGYLQALATKMA  706

Query  239  QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
            +E +  +++    +   R +  +   ++LQ+ E +  A+ E+   L+ E    + + E +
Sbjct  707  EELE-SLRNVGTQTLPARPLDHQWKARRLQKMEAS--ARLELQSALEAEIRAKQGLQERL  763

Query  299  PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK--ASCQESARIEDM  356
                    + +A  QAER+ +E   ++ + LQ++L  L+ E        +   ++ I  +
Sbjct  764  T------QVQEAQLQAERRLQEA-EKQSQALQQELAMLREELRARGPVDTKPSNSLIPFL  816

Query  357  RKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
              R  E   A  P      +     P  R      
Sbjct  817  SFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRS  851


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 81/404 (20%), Positives = 155/404 (38%), Gaps = 88/404 (22%)

Query  57   ENQELRDAIRQSNQILRERCEELLHFQASQ-----------------REEKEFLMCKFQE  99
            +++EL + +R+  Q LR+R  E+L  +AS                  R+E + L  +  E
Sbjct  442  DHREL-EQLRKEVQTLRDRLPEMLRDKASLSQTDGPPAGSPGQDSDLRQELDRLHRELAE  500

Query  100  ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
             R  ++    E    + Q+E+ L+ +       Q+  E +A+  +Q  +L  +L+E    
Sbjct  501  GRAGLQAQEQELCRAQGQQEELLQRL-------QEAQEREAATASQTRALSSQLEE----  549

Query  160  LEAATKECQALEGRARAASEQARQLESEREA---------------------------LQ  192
               A    + LE +  + S Q  QL+ + E                             +
Sbjct  550  ---ARAAQRELEAQVSSLSRQVTQLQGQWEQRLEESSQAKTIHTASETNGMGPPEGGPQE  606

Query  193  QQHSVQVDQLRMQGQ---SVEAALRMER-QAASEEKRKLAQLQVAYHQLF---QEYDNHI  245
             Q   +V  LR Q +   S   + + E      EE R+L++ Q          QE    +
Sbjct  607  AQLRKEVAALREQLEQAHSHRPSGKEEALCQLQEENRRLSREQERLEAELAQEQESKQRL  666

Query  246  KSSVVGSERKRGMQLEDLKQQLQQAE------EALVAK-QEVIDKLKEEAEQ--------  290
            +     +E     QL D+   +   +      +AL  K  E ++ L+    Q        
Sbjct  667  EGERRETESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTLPARPLD  726

Query  291  HKIVMETVPVLKAQADI-YKADFQAERQAREKLAEKKELLQE---QLEQLQREYSKLKAS  346
            H+     +  ++A A +  ++  +AE +A++ L E+   +QE   Q E+  +E  K   +
Sbjct  727  HQWKARRLQKMEASARLELQSALEAEIRAKQGLQERLTQVQEAQLQAERRLQEAEKQSQA  786

Query  347  CQESARI--EDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSP  388
             Q+   +  E++R R    ++      P +LS   +     + P
Sbjct  787  LQQELAMLREELRARGPVDTKPSNSLIP-FLSFRSSEKDSAKDP  829


 Score = 37.1 bits (84),  Expect = 0.33, Method: Composition-based stats.
 Identities = 28/215 (13%), Positives = 73/215 (34%), Gaps = 4/215 (2%)

Query  184  LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
            LE + + L+Q+      + +    +      +E+     +  +    ++   +      +
Sbjct  415  LERKLQCLEQEKVELSRKHQEALHAPTDHRELEQLRKEVQTLRDRLPEMLRDKASLSQTD  474

Query  244  HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI----DKLKEEAEQHKIVMETVP  299
               +   G +     +L+ L ++L +    L A+++ +     + +E  ++ +   E   
Sbjct  475  GPPAGSPGQDSDLRQELDRLHRELAEGRAGLQAQEQELCRAQGQQEELLQRLQEAQEREA  534

Query  300  VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
               +Q     +  +  R A+ +L  +   L  Q+ QLQ ++ +      ++  I    + 
Sbjct  535  ATASQTRALSSQLEEARAAQRELEAQVSSLSRQVTQLQGQWEQRLEESSQAKTIHTASET  594

Query  360  HVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPD  394
            +        P          AL  Q        P 
Sbjct  595  NGMGPPEGGPQEAQLRKEVAALREQLEQAHSHRPS  629


>sp|D3ZFD0|MY18A_RAT Unconventional myosin-XVIIIa OS=Rattus norvegicus 
OX=10116 GN=Myo18a PE=1 SV=2
Length=2044

 Score = 64.1 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 58/327 (18%), Positives = 128/327 (39%), Gaps = 29/327 (9%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             +   LQ+  ++ Q L   ++ +   L  +       +  QR        +  +A +  +R
Sbjct  1411  SQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRR----FDSELSQAHEETQR  1466

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
               L++  L+R+K+  L E   LK+  ++   D A    +V SL  ELQ+  S+       
Sbjct  1467  EKLQREKLQREKDMLLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAELQDISSQESKDEAS  1526

Query  167   CQALEGRARAASEQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                ++ + R    + +  E    E+    Q       +L M+ + +      E ++  EE
Sbjct  1527  LAKVKKQLRDLEAKVKDQEEELDEQAGSIQMLEQAKLRLEMEMERMRQTHSKEMESRDEE  1586

Query  224   --------KRKLAQLQVAYHQLFQEYDNHIKSSVV----------GSERKRGMQLEDLKQ  265
                     ++KL Q++V   + +++    ++                 ++     + L++
Sbjct  1587  VEEARQSCQKKLRQMEVQLEEEYEDKQKALREKRELESKLSTLSDQVNQRDFESEKRLRK  1646

Query  266   QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK  325
              L++ +  L   Q ++D LK  A   +     +  LK Q +  +    A  +AR+ +  +
Sbjct  1647  DLKRTKALLADAQIMLDHLKNNAPSKRE----IAQLKNQLEESEFTCAAAVKARKAMEVE  1702

Query  326   KELLQEQLEQLQREYSKLKASCQESAR  352
              E L  Q++ + +  + L+       R
Sbjct  1703  MEDLHLQIDDIAKAKTALEEQLSRLQR  1729


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/191 (15%), Positives = 76/191 (40%), Gaps = 7/191 (4%)

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             + + RL  EK +++ + E+   ++  L +  +      +   AQ+  L  +L+ES    +
Sbjct  1722  EQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQLEESNKEKQ  1781

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
                ++ QAL+ +     +         ++L  +   ++ +L  + +  +  ++     AS
Sbjct  1782  ELQEKLQALQSQVEFLEQSM-----VDKSLVSRQEAKIRELETRLEFEKTQVKRLESMAS  1836

Query  222   EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ-QLQQAEEALVAKQEV  280
               K  + +L     Q     +   + +    +R+     E++ +   ++AE +    +  
Sbjct  1837  RLKENMEKLTEERDQRAAAENREKEQNKR-LQRQLRDTKEEMSELARKEAEASRKKHELE  1895

Query  281   IDKLKEEAEQH  291
             +D    EA   
Sbjct  1896  MDLESLEAANQ  1906


 Score = 42.9 bits (99),  Expect = 0.005, Method: Composition-based stats.
 Identities = 43/240 (18%), Positives = 86/240 (36%), Gaps = 9/240 (4%)

Query  22    ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLH  81
              DQ+ + E     K A+     +      LQ  LEE+ + +  +++  Q L+ + E    
Sbjct  1740  EDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQLEESNKEKQELQEKLQALQSQVE----  1795

Query  82    FQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQA---LREVEHLKRCQQQMAED  138
             F      +K  +  +  + R+L  RL  EK  +KR +  A      +E L   + Q A  
Sbjct  1796  FLEQSMVDKSLVSRQEAKIRELETRLEFEKTQVKRLESMASRLKENMEKLTEERDQRAAA  1855

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ  198
             +   K Q   L  +L++++  +    ++      +          LE+  ++LQ    + 
Sbjct  1856  ENREKEQNKRLQRQLRDTKEEMSELARKEAEASRKKHELEMDLESLEAANQSLQADLKLA  1915

Query  199   VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
                 R+          ME     +    L  +   Y +   + +          +R  G+
Sbjct  1916  FK--RIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRVDGV  1973


 Score = 42.1 bits (97),  Expect = 0.009, Method: Composition-based stats.
 Identities = 43/273 (16%), Positives = 112/273 (41%), Gaps = 30/273 (11%)

Query  96    KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQE  155
             + Q + + +     E   L+ + E+  +E       + ++  +   ++ +++ L  EL +
Sbjct  1238  QVQLSEEQIRNKDEEIQQLRNKLEKVEKE-------RNELRLNSDRLETRISELTSELTD  1290

Query  156   SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQL-------------  202
              ++  E+A++   A         ++ ++L+++ +AL++Q      ++             
Sbjct  1291  ERNTGESASQLLDAETAERLRTEKEMKELQTQYDALKKQMEAMDMEVMEARLIRAAEING  1350

Query  203   RMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
              +         R++ + A  E      +     +L QE ++ ++     + R+   +L D
Sbjct  1351  EVDDDDAGGEWRLKYERAVRE------VDFTKKRLQQELEDKMEVE-QQNRRQLERRLGD  1403

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
             L+    +++ AL   ++   +L  E +  K+ +E   V   + +  +  F +E     + 
Sbjct  1404  LQADSDESQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELS---QA  1460

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESARIED  355
              E+ +  + Q E+LQRE   L A      +  +
Sbjct  1461  HEETQREKLQREKLQREKDMLLAEAFSLKQQME  1493


>sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis 
elegans OX=6239 GN=epi-1 PE=1 SV=1
Length=3672

 Score = 62.9 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 77/370 (21%), Positives = 135/370 (36%), Gaps = 73/370 (20%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEK-------EFL---MCKFQEARKLVERLGL  109
             + +D +  S QI  +      H Q S    K       EFL   M + Q AR+ V  L  
Sbjct  2200  DAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAE  2259

Query  110   EKLDLKRQKEQALREVEHLKRCQQ-----------QMAEDKASVKAQVTSLLGELQESQS  158
               L +    +    +   LK  ++           Q  E   +V  ++  +  ++QE   
Sbjct  2260  IALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETE  2319

Query  159   RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ------VDQLRM-QGQSVEA  211
             +L+   K+ +  E + + A E A  L S ++ L++  S           L++ + +++ A
Sbjct  2320  KLD---KQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKSNNIAKMLQLTKVENLVA  2376

Query  212   AL----------RMERQA--------ASEEKRKLAQLQVAYHQLFQEYDN------HIKS  247
             A+          + E Q             K K  ++  A   L +  ++        K 
Sbjct  2377  AITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKK  2436

Query  248   SVVGSERKRGMQL-----EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
              V   E+   MQL      +L  Q     +     ++  D+  E A     + +T+   K
Sbjct  2437  RVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAK  2496

Query  303   AQADIYKADFQAERQ-------AREK-----LAEKKELLQEQLEQLQREYSKLKASCQES  350
             AQ D       AE         AR+K       EK + L + + Q  +E  KLK   ++ 
Sbjct  2497  AQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQL  2556

Query  351   ARI-EDMRKR  359
               + E +RKR
Sbjct  2557  TELSEKLRKR  2566


>sp|A2BGD5|CACO1_DANRE Calcium-binding and coiled-coil domain-containing 
protein 1 OS=Danio rerio OX=7955 GN=calcoco1 PE=3 
SV=1
Length=640

 Score = 62.5 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 58/324 (18%), Positives = 139/324 (43%), Gaps = 13/324 (4%)

Query  38   MLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKF  97
            +L +P  Q     LQ CL+E  EL  A+  ++Q +          + S    ++ L  K 
Sbjct  136  LLVIPRAQLLQSRLQECLKERAELLQALEAADQNVEREKGRRERDRGSWEHTRKELERKI  195

Query  98   QEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
             + ++ V     +  D+K+++++     E L   ++ +   K + + ++  L  +++   
Sbjct  196  DDLKEEVREYREKVEDMKKKQKEVEDLGEALTEEKRALLAQKEANEQRIRELEEDIKILT  255

Query  158  SRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMER  217
             R      + + +  RA+ ++ Q R+ E E + L+    ++++Q   +  S+ A  +  R
Sbjct  256  QRGLERETDLERMRERAKKSAAQKREDEDEHKNLK----LKMEQTEKELHSLSAEFQSLR  311

Query  218  QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             + ++      QL+     L  + ++  +     +      +L  ++++L  +E  +   
Sbjct  312  SSLAQRDTHALQLRDTITTLTHKLNSAHR--KEAANELALNELRSVQERLNVSEHCVETL  369

Query  278  QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ-AERQAREKLAEKKELLQEQLEQ-  335
            +  +  +  + +     +    +  AQ  +  AD   A R+ R   A+++E LQ+  E  
Sbjct  370  RGELRDMVAQRDSAHAELHQARLQAAQLTLQLADASLALREGRANWAQERETLQQNAEID  429

Query  336  ---LQREYSKL--KASCQESARIE  354
               L+R+  ++  K    + AR+E
Sbjct  430  KVRLERQNDEIQQKEEMLQKARME  453


>sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 
PE=1 SV=3
Length=1976

 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 55/345 (16%), Positives = 131/345 (38%), Gaps = 20/345 (6%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +++    +    EE+        EEK  L  + Q   +L       +  L  +K++    
Sbjct  864   VKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEI  923

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
             +  L+   ++  E    ++ +   +   +Q+ + +L+      Q L+     A  + +++
Sbjct  924   LHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKM  983

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E   L+ Q+S  + + ++  +   A    +     E+ + LA+++     +  + +  
Sbjct  984   EEEILLLEDQNSKFIKEKKL-MEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEER  1042

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME--------  296
             +K      +     +   L  +    ++ +   Q  ID+LK +  + +  ++        
Sbjct  1043  LKKEEKTRQELEKAK-RKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDD  1101

Query  297   ----------TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                        V  L+AQ    + DF++E+ +R K  ++K  L E+LE L+ E      +
Sbjct  1102  ETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDT  1161

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   +   R++ V   +  L        + +    QR +   E
Sbjct  1162  TAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALE  1206


 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 68/335 (20%), Positives = 142/335 (42%), Gaps = 34/335 (10%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK-------FQEAR  101
             E L + LEE     D + ++   L++  ++L      QR+    L  K         E +
Sbjct  1402  EALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEK  1461

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
              +  R   E+   + +  +   +   L R  ++  E K   + Q   L  ++++  S  +
Sbjct  1462  SISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKD  1521

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVD---QLRMQGQSVEAALRME--  216
                K    LE   RA  +Q  ++ ++ E L+ +     D   +L +  Q+++A    +  
Sbjct  1522  DVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQ  1581

Query  217   -RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
              R   +EEK++L   QV   +   E +   ++  V S++K  + L+DL+ Q++ A +A  
Sbjct  1582  TRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKA--  1639

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
                               V++ +  L+AQ   Y+ + +  R +R+++  + +  +++L+ 
Sbjct  1640  ---------------RDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKS  1684

Query  336   LQREYSKLKASCQESARIEDMRKRHVEVSQAPLPP  370
             L+ E  +L+     S R     +RH E  +  L  
Sbjct  1685  LEAEILQLQEELASSER----ARRHAEQERDELAD  1715


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 51/314 (16%), Positives = 127/314 (40%), Gaps = 27/314 (9%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
               + + + + + E ++ + A+ Q  + +R + EEL     +  + K  L    Q  +   
Sbjct  1517  MSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQF  1576

Query  105   ERL--------GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             ER           +K  L +Q  +   E+E  ++ +      K  ++  +  L  +++ +
Sbjct  1577  ERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAA  1636

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 +   K+ + L+ + +    +  +  + R+ +  Q      +L+    S+EA +   
Sbjct  1637  NKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLK----SLEAEILQL  1692

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++  +  +R     +    +L  E  N         + KR      L+ ++ Q EE L  
Sbjct  1693  QEELASSERARRHAEQERDELADEITNSASGKSALLDEKRR-----LEARIAQLEEELEE  1747

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             +Q  ++ L +   +  + ++T+           A+  AER A +K    ++ L+ Q ++L
Sbjct  1748  EQSNMELLNDRFRKTTLQVDTLN----------AELAAERSAAQKSDNARQQLERQNKEL  1797

Query  337   QREYSKLKASCQES  350
             + +  +L+ + +  
Sbjct  1798  KAKLQELEGAVKSK  1811


 Score = 41.7 bits (96),  Expect = 0.013, Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 115/309 (37%), Gaps = 29/309 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E LQ  L    +       + +++RE   ++   Q     EK       ++ R L E L
Sbjct  1089  EEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEEL  1148

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGE-----------LQES  156
                K +L+   +    + E   + +Q++AE K +++ +  +   +           L+E 
Sbjct  1149  EALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEEL  1208

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQ---QHSVQVDQLRMQGQSVEAAL  213
               +LE A +    LE   +      ++L  E + LQQ   +   +  +L  Q Q + A +
Sbjct  1209  SEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKV  1268

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA  273
                 +   E   K ++LQ     +    +   K  +  ++         L+ QLQ  +E 
Sbjct  1269  SEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAAS-----LESQLQDTQEL  1323

Query  274   LVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQL  333
             L  +      L     Q +    ++   + + +          +AR+ L ++   LQ QL
Sbjct  1324  LQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEE----------EARKNLEKQVLALQSQL  1373

Query  334   EQLQREYSK  342
                +++   
Sbjct  1374  ADTKKKVDD  1382


 Score = 40.2 bits (92),  Expect = 0.038, Method: Composition-based stats.
 Identities = 60/352 (17%), Positives = 123/352 (35%), Gaps = 27/352 (8%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQ----REEKEFLMCKFQEARKLVERLGLEKLDL  114
             QELR    Q    L++  EE      +Q    R+     + +  E  +  +R        
Sbjct  1166  QELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKN  1225

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             K+  E   +E+    +  QQ+   KA  + +   L  ++QE  +++    +    L  +A
Sbjct  1226  KQGLETDNKELACEVKVLQQV---KAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKA  1282

Query  175   RAASEQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                  +      L  E E    + +     L  Q Q  +  L+ E +       ++ QL+
Sbjct  1283  SKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLE  1342

Query  232   VAYHQL-------------FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
                + L              ++    ++S +  +++K    L  ++   +  ++ L   +
Sbjct  1343  EEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAE  1402

Query  279   EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
              +  +L+E+A  +  + +T   L+ + D    D   +RQ    L    E  Q++ +QL  
Sbjct  1403  ALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNL----EKKQKKFDQLLA  1458

Query  339   EYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPE  390
             E   + A   E     +   R  E     L  A            ++     
Sbjct  1459  EEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLR  1510


 Score = 40.2 bits (92),  Expect = 0.044, Method: Composition-based stats.
 Identities = 59/300 (20%), Positives = 117/300 (39%), Gaps = 12/300 (4%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q     + R E +   +  Q + K++   + +EAR   + +  +  + +++ +
Sbjct  1625  DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDY-QRELEEARASRDEIFAQSKESEKKLK  1683

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                 E+  L+         +   + +   L  E+  S S   A   E + LE R     E
Sbjct  1684  SLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEE  1743

Query  180   QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL--  237
             +  + +S  E L  +         +Q  ++ A L  ER AA +      QL+    +L  
Sbjct  1744  ELEEEQSNMELLNDRFRKTT----LQVDTLNAELAAERSAAQKSDNARQQLERQNKELKA  1799

Query  238   -FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI----DKLKEEAEQHK  292
               QE +  +KS    +      ++  L++QL+Q  +   A  +++     KLKE   Q +
Sbjct  1800  KLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVE  1859

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                      K Q +   A  +  ++  E+  E+         +LQRE      + +  +R
Sbjct  1860  DERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSR  1919


 Score = 34.4 bits (77),  Expect = 2.4, Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (1%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +  QR LEE +  RD I   ++   ++ + L       +EE        + A +  
Sbjct  1651  QAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQER  1710

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             + L  E  +    K   L E   L+    Q+ E+    ++ +  L    +++  +++   
Sbjct  1711  DELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLN  1770

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              E  A    A+ +    +QLE + + L+ +       ++ + ++  +AL  +     E+ 
Sbjct  1771  AELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQL  1830

Query  225   RKLAQLQVAYHQLFQEYDNHIKS--SVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
              + A+ + A ++L +  +  +K     V  ER+   Q ++  ++     + L  +
Sbjct  1831  EQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQ  1885


>sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 
PE=1 SV=1
Length=1976

 Score = 61.4 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 129/345 (37%), Gaps = 20/345 (6%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +++    +    EE+        EEK  L  + Q   +L       +  L  +K++    
Sbjct  864   VKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEI  923

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
             +  L+   +   E    ++ +   +   +Q+ + +L+      Q L+     A  + +++
Sbjct  924   LHDLESRVEGEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKM  983

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E   L+ Q+S  + + ++  +   A    +     E+ + LA+++     +  + +  
Sbjct  984   EEEVLLLEDQNSKFIKEKKL-MEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEER  1042

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV----  300
             +K      +     +   L  +    ++ +   Q  +D+LK +  + +  ++        
Sbjct  1043  LKKEEKTRQELEKAK-RKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDD  1101

Query  301   --------------LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                           L+AQ    + DF++E+ +R K  ++K  L E+LE L+ E      +
Sbjct  1102  ETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDT  1161

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   +   R++ V   +  L        + +    QR +   E
Sbjct  1162  TAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALE  1206


 Score = 55.6 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 69/338 (20%), Positives = 143/338 (42%), Gaps = 34/338 (10%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK-------FQEAR  101
             E L + LEE     D + ++   L++  ++L      QR+    L  K         E +
Sbjct  1402  EALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEK  1461

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
              +  R   E+   + +  +   +   L R  ++  E K   + Q   L  ++++  S  +
Sbjct  1462  GISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKD  1521

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVD---QLRMQGQSVEAALRME--  216
                K    LE   RA  +Q  ++ ++ E L+ +     D   +L +  Q+++A    +  
Sbjct  1522  DVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQ  1581

Query  217   -RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
              R   +EEK++L   QV   +   E +   ++  V S++K  + L+DL+ Q++ A +A  
Sbjct  1582  TRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKA--  1639

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
                               V++ +  L+AQ   Y+ + +  R +R+++  + +  +++L+ 
Sbjct  1640  ---------------RDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKS  1684

Query  336   LQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
             L+ E  +L+     S R     +RH E  +  L    A
Sbjct  1685  LEAEILQLQEELASSER----ARRHAEQERDELADEIA  1718


 Score = 39.4 bits (90),  Expect = 0.069, Method: Composition-based stats.
 Identities = 58/300 (19%), Positives = 116/300 (39%), Gaps = 12/300 (4%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q     + R E +   +  Q + K++   + +EAR   + +  +  + +++ +
Sbjct  1625  DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDY-QRELEEARASRDEIFAQSKESEKKLK  1683

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                 E+  L+         +   + +   L  E+  S S   A   E + LE R     E
Sbjct  1684  SLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEE  1743

Query  180   QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL--  237
             +  + +S  E L  +         +Q  ++   L  ER AA +      QL+    +L  
Sbjct  1744  ELEEEQSNMELLNDRFRKTT----LQVDTLNTELAAERSAAQKSDNARQQLERQNKELKA  1799

Query  238   -FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI----DKLKEEAEQHK  292
               QE +  +KS    +      ++  L++QL+Q  +   A  +++     KLKE   Q +
Sbjct  1800  KLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVE  1859

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                      K Q +   A  +  ++  E+  E+         +LQRE      + +  +R
Sbjct  1860  DERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSR  1919


 Score = 38.7 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 50/302 (17%), Positives = 124/302 (41%), Gaps = 10/302 (3%)

Query  62    RDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVE----RLGLEKLDLKRQ  117
             +  + +  + L+   E+ L   A+Q+E +     +  E +K +E        +  D++++
Sbjct  1141  KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQR  1200

Query  118   KEQALRE----VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGR  173
                AL E    +E  KR +  + ++K  ++     L  E++  Q     +  + + L+ +
Sbjct  1201  HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ  1260

Query  174   ARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVA  233
              +    +  + +  R  L ++ +   ++L      +E A +   + A +     +QLQ  
Sbjct  1261  VQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGMKFAKDAAGLESQLQDT  1320

Query  234   YHQLFQEYDNHIK-SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI-DKLKEEAEQH  291
                L +E    +  SS +    +    L++ +++ ++A + L  +   +  +L +  ++ 
Sbjct  1321  QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV  1380

Query  292   KIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESA  351
                + T+  L+        D +A  Q  E+     + L++   +LQ+E   L        
Sbjct  1381  DDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQR  1440

Query  352   RI  353
             +I
Sbjct  1441  QI  1442


 Score = 38.7 bits (88),  Expect = 0.14, Method: Composition-based stats.
 Identities = 53/328 (16%), Positives = 116/328 (35%), Gaps = 19/328 (6%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQ----REEKEFLMCKFQEARKLVERLGLEKLDL  114
             QELR    Q    L++  E+      +Q    R+     + +  E  +  +R        
Sbjct  1166  QELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKN  1225

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             K+  E   +E+    +  QQ+   KA  + +   L  ++QE  +++    +    L  +A
Sbjct  1226  KQGLETDNKELACEVKVLQQV---KAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKA  1282

Query  175   RAASEQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                  +      L  E E    + +     L  Q Q  +  L+ E +       ++ QL+
Sbjct  1283  NKLQNELDNVSTLLEEAEKKGMKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLE  1342

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQ---------LEDLKQQLQQAEEALVAKQEVID  282
                + L ++ +   ++     ++   +Q         ++D    ++  EEA     + ++
Sbjct  1343  EEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIEGLEEAKKKLLKDVE  1402

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
              L +  E+  +  + +   K +      D   +   + ++    E  Q++ +QL  E   
Sbjct  1403  ALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKG  1462

Query  343   LKASCQESARIEDMRKRHVEVSQAPLPP  370
             + A   E     +   R  E     L  
Sbjct  1463  ISARYAEERDRAEAEAREKETKALSLAR  1490


 Score = 37.1 bits (84),  Expect = 0.32, Method: Composition-based stats.
 Identities = 49/315 (16%), Positives = 129/315 (41%), Gaps = 11/315 (3%)

Query  66    RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREV  125
              +  ++L ++  EL      +R+++   +   ++    ++ L  +     + +++ ++++
Sbjct  1588  EEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQL  1647

Query  126   EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
               L+   +    +    +A    +  + +ES+ +L++   E   L+    ++    R  E
Sbjct  1648  RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAE  1707

Query  186   SEREALQQQHSVQVD---QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
              ER+ L  + +        L  + + +EA +    +   EE+  +  L   + +   + D
Sbjct  1708  QERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVD  1767

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                 ++ + +ER    + ++ +QQL++  + L AK + ++   +   + K  +  +    
Sbjct  1768  TL--NTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVK--SKFKATISALEAKI  1823

Query  303   AQADIYKADFQAERQAREKLAEKKE----LLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              Q +        ER A  KL  + E     +  Q+E  +R   + K   +++       K
Sbjct  1824  GQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLK  1883

Query  359   RHVEVSQAPLPPAPA  373
             R +E ++     A A
Sbjct  1884  RQLEEAEEEATRANA  1898


 Score = 35.6 bits (80),  Expect = 1.2, Method: Composition-based stats.
 Identities = 48/310 (15%), Positives = 126/310 (41%), Gaps = 27/310 (9%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             EL+  + +    L ++ EEL    A   +E        + AR+L  ++   + D + +K 
Sbjct  1073  ELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKA  1132

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                +  +  +   +++   K  ++  + +   + +    R +   +  +ALE   +    
Sbjct  1133  SRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEA  1192

Query  180   QARQLESEREALQQQHSVQVDQ--------------LRMQGQSVEAALRMERQAASEEKR  225
             Q + +        ++ S Q++Q              L    + +   +++ +Q  +E + 
Sbjct  1193  QIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEH  1252

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEE----------A  273
             K  +L     +L  +     +  V  +E+   +Q  L+++   L++AE+           
Sbjct  1253  KRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGMKFAKDAAG  1312

Query  274   LVAKQEVIDKLKEEAEQHKIVMET-VPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
             L ++ +   +L +E  + K+ + + +  L+ + +  +   + E +AR+ L ++   LQ Q
Sbjct  1313  LESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQ  1372

Query  333   LEQLQREYSK  342
             L   +++   
Sbjct  1373  LADTKKKVDD  1382


 Score = 35.2 bits (79),  Expect = 1.5, Method: Composition-based stats.
 Identities = 57/339 (17%), Positives = 135/339 (40%), Gaps = 17/339 (5%)

Query  70    QILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLK  129
             ++L++   E  H +     + + L  K  E  +L   L  +   L+ + +     +E  +
Sbjct  1241  KVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAE  1300

Query  130   RCQQQMAEDKASVKAQVTSLLGELQESQ-------SRLEAATKECQALEGRARAASEQAR  182
             +   + A+D A +++Q+      LQE         SR+    +E  +L+ +     E  +
Sbjct  1301  KKGMKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARK  1360

Query  183   QLESEREALQQQHSVQVDQ----------LRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              LE +  ALQ Q +    +          L    + +   +    Q   E+     +L+ 
Sbjct  1361  NLEKQVLALQSQLADTKKKVDDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEK  1420

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK  292
               ++L QE D+         +    ++ +  K     AEE  ++ +   ++ + EAE  +
Sbjct  1421  TKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEARE  1480

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                + + + +A  +  +A  + ERQ ++  A+ ++L+  + +  +  +   K+      +
Sbjct  1481  KETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQ  1540

Query  353   IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
             +E+MR +  E+         A L   + + + +     +
Sbjct  1541  VEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERD  1579


 Score = 34.4 bits (77),  Expect = 2.3, Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (1%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +  QR LEE +  RD I   ++   ++ + L       +EE        + A +  
Sbjct  1651  QAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQER  1710

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             + L  E  +    K   L E   L+    Q+ E+    ++ +  L    +++  +++   
Sbjct  1711  DELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLN  1770

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              E  A    A+ +    +QLE + + L+ +       ++ + ++  +AL  +     E+ 
Sbjct  1771  TELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQL  1830

Query  225   RKLAQLQVAYHQLFQEYDNHIKS--SVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
              + A+ + A ++L +  +  +K     V  ER+   Q ++  ++     + L  +
Sbjct  1831  EQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQ  1885


>sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus OX=9913 GN=MYH10 
PE=2 SV=2
Length=1976

 Score = 61.0 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 55/345 (16%), Positives = 131/345 (38%), Gaps = 20/345 (6%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +++    +    EE+        EEK  L  + Q   +L       +  L  +K++    
Sbjct  864   VKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEI  923

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
             +  L+   ++  E    ++ +   +   +Q+ + +L+      Q L+     A  + +++
Sbjct  924   LHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKM  983

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E   L+ Q+S  + + ++  +   A    +     E+ + LA+++     +  + +  
Sbjct  984   EEEILLLEDQNSKFIKEKKL-MEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEER  1042

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME--------  296
             +K      +     +   L  +    ++ +   Q  ID+LK +  + +  ++        
Sbjct  1043  LKKEEKTRQELEKAK-RKLDGETTDLQDQIAELQAQIDELKIQVAKKEEELQGALARGDD  1101

Query  297   ----------TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                        V  L+AQ    + DF++E+ +R K  ++K  L E+LE L+ E      +
Sbjct  1102  ETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDT  1161

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   +   R++ V   +  L        + +    QR +   E
Sbjct  1162  TAAQQELRTKREQEVAELKKALEEETKSHEAQIQDMRQRHATALE  1206


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 54/340 (16%), Positives = 138/340 (41%), Gaps = 14/340 (4%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             + G  E L+   ++  +  + + Q  +      ++L   +   ++E + L+      R++
Sbjct  1383  DLGTIENLEEAKKKLLKDVEVLSQRLEEKALAYDKLEKTKTRLQQELDDLLVDLDHQRQI  1442

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
             V  L  ++    +   +           + +   +    + +  SL   L+E+    E A
Sbjct  1443  VSNLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAREEA  1502

Query  164   T---KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                 K+ +A      ++ +   +   E E  ++    QV+++R Q + +E  L+    A 
Sbjct  1503  ERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAK  1562

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                +  +  ++  + +  Q  D   +       ++      +L+ + +Q   A+ +K+++
Sbjct  1563  LRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKM  1622

Query  281   IDKLKEEAEQHK-------IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQL  333
                LK+   Q +        V++ +  L+AQ   Y+ + +  R +R+++  + +  +++L
Sbjct  1623  EIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKL  1682

Query  334   EQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
             + L+ E  +L+     S R     +RH E  +  L    A
Sbjct  1683  KSLEAEILQLQEELASSER----ARRHAEQERDELADEIA  1718


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 67/339 (20%), Positives = 130/339 (38%), Gaps = 30/339 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E LQ  L    +       + +++RE   ++   Q     EK       ++ R L E L
Sbjct  1089  EEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEEL  1148

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGE-----------LQES  156
                K +L+   +    + E   + +Q++AE K +++ +  S   +           L+E 
Sbjct  1149  EALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKSHEAQIQDMRQRHATALEEL  1208

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQ---QHSVQVDQLRMQGQSVEAAL  213
               +LE A +    LE   +      ++L  E + LQQ   +   +  +L  Q Q + A +
Sbjct  1209  SEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKV  1268

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM--QLEDLKQQLQQAE  271
                 +   E   K  +LQ     +    +   K  +  ++   G+  QL+D ++ LQ+  
Sbjct  1269  SEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEET  1328

Query  272   EALVAKQEVIDKLKEE-----------AEQHKIVMETVPVLKAQADIYKADFQAERQARE  320
                +     I +L+EE            E  + + + +  L+AQ    K     +    E
Sbjct  1329  RQKLNLSSRIRQLEEERSSLQEQQEEEEEARRSLEKQLQALQAQLTDTKKKVDDDLGTIE  1388

Query  321   KLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
              L E K+ L + +E L     +L+       ++E  + R
Sbjct  1389  NLEEAKKKLLKDVEVL---SQRLEEKALAYDKLEKTKTR  1424


 Score = 39.4 bits (90),  Expect = 0.074, Method: Composition-based stats.
 Identities = 58/300 (19%), Positives = 116/300 (39%), Gaps = 12/300 (4%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q     + R E +   +  Q + K++   + +EAR   + +  +  + +++ +
Sbjct  1625  DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDY-QRELEEARASRDEIFAQSKESEKKLK  1683

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                 E+  L+         +   + +   L  E+  S S   A   E + LE R     E
Sbjct  1684  SLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEE  1743

Query  180   QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL--  237
             +  + +S  E L  +         +Q  ++   L  ER AA +      QL+    +L  
Sbjct  1744  ELEEEQSNMELLNDRFRKTT----LQVDTLNTELAAERSAAQKSDNARQQLERQNKELKA  1799

Query  238   -FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI----DKLKEEAEQHK  292
               QE +  +KS    +      ++  L++QL+Q  +   A  +++     KLKE   Q +
Sbjct  1800  KLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVE  1859

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                      K Q +   A  +  ++  E+  E+         +LQRE      + +  +R
Sbjct  1860  DERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSR  1919


 Score = 37.1 bits (84),  Expect = 0.39, Method: Composition-based stats.
 Identities = 49/315 (16%), Positives = 129/315 (41%), Gaps = 11/315 (3%)

Query  66    RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREV  125
              +  ++L ++  EL      +R+++   +   ++    ++ L  +     + +++ ++++
Sbjct  1588  EEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQL  1647

Query  126   EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
               L+   +    +    +A    +  + +ES+ +L++   E   L+    ++    R  E
Sbjct  1648  RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAE  1707

Query  186   SEREALQQQHSVQVD---QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
              ER+ L  + +        L  + + +EA +    +   EE+  +  L   + +   + D
Sbjct  1708  QERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVD  1767

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                 ++ + +ER    + ++ +QQL++  + L AK + ++   +   + K  +  +    
Sbjct  1768  TL--NTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVK--SKFKATISALEAKI  1823

Query  303   AQADIYKADFQAERQAREKLAEKKE----LLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              Q +        ER A  KL  + E     +  Q+E  +R   + K   +++       K
Sbjct  1824  GQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLK  1883

Query  359   RHVEVSQAPLPPAPA  373
             R +E ++     A A
Sbjct  1884  RQLEEAEEEATRANA  1898


 Score = 34.4 bits (77),  Expect = 2.4, Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (1%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +  QR LEE +  RD I   ++   ++ + L       +EE        + A +  
Sbjct  1651  QAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQER  1710

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             + L  E  +    K   L E   L+    Q+ E+    ++ +  L    +++  +++   
Sbjct  1711  DELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLN  1770

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              E  A    A+ +    +QLE + + L+ +       ++ + ++  +AL  +     E+ 
Sbjct  1771  TELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQL  1830

Query  225   RKLAQLQVAYHQLFQEYDNHIKS--SVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
              + A+ + A ++L +  +  +K     V  ER+   Q ++  ++     + L  +
Sbjct  1831  EQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQ  1885


>sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC 
PE=1 SV=3
Length=4684

 Score = 61.0 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 63/298 (21%), Positives = 125/298 (42%), Gaps = 18/298 (6%)

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             RQK+ A  E+E  K+  +Q    KA V+ ++T+L  +L+E+  +     +E Q L+  A 
Sbjct  2295  RQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEAT  2354

Query  176   AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
              A+ Q  Q+E E  +++    VQ+++L      +EA  R       +  ++  Q +    
Sbjct  2355  EAARQRSQVEEELFSVR----VQMEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKM  2410

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
             +   E    +  +   + R R +  EDL QQ   AE+ L  K + + +      + +   
Sbjct  2411  KQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAE---  2467

Query  296   ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
                 +L+ Q ++      A+ QAR +L E KE + +QL +  + + +   + ++      
Sbjct  2468  ----LLQQQKEL------AQEQAR-RLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMS  2516

Query  356   MRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIH  413
                  +++  A +  A A          ++     E         Q +   + TL+I 
Sbjct  2517  AEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQ  2574


 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 62/309 (20%), Positives = 128/309 (41%), Gaps = 19/309 (6%)

Query  63    DAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL  122
             +++ Q    LR    EL    +   +     + + +E  +L E+   E+ +   + E AL
Sbjct  1447  ESVIQEYVDLRTHYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAAL  1506

Query  123   REVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
              +   L    +  A+ KA  + +   L   +QE   R E A  + Q  +   +   +Q R
Sbjct  1507  EKQRQLA---EAHAQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLR  1563

Query  183   QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
             Q        + + +   ++ R++ +     +R++ +A   ++        A     +E +
Sbjct  1564  QSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAEEAE  1623

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                + +   +ER R  Q++D  Q+ +QAE  L ++   +    E A + +  ++ +  L+
Sbjct  1624  AQKRQAQEEAERLRR-QVQDESQRKRQAEVELASR---VKAEAEAAREKQRALQALEELR  1679

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES------ARIEDM  356
              QA+      +AER+ R+   E+   +Q  LE  QR       S + S           +
Sbjct  1680  LQAE------EAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERSL  1733

Query  357   RKRHVEVSQ  365
             ++ HV V+Q
Sbjct  1734  QEEHVAVAQ  1742


 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 45/248 (18%), Positives = 105/248 (42%), Gaps = 9/248 (4%)

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             RQ+E A +E+E  ++  +  A+ + + + ++  L  E ++ + + +   +E   L+  A 
Sbjct  1822  RQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAA  1881

Query  176   AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
             AA+++ ++LE+E   ++ +  V +       +   +     +Q    E  +  +L     
Sbjct  1882  AATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFREL-----  1936

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
                 E    +++    ++R+R +  ED  +Q  +AE  L  K   I +      + +I +
Sbjct  1937  ---AEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLAEKLAAIGEATRLKTEAEIAL  1993

Query  296   ETVPVLKAQADIYKAD-FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIE  354
             +       +      D     R+  E+ A+ K  ++E+L QL++         +      
Sbjct  1994  KEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASDSELERQKGLVEDT  2053

Query  355   DMRKRHVE  362
               ++R VE
Sbjct  2054  LRQRRQVE  2061


 Score = 51.8 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 62/312 (20%), Positives = 130/312 (42%), Gaps = 32/312 (10%)

Query  73    RERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK-------RQKEQALREV  125
             ++  E+ L  +A   +E   L  + +E       L  E   LK       RQ+ Q   E+
Sbjct  2308  KKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEEL  2367

Query  126   EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL--EAATKECQALEGRAR---AASEQ  180
               ++   +++++ KA ++A+  +L+   +++  R   E A K  Q  E  AR   AA E 
Sbjct  2368  FSVRVQMEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEA  2427

Query  181   ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             AR  +   E L QQ ++    L+ + Q+V+ A R+ +  A   +++    Q    +L ++
Sbjct  2428  ARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL-KAEAELLQQQKELAQEQARRLQED  2486

Query  241   YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
              +   +     ++  +     + ++QL+ + EA   K   + ++     + +   +    
Sbjct  2487  KEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAERLK-LRVAEMSRAQARAEEDAQR---  2542

Query  301   LKAQADIYKADFQAERQA--------------REKLAEKKELLQEQLEQLQREYSKLKAS  346
              + QA+           A              R++     E L+E + +L+RE  KL+  
Sbjct  2543  FRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQQE  2602

Query  347   CQESA-RIEDMR  357
              +    + E+M+
Sbjct  2603  AKLLQLKSEEMQ  2614


 Score = 41.7 bits (96),  Expect = 0.016, Method: Composition-based stats.
 Identities = 56/354 (16%), Positives = 142/354 (40%), Gaps = 6/354 (2%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
               +G  + L+   EE +  +   ++  + LR + ++    +     E    +    EA +
Sbjct  1607  GAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAR  1666

Query  103   LVERLGLEKLDLKRQKEQALR-----EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
               +R      +L+ Q E+A R     EVE  ++ Q  +   + S +A++ S      E  
Sbjct  1667  EKQRALQALEELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKT  1726

Query  158   SRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMER  217
             ++LE + +E      + R  +E+  Q ++E E  +++   ++++ +++       LR++ 
Sbjct  1727  AQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANE-ALRLRLQA  1785

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             +  +++K           +  +        +   + R+R +  ++L++Q Q AE     +
Sbjct  1786  EEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQR  1845

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
                  +L     + +   +   +L+ +    + +  A  Q R++L  +   ++ ++E L 
Sbjct  1846  LAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQELEAELAKVRAEMEVLL  1905

Query  338   REYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                ++ +   + ++     R          L    A L +      ++R   EE
Sbjct  1906  ASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEE  1959


 Score = 40.6 bits (93),  Expect = 0.032, Method: Composition-based stats.
 Identities = 46/316 (15%), Positives = 119/316 (38%), Gaps = 11/316 (3%)

Query  50    TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
             T     +E +  ++   +  Q   ER  E+  ++    +  E       +       L  
Sbjct  1282  TFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLAQTDVRQRELEQ  1341

Query  110   EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
                 L+  +E A      L+  +++  + +A   A   ++  +L++ Q+ LE   +  + 
Sbjct  1342  LGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGEK  1401

Query  170   LEGRARAASEQARQLESEREAL----QQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
             +E   R A +    ++     L     Q   V     + + QS   ++  E         
Sbjct  1402  VEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTHYS  1461

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             +L  L   Y +   E    ++     +E++R     + +++L + E AL  ++++ +   
Sbjct  1462  ELTTLTSQYIKFISETLRRMEEEERLAEQQRA----EERERLAEVEAALEKQRQLAEAHA  1517

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREK--LAEKKELLQEQLEQLQREYSKL  343
             +   Q +   + +   + Q ++ + +  A    ++K  + E+ + L++  E   +  ++ 
Sbjct  1518  QAKAQAEREAKELQ-QRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQ  1576

Query  344   KASCQESARIEDMRKR  359
               + + S    +   R
Sbjct  1577  AEAAERSRLRIEEEIR  1592


 Score = 38.7 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 90/228 (39%), Gaps = 12/228 (5%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q A    Q   +  +E ++  ++  + +  R E  +  Q  +R  +E L    Q +   +
Sbjct  1511  QLAEAHAQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEI  1570

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             +    +    +R + +   E+  ++   +     +   + ++ +L    +E++++   A 
Sbjct  1571  QAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAEEAEAQKRQAQ  1630

Query  165   KECQALEGRARAASEQARQ----------LESEREALQQQHSVQVDQLRMQGQSVEAALR  214
             +E + L  + +  S++ RQ           E+E    +Q+    +++LR+Q +  EA  R
Sbjct  1631  EEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQALEELRLQAE--EAERR  1688

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
             + +      ++    L+ A      E  +   S    + +      E+
Sbjct  1689  LRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERSLQEE  1736


 Score = 37.9 bits (86),  Expect = 0.24, Method: Composition-based stats.
 Identities = 51/261 (20%), Positives = 107/261 (41%), Gaps = 23/261 (9%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E +++  EE   L  A +++ ++ +   E+L    A QR   E ++ +  +A +  
Sbjct  2404  QEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDL----AQQRALAEKMLKEKMQAVQEA  2459

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA--------------SVKAQVTSLL  150
              RL  E   L++QKE A  +   L+  ++QMA+  A                + ++++  
Sbjct  2460  TRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEA  2519

Query  151   GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
               L+   + +  A    +    R R  +E+  +     E   Q+    V  L +Q Q  +
Sbjct  2520  ERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSD  2579

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL----KQQ  266
                   R+A +E +R+  +LQ    +L Q     +++       +    L+      K  
Sbjct  2580  HDAERLREAIAELEREKEKLQQE-AKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDS  2638

Query  267   LQQAEEALVAKQEVIDKLKEE  287
             L Q E  +  ++  +++L ++
Sbjct  2639  LLQRERFIEQEKAKLEQLFQD  2659


 Score = 35.2 bits (79),  Expect = 1.4, Method: Composition-based stats.
 Identities = 43/243 (18%), Positives = 105/243 (43%), Gaps = 9/243 (4%)

Query  49    ETLQRCLEENQELRDAIRQ-SNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E LQ+  E  QE    +++   Q+ ++  EE   FQ +   E+     +  E     ERL
Sbjct  2467  ELLQQQKELAQEQARRLQEDKEQMAQQLAEETQGFQRTLEAER----QRQLEMSAEAERL  2522

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              L   ++ R + +A  + +  ++  +++ E     +      +  +Q  + + + +  + 
Sbjct  2523  KLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDA  2582

Query  168   QALEGRARAASEQARQLESEREALQ----QQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             + L         +  +L+ E + LQ    +  +VQ +QL  + Q+++ +   E+ +  + 
Sbjct  2583  ERLREAIAELEREKEKLQQEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQR  2642

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             +R + Q +    QLFQ+     +      +R++    ++ ++ +   EEA   + E  + 
Sbjct  2643  ERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAEEG  2702

Query  284   LKE  286
             ++ 
Sbjct  2703  VRR  2705


 Score = 34.8 bits (78),  Expect = 2.1, Method: Composition-based stats.
 Identities = 52/326 (16%), Positives = 128/326 (39%), Gaps = 18/326 (6%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
             A QR+       + +EA + V++    + +  RQ++ AL EVE LK   ++    +   +
Sbjct  2107  ARQRQLAAEEERRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAE  2166

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQ--------QQH  195
              +    L   QE+  +   A ++  A   + +    Q    + +    Q        ++ 
Sbjct  2167  QESARQLQLAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDQLRGEAEAARRA  2226

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE--  253
             + + ++ R+Q +   A  R + + A   K+   +   A  Q     +   K +   +   
Sbjct  2227  AEEAEEARVQAEREAAQSRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARR  2286

Query  254   --------RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
                     R++     ++++  + AE+ L  K +V  +L     Q +       +L  + 
Sbjct  2287  AQAEQAALRQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEEL  2346

Query  306   DIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQ  365
                KA+     + R ++ E+   ++ Q+E+L +  ++++A  +     +    +     +
Sbjct  2347  QRLKAEATEAARQRSQVEEELFSVRVQMEELSKLKARIEAENRALILRDKDNTQRFLQEE  2406

Query  366   APLPPAPAYLSSPLALPSQRRSPPEE  391
             A      A  ++ L++ +Q  +   +
Sbjct  2407  AEKMKQVAEEAARLSVAAQEAARLRQ  2432


 Score = 34.0 bits (76),  Expect = 3.2, Method: Composition-based stats.
 Identities = 66/377 (18%), Positives = 136/377 (36%), Gaps = 30/377 (8%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   L +   QGA E L+      ++L++A  Q+        E         R + E   
Sbjct  1226  KTISLVIRGTQGAEEVLR---AHEEQLKEA--QAVPATLPELEATKASLKKLRAQAEAQQ  1280

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
               F   R  +         L+++  +   EVE  +    Q+ E   +V AQ      EL+
Sbjct  1281  PTFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLAQTDVRQRELE  1340

Query  155   E----------SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRM  204
             +          S   L A  ++ +  + + +A      Q   E+   +Q    ++++   
Sbjct  1341  QLGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGE  1400

Query  205   QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
             + +  +   +    A  + + +L   +     +          S   S  +  + L    
Sbjct  1401  KVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTHY  1460

Query  265   QQLQQ---------AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
              +L           +E     ++E     ++ AE+ + + E    L+ Q  + +A  QA+
Sbjct  1461  SELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAK  1520

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
              QA  +  E ++ +QE  E ++RE + + A  Q+ +  E+++    ++ Q+      A  
Sbjct  1521  AQAEREAKELQQRMQE--EVVRREEAAVDAQQQKRSIQEELQ----QLRQSSEAEIQAKA  1574

Query  376   SSPLALPSQRRSPPEEP  392
                 A    R    EE 
Sbjct  1575  RQAEAAERSRLRIEEEI  1591


 Score = 33.7 bits (75),  Expect = 4.7, Method: Composition-based stats.
 Identities = 52/260 (20%), Positives = 102/260 (39%), Gaps = 17/260 (7%)

Query  57    ENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKR  116
             EN+ LR  + +     R R EE      +  EE+  L    + +   +ER      D  R
Sbjct  1999  ENERLRR-LAEDEAFQRRRLEEQAAQHKADIEER--LAQLRKASDSELERQKGLVEDTLR  2055

Query  117   QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE---CQALEGR  173
             Q+ Q   E+  LK   ++ A  KA ++ ++  +    +++    E A  E    + L   
Sbjct  2056  QRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKEQAELEAARQRQLAAE  2115

Query  174   ARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAAL----RMERQAASEEKRKLAQ  229
                   +A +   +  A +++ + Q      + + ++A +    R+  +A  E  R+L  
Sbjct  2116  EERRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQL  2175

Query  230   LQVAYHQLFQEYDNHIKSSVVGSERKRGM-------QLEDLKQQLQQAEEALVAKQEVID  282
              Q A  +  Q  +     +V   E++           L+ L+ + + A  A    +E   
Sbjct  2176  AQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDQLRGEAEAARRAAEEAEEARV  2235

Query  283   KLKEEAEQHKIVMETVPVLK  302
             + + EA Q +  +E    LK
Sbjct  2236  QAEREAAQSRRQVEEAERLK  2255


>sp|A0A287B8J2|DCTN1_PIG Dynactin subunit 1 OS=Sus scrofa OX=9823 
GN=DCTN1 PE=1 SV=2
Length=1281

 Score = 60.6 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 65/342 (19%), Positives = 152/342 (44%), Gaps = 11/342 (3%)

Query  62   RDAIRQSNQILRERCEELLHFQASQREEKEFLMC---KFQEARKLVERLGLEKLDLKRQK  118
             + +R   + L E+ E L   +A  + + + L     + ++ ++   ++  ++ DL+R+ 
Sbjct  217  EEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRL  276

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
            ++A +E +     +++  E+ A     +     + + ++ R E+  +E +AL+ R    +
Sbjct  277  KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELT  336

Query  179  EQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
                 L+    E+ +     S Q+ QL  Q   ++ AL   R  +S EK++  +LQ    
Sbjct  337  TDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLME  396

Query  236  QLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKI  293
            +  QE +   +      E     +  +++LK+Q+  A  A    + + D+     E+ + 
Sbjct  397  KKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRE  456

Query  294  VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
            + ETV  L+A  ++   + + +  ARE   E +E L     +++    +++A+ +  A  
Sbjct  457  LRETVGDLEAMNEM---NDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADY  513

Query  354  EDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
            +   K++ +++           +   A   +++ PP E  DF
Sbjct  514  QQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 72/356 (20%), Positives = 151/356 (42%), Gaps = 32/356 (9%)

Query  41   LPSEQGAPETLQRCLEENQELRDAIR----QSNQILRE------RCEELLHFQASQREEK  90
            LPS     E L+  + + +E  + +R    +    L+E      + E++  +++  +E++
Sbjct  210  LPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQ  269

Query  91   EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
              L  + +EARK  +     K     +       +E     ++   E   S++ +V +L 
Sbjct  270  ADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALK  329

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD----------  200
              + E  + LE    E +       A+S Q +QLE +   L+       D          
Sbjct  330  ERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHV  389

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI-KSSVVGSERKRGMQ  259
            +L+   +     L + RQ     + +L+Q +    +L ++ D  +    +V     R + 
Sbjct  390  KLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN  449

Query  260  LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAR  319
            LE+  ++L++    L A  E+ D+L+E A + ++       L+ Q D+  A     R+A+
Sbjct  450  LEEKVRELRETVGDLEAMNEMNDELQENARETELE------LREQLDMAGARV---REAQ  500

Query  320  EKLAEKKELLQEQLEQLQREYSKLKASCQESAR-IEDMRKRHVEVSQAPLPPAPAY  374
            +++   +E +    +Q  ++Y +L A  Q+  R + + ++  VE  Q P P    +
Sbjct  501  KRVEAAQETVA-DYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


>sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 
GN=DCTN1 PE=1 SV=3
Length=1278

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 65/342 (19%), Positives = 152/342 (44%), Gaps = 11/342 (3%)

Query  62   RDAIRQSNQILRERCEELLHFQASQREEKEFLMC---KFQEARKLVERLGLEKLDLKRQK  118
             + +R   + L E+ E L   +A  + + + L     + ++ ++   ++  ++ DL+R+ 
Sbjct  217  EEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRL  276

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
            ++A +E +     +++  E+ A     +     + + ++ R E+  +E +AL+ R    +
Sbjct  277  KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELT  336

Query  179  EQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
                 L+    E+ +     S Q+ QL  Q   ++ AL   R  +S EK++  +LQ    
Sbjct  337  TDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLME  396

Query  236  QLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKI  293
            +  QE +   +      E     +  +++LK+Q+  A  A    + + D+     E+ + 
Sbjct  397  KKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRE  456

Query  294  VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
            + ETV  L+A  ++   + + +  ARE   E +E L     +++    +++A+ +  A  
Sbjct  457  LRETVGDLEAMNEM---NDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADY  513

Query  354  EDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
            +   K++ +++           +   A   +++ PP E  DF
Sbjct  514  QQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 72/356 (20%), Positives = 151/356 (42%), Gaps = 32/356 (9%)

Query  41   LPSEQGAPETLQRCLEENQELRDAIR----QSNQILRE------RCEELLHFQASQREEK  90
            LPS     E L+  + + +E  + +R    +    L+E      + E++  +++  +E++
Sbjct  210  LPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQ  269

Query  91   EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
              L  + +EARK  +     K     +       +E     ++   E   S++ +V +L 
Sbjct  270  ADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALK  329

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD----------  200
              + E  + LE    E +       A+S Q +QLE +   L+       D          
Sbjct  330  ERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHV  389

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI-KSSVVGSERKRGMQ  259
            +L+   +     L + RQ     + +L+Q +    +L ++ D  +    +V     R + 
Sbjct  390  KLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN  449

Query  260  LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAR  319
            LE+  ++L++    L A  E+ D+L+E A + ++       L+ Q D+  A     R+A+
Sbjct  450  LEEKVRELRETVGDLEAMNEMNDELQENARETELE------LREQLDMAGARV---REAQ  500

Query  320  EKLAEKKELLQEQLEQLQREYSKLKASCQESAR-IEDMRKRHVEVSQAPLPPAPAY  374
            +++   +E +    +Q  ++Y +L A  Q+  R + + ++  VE  Q P P    +
Sbjct  501  KRVEAAQETVA-DYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


>sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 
1 OS=Gallus gallus OX=9031 GN=CLIP1 PE=2 SV=1
Length=1433

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 53/329 (16%), Positives = 133/329 (40%), Gaps = 21/329 (6%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L++ L    +++D++ +  Q+L+E+    +    + +   +  + K  +  +    +  E
Sbjct  819   LEKNLSAVNQVKDSLEKELQLLKEKFTSAVDGAENAQRAMQETINKLNQKEEQFALMSSE  878

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                LK        +++  +  +QQ+ E K  ++  +  ++    +S ++L     E +  
Sbjct  879   LEQLKSNLTVMETKLKEREEREQQLTEAKVKLENDIAEIMKSSGDSSAQLMKMNDELRLK  938

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQ----GQSVEAALRMERQAASEEKRK  226
             E +      +  +   +   LQ+       +         ++ +  L+  +   ++ K++
Sbjct  939   ERQLEQIQLELTKANEKAVQLQKNVEQTAQKAEQSQQETLKTHQEELKKMQDQLTDMKKQ  998

Query  227   LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             +   Q  Y  L  +Y+      +   +      ++  KQ L  AEEAL A Q+  D+L+ 
Sbjct  999   METSQNQYKDLQAKYEKETSEMITKHD----ADIKGFKQNLLDAEEALKAAQKKNDELET  1054

Query  287   EAE-------------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQL  333
             +AE             + + V++T+  +  + D    +      + E   +  E LQ +L
Sbjct  1055  QAEELKKQAEQAKADKRAEEVLQTMEKVTKEKDAIHQEKIETLASLENSRQTNEKLQNEL  1114

Query  334   EQLQREYSKLKASCQESARIEDMRKRHVE  362
             + L++   K +    +S  + ++  + VE
Sbjct  1115  DMLKQNNLKNEEELTKSKELLNLENKKVE  1143


 Score = 38.3 bits (87),  Expect = 0.16, Method: Composition-based stats.
 Identities = 64/373 (17%), Positives = 137/373 (37%), Gaps = 25/373 (7%)

Query  60   ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER-LGLEKLDLKRQK  118
            +L  AI    Q + E          +Q  E   L  + ++ +   E  +   KL  + +K
Sbjct  616  KLESAIASHQQAMEELKVSFNKGVGAQTAEFAELKTQMEKVKLDYENEMSNLKLKQENEK  675

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLG--------ELQESQSRLEAAT---KEC  167
             Q L+E+E LK    ++ E+K      + + L         E++++ ++L+ A    KE 
Sbjct  676  SQHLKEIEALKAKLLEVTEEKEQTLENLKAKLESVEDQHLVEMEDTLNKLQEAEIKVKEL  735

Query  168  QALEGRARAASEQARQLESEREALQQQH-------------SVQVDQLRMQGQSVEAALR  214
              L+ +    ++    L  +  A +++               +++ +L  Q Q+ E  ++
Sbjct  736  DVLQAKCNEQTKLIGSLTQQIRASEEKLLDLAALQKANSEGKLEIQKLSEQLQAAEKQIQ  795

Query  215  MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
                       K  Q +       ++  + +       E++  +  E     +  AE A 
Sbjct  796  NLETEKVSNLTKELQGKEQKLLDLEKNLSAVNQVKDSLEKELQLLKEKFTSAVDGAENAQ  855

Query  275  VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
             A QE I+KL ++ EQ  ++   +  LK+   + +   +   +  ++L E K  L+  + 
Sbjct  856  RAMQETINKLNQKEEQFALMSSELEQLKSNLTVMETKLKEREEREQQLTEAKVKLENDIA  915

Query  335  QLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPD  394
            ++ +      A   +      +++R +E  Q  L  A            Q     E+   
Sbjct  916  EIMKSSGDSSAQLMKMNDELRLKERQLEQIQLELTKANEKAVQLQKNVEQTAQKAEQSQQ  975

Query  395  FCCPKCQYQAPDM  407
                  Q +   M
Sbjct  976  ETLKTHQEELKKM  988


 Score = 33.7 bits (75),  Expect = 4.4, Method: Composition-based stats.
 Identities = 53/329 (16%), Positives = 129/329 (39%), Gaps = 23/329 (7%)

Query  39   LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ  98
            L L  E    + L+       +L +   +  Q L     +L   +     E E  + K Q
Sbjct  667  LKLKQENEKSQHLKEIEALKAKLLEVTEEKEQTLENLKAKLESVEDQHLVEMEDTLNKLQ  726

Query  99   EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            EA   V+ L + +     Q +      + ++  ++++  D A+++   +    E+Q+   
Sbjct  727  EAEIKVKELDVLQAKCNEQTKLIGSLTQQIRASEEKLL-DLAALQKANSEGKLEIQKLSE  785

Query  159  RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME--  216
            +L+AA K+ Q LE    +   +  Q + ++    +++   V+Q++   +     L+ +  
Sbjct  786  QLQAAEKQIQNLETEKVSNLTKELQGKEQKLLDLEKNLSAVNQVKDSLEKELQLLKEKFT  845

Query  217  ---------RQAASEEKRKLAQLQVAYHQLFQEYDN------HIKSSVVGSERKRGMQLE  261
                     ++A  E   KL Q +  +  +  E +        +++ +   E +     E
Sbjct  846  SAVDGAENAQRAMQETINKLNQKEEQFALMSSELEQLKSNLTVMETKLKEREEREQQLTE  905

Query  262  ---DLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV--PVLKAQADIYKADFQAER  316
                L+  + +  ++       + K+ +E    +  +E +   + KA     +     E+
Sbjct  906  AKVKLENDIAEIMKSSGDSSAQLMKMNDELRLKERQLEQIQLELTKANEKAVQLQKNVEQ  965

Query  317  QAREKLAEKKELLQEQLEQLQREYSKLKA  345
             A++    ++E L+   E+L++   +L  
Sbjct  966  TAQKAEQSQQETLKTHQEELKKMQDQLTD  994


>sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 
PE=1 SV=4
Length=1960

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 61/344 (18%), Positives = 135/344 (39%), Gaps = 18/344 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R+       R  E+   Q+    EK  L  + Q   +L       +  L  +K++    
Sbjct  857   VREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEI  916

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                L+   ++  E    ++A+   +   +QE + +LE      Q L+        + ++L
Sbjct  917   CHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKL  976

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E+  L+ Q+     + ++  +   A          E+ + LA+L+  +  +  + +  
Sbjct  977   EEEQIILEDQNCKLAKEKKL-LEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEER  1035

Query  245   IKSSVVGSERKRG-------------MQLEDLKQQLQQAEEALVAKQEVIDK----LKEE  287
             ++      +                  Q+ +L+ Q+ + +  L  K+E +      ++EE
Sbjct  1036  LRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEE  1095

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
             A Q  + ++ +  L++Q    + D ++ER +R K  ++K  L E+LE L+ E      S 
Sbjct  1096  AAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDST  1155

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                  +   R++ V + +  L        + +    Q+ S   E
Sbjct  1156  AAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVE  1199


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 47/284 (17%), Positives = 118/284 (42%), Gaps = 15/284 (5%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF----LMCKFQEARKLVERLGLE  110
             LE+ Q+  D +    + +  +  E      ++  EKE     L    +EA +    L   
Sbjct  1439  LEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERL  1498

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                 + + E  +   + + +   ++ + K +++ QV  +  +L+E +  L+A       L
Sbjct  1499  NKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRL  1558

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             E   +A      Q E + +   +Q   +  QL  Q + +EA L        E++RK   +
Sbjct  1559  EVNLQAMKA---QFERDLQGRDEQSEEKKKQLVRQVREMEAEL--------EDERKQRSM  1607

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              VA  +  +     +++ +  + + R   ++ L++   Q ++ +    +     +E   Q
Sbjct  1608  AVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQ  1667

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
              K   + +  ++A+    + +  A  +A+ +  ++++ L +++ 
Sbjct  1668  AKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIA  1711


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 67/326 (21%), Positives = 134/326 (41%), Gaps = 28/326 (9%)

Query  47    APETLQRCLEENQELRDA---IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             A E   R   + QEL +    +    +   ERC+ L   +   ++  + L  + +E    
Sbjct  899   AEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESA  958

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
              ++L LEK+  + + ++   E   L+    ++A++K  ++ ++      L E + + ++ 
Sbjct  959   RQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSL  1018

Query  164   TKECQALEGRARAASEQARQLESEREALQQ-----------------QHSVQVDQLRMQG  206
              K     E       E+ R+ E +R+ L++                 +   Q+ +L+MQ 
Sbjct  1019  AKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQL  1078

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
                E  L+       EE  +         +  +E ++ I       E +R  + +  KQ+
Sbjct  1079  AKKEEELQAALARVEEEAAQKNMAL----KKIRELESQISELQEDLESERASRNKAEKQK  1134

Query  267   LQQAEEALVAKQEVIDKLKEEAEQHK---IVMETVPVLKAQADIYKADFQAE-RQAREKL  322
                 EE    K E+ D L   A Q +      + V +LK   +      +A+ ++ R+K 
Sbjct  1135  RDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKH  1194

Query  323   AEKKELLQEQLEQLQREYSKLKASCQ  348
             ++  E L EQLEQ +R  + L+ + Q
Sbjct  1195  SQAVEELAEQLEQTKRVKANLEKAKQ  1220


 Score = 44.8 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 131/316 (41%), Gaps = 21/316 (7%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +T ++   ++ +L D I +    L+ +  EL    A + EE +  + + +E     
Sbjct  1044  QELEKTRRKLEGDSTDLSDQIAE----LQAQIAELKMQLAKKEEELQAALARVEEEAAQK  1099

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
                  +  +L+ Q  +   ++E  +  + +  + K  +  ++ +L  EL+++     A  
Sbjct  1100  NMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQ  1159

Query  165   KECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             +     E       +   E+A+  E++ + ++Q+HS  V++L  Q +  +       +A 
Sbjct  1160  ELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAK  1219

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                + +  +L      L Q   +          +K   QL++L+ +  + E         
Sbjct  1220  QTLENERGELANEVKVLLQGKGDS-----EHKRKKVEAQLQELQVKFNEGERVRT-----  1269

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE-KLAEKKELLQEQLEQLQRE  339
               +L ++  + ++ ++ V  L +Q+D   +    +  A E +L + +ELLQE+  Q    
Sbjct  1270  --ELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSL  1327

Query  340   YSKLKASCQESARIED  355
              +KLK    E     +
Sbjct  1328  STKLKQVEDEKNSFRE  1343


 Score = 41.7 bits (96),  Expect = 0.012, Method: Composition-based stats.
 Identities = 56/346 (16%), Positives = 131/346 (38%), Gaps = 26/346 (8%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF------LMCK  96
             + +   E +++  +   +++D +R+ +     R E L   + ++++ K        L  +
Sbjct  1629  ANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEE  1688

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
                A +   +   E+ +L  +   +  +       ++++    A ++ ++    G  +  
Sbjct  1689  LAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELI  1748

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               RL+ A  +   +          A++ E+ R    QQ   Q  +L+++ Q +E  ++ +
Sbjct  1749  NDRLKKANLQIDQINTDLNLERSHAQKNENAR----QQLERQNKELKVKLQEMEGTVKSK  1804

Query  217   RQAA-SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
              +A+ +  + K+AQL+       +E     K  V  +E+K    L  +  + + AE+   
Sbjct  1805  YKASITALEAKIAQLEEQLDNETKERQAACKQ-VRRTEKKLKDVLLQVDDERRNAEQYKD  1863

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
                +   +LK+              LK Q +  + + Q    +R KL  + E   E  + 
Sbjct  1864  QADKASTRLKQ--------------LKRQLEEAEEEAQRANASRRKLQRELEDATETADA  1909

Query  336   LQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             + RE S LK   +       + +R                 +  A 
Sbjct  1910  MNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAE  1955


 Score = 41.4 bits (95),  Expect = 0.018, Method: Composition-based stats.
 Identities = 49/300 (16%), Positives = 122/300 (41%), Gaps = 20/300 (7%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
               + + + + + E ++ + A+ Q  + ++ + EEL     +  + K  L    Q  +   
Sbjct  1510  MSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQF  1569

Query  105   ERL--------GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             ER           +K  L RQ  +   E+E  ++ +      +  ++  +  L   +  +
Sbjct  1570  ERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSA  1629

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 + A K+ + L+ + +    +     + RE +  Q      +L+    S+EA +   
Sbjct  1630  NKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLK----SMEAEMIQL  1685

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++  +  +R   Q Q    +L  E  N      +  E KR      L+ ++ Q EE L  
Sbjct  1686  QEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRR-----LEARIAQLEEELEE  1740

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             +Q   + + +  ++  + ++ +       ++ ++  Q    AR++L  + + L+ +L+++
Sbjct  1741  EQGNTELINDRLKKANLQIDQI---NTDLNLERSHAQKNENARQQLERQNKELKVKLQEM  1797


 Score = 39.8 bits (91),  Expect = 0.058, Method: Composition-based stats.
 Identities = 54/281 (19%), Positives = 117/281 (42%), Gaps = 16/281 (6%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             + QS+    +  ++    ++  ++ +E L  + ++   L  +L   + +    +EQ   E
Sbjct  1289  LSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEE  1348

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                 +  +  + +  A++ AQV  +  ++++S   LE A +  + L+       E   Q 
Sbjct  1349  ----EEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDL----EGLSQR  1400

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
               E+ A   +      +L+ +   +   L  +RQ+A   ++K    Q  + QL  E    
Sbjct  1401  HEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKK----QKKFDQLLAEEKTI  1456

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQ  304
                     +R      E   + L  A  AL    E   +L+   +Q +  ME +  + ++
Sbjct  1457  SAKYAEERDRAEAEAREKETKALSLA-RALEEAMEQKAELERLNKQFRTEMEDL--MSSK  1513

Query  305   ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
              D+ K+  + E+  R  L ++ E ++ QLE+L+ E    + 
Sbjct  1514  DDVGKSVHELEKSKR-ALEQQVEEMKTQLEELEDELQATED  1553


 Score = 39.4 bits (90),  Expect = 0.081, Method: Composition-based stats.
 Identities = 49/303 (16%), Positives = 118/303 (39%), Gaps = 19/303 (6%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L+  L++ QEL     +    L  + +++        +EK     + +E  +    L  +
Sbjct  1306  LESQLQDTQELLQEENRQKLSLSTKLKQV-------EDEKNSFREQLEEEEEAKHNLEKQ  1358

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                L  Q     +++E    C +   E K  ++  +  L    +E  +  +   K    L
Sbjct  1359  IATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRL  1418

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             +                   L+++   + DQL  + +++ A    ER  A  E R+    
Sbjct  1419  QQELDDLLVDLDHQRQSACNLEKKQ-KKFDQLLAEEKTISAKYAEERDRAEAEAREKETK  1477

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ------LQQAEEALVAKQEVIDKL  284
              ++  +  +E           +++ R    + +  +      + + E++  A ++ ++++
Sbjct  1478  ALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEM  1537

Query  285   KEEAEQHKIVMETVPVLKAQADI----YKADFQAERQAR-EKLAEKKELLQEQLEQLQRE  339
             K + E+ +  ++     K + ++     KA F+ + Q R E+  EKK+ L  Q+ +++ E
Sbjct  1538  KTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAE  1597

Query  340   YSK  342
                
Sbjct  1598  LED  1600


 Score = 37.1 bits (84),  Expect = 0.41, Method: Composition-based stats.
 Identities = 42/265 (16%), Positives = 101/265 (38%), Gaps = 3/265 (1%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K  M  L   + + E +    +EN++   ++      L+E        +   ++E++ L 
Sbjct  1648  KDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELA  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +   +         EK  L+ +  Q   E+E  +   + + +       Q+  +  +L 
Sbjct  1708  DEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLN  1767

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD-QLRMQGQSVEAAL  213
               +S  +      Q LE + +    + +++E   ++  +     ++ ++    + ++   
Sbjct  1768  LERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNET  1827

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA  273
             +  + A  + +R   +L+    Q+  E  N           K   +L+ LK+QL++AEE 
Sbjct  1828  KERQAACKQVRRTEKKLKDVLLQVDDERRNA--EQYKDQADKASTRLKQLKRQLEEAEEE  1885

Query  274   LVAKQEVIDKLKEEAEQHKIVMETV  298
                      KL+ E E      + +
Sbjct  1886  AQRANASRRKLQRELEDATETADAM  1910


>sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 
PE=1 SV=2
Length=1976

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 130/345 (38%), Gaps = 20/345 (6%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +++    +    EE+        EEK  L  + Q   +L       +  L  +K++    
Sbjct  864   VKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEI  923

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
             +  L+   ++  E    ++ +   +   +Q+ + +L+      Q L+     A  + +++
Sbjct  924   LHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKM  983

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E   L+ Q+S  + + ++  +   A    +     E+ + LA+++     +  + +  
Sbjct  984   EEEVLLLEDQNSKFIKEKKL-MEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEER  1042

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV----  300
             +K      +     +   L  +    ++ +   Q  +D+LK +  + +  ++        
Sbjct  1043  LKKEEKTRQELEKAK-RKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDD  1101

Query  301   --------------LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                           L+AQ    + DF++E+ +R K  ++K  L E+LE L+ E      +
Sbjct  1102  ETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDT  1161

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   +   R++ V   +  L        + +    QR +   E
Sbjct  1162  TAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALE  1206


 Score = 46.8 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/319 (18%), Positives = 126/319 (39%), Gaps = 36/319 (11%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
             L+  +++   + +  +   +   E     A   EE++    + +E       L     + 
Sbjct  1436  LDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEA  1495

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
                KE+  R+ + L+   + +   K  V   V  L    +  + ++E    + + LE   
Sbjct  1496  LEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDEL  1555

Query  175   RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
             +A  +   +LE   +A++ Q    +     Q +               EK++L   QV  
Sbjct  1556  QATEDAKLRLEVNMQAMKAQFERDLQTRDEQNE---------------EKKRLLLKQVRE  1600

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
              +   E +   ++  V S++K  + L+DL+ Q++ A +A                    V
Sbjct  1601  LEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKA-----------------RDEV  1643

Query  295   METVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIE  354
             ++ +  L+AQ   Y+ + +  R +R+++  + +  +++L+ L+ E  +L+     S R  
Sbjct  1644  IKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSER--  1701

Query  355   DMRKRHVEVSQAPLPPAPA  373
                +RH E  +  L    A
Sbjct  1702  --ARRHAEQERDELADEIA  1718


 Score = 39.8 bits (91),  Expect = 0.058, Method: Composition-based stats.
 Identities = 58/300 (19%), Positives = 116/300 (39%), Gaps = 12/300 (4%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q     + R E +   +  Q + K++   + +EAR   + +  +  + +++ +
Sbjct  1625  DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDY-QRELEEARASRDEIFAQSKESEKKLK  1683

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                 E+  L+         +   + +   L  E+  S S   A   E + LE R     E
Sbjct  1684  SLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEE  1743

Query  180   QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL--  237
             +  + +S  E L  +         +Q  ++   L  ER AA +      QL+    +L  
Sbjct  1744  ELEEEQSNMELLNDRFRKTT----LQVDTLNTELAAERSAAQKSDNARQQLERQNKELKA  1799

Query  238   -FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI----DKLKEEAEQHK  292
               QE +  +KS    +      ++  L++QL+Q  +   A  +++     KLKE   Q +
Sbjct  1800  KLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVE  1859

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                      K Q +   A  +  ++  E+  E+         +LQRE      + +  +R
Sbjct  1860  DERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSR  1919


 Score = 38.7 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 53/328 (16%), Positives = 116/328 (35%), Gaps = 19/328 (6%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQ----REEKEFLMCKFQEARKLVERLGLEKLDL  114
             QELR    Q    L++  E+      +Q    R+     + +  E  +  +R        
Sbjct  1166  QELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKN  1225

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             K+  E   +E+    +  QQ+   KA  + +   L  ++QE  +++    +    L  +A
Sbjct  1226  KQGLETDNKELACEVKVLQQV---KAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKA  1282

Query  175   RAASEQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                  +      L  E E    + +     L  Q Q  +  L+ E +       ++ QL+
Sbjct  1283  NKLQNELDNVSTLLEEAEKKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLE  1342

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQ---------LEDLKQQLQQAEEALVAKQEVID  282
                + L ++ +   ++     ++   +Q         ++D    ++  EEA     + ++
Sbjct  1343  EEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVE  1402

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
              L +  E+  +  + +   K +      D   +   + ++    E  Q++ +QL  E   
Sbjct  1403  ALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKG  1462

Query  343   LKASCQESARIEDMRKRHVEVSQAPLPP  370
             + A   E     +   R  E     L  
Sbjct  1463  ISARYAEERDRAEAEAREKETKALSLAR  1490


 Score = 38.7 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 51/308 (17%), Positives = 128/308 (42%), Gaps = 14/308 (5%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVE----RLGLEK  111
             ++ ++L + +    + L+   E+ L   A+Q+E +     +  E +K +E        + 
Sbjct  1139  KQKRDLSEEL----EALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQI  1194

Query  112   LDLKRQKEQALRE----VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              D++++   AL E    +E  KR +  + ++K  ++     L  E++  Q     +  + 
Sbjct  1195  QDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR  1254

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             + L+ + +    +  + +  R  L ++ +   ++L      +E A +   + A +     
Sbjct  1255  KKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFAKDAAGLE  1314

Query  228   AQLQVAYHQLFQEYDNHIK-SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI-DKLK  285
             +QLQ     L +E    +  SS +    +    L++ +++ ++A + L  +   +  +L 
Sbjct  1315  SQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLA  1374

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             +  ++    + T+  L+        D +A  Q  E+     + L++   +LQ+E   L  
Sbjct  1375  DTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTV  1434

Query  346   SCQESARI  353
                   +I
Sbjct  1435  DLDHQRQI  1442


 Score = 37.5 bits (85),  Expect = 0.27, Method: Composition-based stats.
 Identities = 49/315 (16%), Positives = 129/315 (41%), Gaps = 11/315 (3%)

Query  66    RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREV  125
              +  ++L ++  EL      +R+++   +   ++    ++ L  +     + +++ ++++
Sbjct  1588  EEKKRLLLKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQL  1647

Query  126   EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
               L+   +    +    +A    +  + +ES+ +L++   E   L+    ++    R  E
Sbjct  1648  RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAE  1707

Query  186   SEREALQQQHSVQVD---QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
              ER+ L  + +        L  + + +EA +    +   EE+  +  L   + +   + D
Sbjct  1708  QERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVD  1767

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                 ++ + +ER    + ++ +QQL++  + L AK + ++   +   + K  +  +    
Sbjct  1768  TL--NTELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVK--SKFKATISALEAKI  1823

Query  303   AQADIYKADFQAERQAREKLAEKKE----LLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              Q +        ER A  KL  + E     +  Q+E  +R   + K   +++       K
Sbjct  1824  GQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLK  1883

Query  359   RHVEVSQAPLPPAPA  373
             R +E ++     A A
Sbjct  1884  RQLEEAEEEATRANA  1898


 Score = 35.6 bits (80),  Expect = 1.1, Method: Composition-based stats.
 Identities = 48/310 (15%), Positives = 126/310 (41%), Gaps = 27/310 (9%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             EL+  + +    L ++ EEL    A   +E        + AR+L  ++   + D + +K 
Sbjct  1073  ELQAQVDELKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKA  1132

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
                +  +  +   +++   K  ++  + +   + +    R +   +  +ALE   +    
Sbjct  1133  SRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEA  1192

Query  180   QARQLESEREALQQQHSVQVDQ--------------LRMQGQSVEAALRMERQAASEEKR  225
             Q + +        ++ S Q++Q              L    + +   +++ +Q  +E + 
Sbjct  1193  QIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEH  1252

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEE----------A  273
             K  +L     +L  +     +  V  +E+   +Q  L+++   L++AE+           
Sbjct  1253  KRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFAKDAAG  1312

Query  274   LVAKQEVIDKLKEEAEQHKIVMET-VPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
             L ++ +   +L +E  + K+ + + +  L+ + +  +   + E +AR+ L ++   LQ Q
Sbjct  1313  LESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQ  1372

Query  333   LEQLQREYSK  342
             L   +++   
Sbjct  1373  LADTKKKVDD  1382


 Score = 34.8 bits (78),  Expect = 2.0, Method: Composition-based stats.
 Identities = 57/339 (17%), Positives = 135/339 (40%), Gaps = 17/339 (5%)

Query  70    QILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLK  129
             ++L++   E  H +     + + L  K  E  +L   L  +   L+ + +     +E  +
Sbjct  1241  KVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAE  1300

Query  130   RCQQQMAEDKASVKAQVTSLLGELQESQ-------SRLEAATKECQALEGRARAASEQAR  182
             +   + A+D A +++Q+      LQE         SR+    +E  +L+ +     E  +
Sbjct  1301  KKGIKFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARK  1360

Query  183   QLESEREALQQQHSVQVDQ----------LRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              LE +  ALQ Q +    +          L    + +   +    Q   E+     +L+ 
Sbjct  1361  NLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEALSQRLEEKVLAYDKLEK  1420

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK  292
               ++L QE D+         +    ++ +  K     AEE  ++ +   ++ + EAE  +
Sbjct  1421  TKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEARE  1480

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                + + + +A  +  +A  + ERQ ++  A+ ++L+  + +  +  +   K+      +
Sbjct  1481  KETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQ  1540

Query  353   IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
             +E+MR +  E+         A L   + + + +     +
Sbjct  1541  VEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERD  1579


 Score = 34.8 bits (78),  Expect = 2.0, Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (1%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +  QR LEE +  RD I   ++   ++ + L       +EE        + A +  
Sbjct  1651  QAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQER  1710

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             + L  E  +    K   L E   L+    Q+ E+    ++ +  L    +++  +++   
Sbjct  1711  DELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLN  1770

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              E  A    A+ +    +QLE + + L+ +       ++ + ++  +AL  +     E+ 
Sbjct  1771  TELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQL  1830

Query  225   RKLAQLQVAYHQLFQEYDNHIKS--SVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
              + A+ + A ++L +  +  +K     V  ER+   Q ++  ++     + L  +
Sbjct  1831  EQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQ  1885


>sp|O14157|MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=myo3 
PE=1 SV=1
Length=2104

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 55/368 (15%), Positives = 138/368 (38%), Gaps = 34/368 (9%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQREEKE----------FLMCKFQEARKLVERLG  108
             Q+L +  ++   + +   +EL  F+    EE+E           +  +  + R   + L 
Sbjct  1730  QDLEEREKKDQLLFQRYQKELNGFKVQLEEEREKNLRIRQDNRHMHAEIGDIRTKFDELV  1789

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             LEK +L ++      +++ L R     +  + + ++Q+ SL  +LQE +   +   K+  
Sbjct  1790  LEKTNLLKENSILQADLQSLSRVNNSSSTAQQNAQSQLLSLTAQLQEVREANQTLRKDQD  1849

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ--SVEAALRMERQAASEEKRK  226
              L    R    +  ++  +        +   D++ M+ +  ++++ L  +    S    +
Sbjct  1850  TLLRENRNLERKLHEVSEQLNKKFDSSARPFDEIEMEKEVLTLKSNLAQKDDLLSSLVER  1909

Query  227   LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             + Q+++   +  ++ +NH + ++    +   +Q E    +L+  +  L        K   
Sbjct  1910  IKQIEMFALKTQKDSNNHREENLQLHRQLGVLQKEKKDLELKLFDLDLKTYPISTSKDVR  1969

Query  287   EAEQHKIVME----------------------TVPVLKAQADIYKADFQAERQAREKLAE  324
               ++    +E                      T+  L+AQ   +  D +  + +  +L E
Sbjct  1970  MLQKQISDLEASFAASDIERIKGIDECRNRDRTIRQLEAQISKFDDDKKRIQSSVSRLEE  2029

Query  325   KKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQ  384
             +   L+ QLE +Q   ++ K + + +       +  V+  +       + L       S+
Sbjct  2030  RNAQLRNQLEDVQASETQWKFALRRTEHALQEERERVKSLETDFDKYRSLLEGQRVKRSE  2089

Query  385   RRSPPEEP  392
              R      
Sbjct  2090  SRLSMRSN  2097


 Score = 49.1 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 40/238 (17%), Positives = 86/238 (36%), Gaps = 13/238 (5%)

Query  27    LGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQ  86
             +  E  + K  +L L ++       Q    E   L +      +++ ER   L +     
Sbjct  858   VANELTITKERVLQLTNDLQEE---QALAHEKDILVERANSRVEVVHERLSSLENQVTIA  914

Query  87    REEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV  146
              E+ EFL  + Q   + +     E   L        +++  +K+ +Q ++     ++   
Sbjct  915   DEKYEFLYAEKQSIEEDLANKQTEISYLSDLSSTLEKKLSSIKKDEQTISSKYKELEKDY  974

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG  206
              +++ + Q S   L    K         R  +E+  +L+ E    Q+ +  +V +LR + 
Sbjct  975   LNIMADYQHSSQHLSNLEKAINEKNLNIRELNEKLMRLDDELLLKQRSYDTKVQELREEN  1034

Query  207   ----------QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
                       +S  A+L  +      E  K     V + +   EY + +  +    E+
Sbjct  1035  ASLKDQCRTYESQLASLVSKYSETESELNKKEAELVIFQKEITEYRDQLHKAFQNPEK  1092


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 45/256 (18%), Positives = 93/256 (36%), Gaps = 34/256 (13%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             LQ  LE  +E+ + +  + + + +   +L   QA    EK+ L+ +   A   VE +   
Sbjct  848   LQNQLESTKEVANELTITKERVLQLTNDLQEEQA-LAHEKDILVER---ANSRVEVVHER  903

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                L+ Q   A  + E L   +Q + ED A+               Q+ +   +     L
Sbjct  904   LSSLENQVTIADEKYEFLYAEKQSIEEDLAN--------------KQTEISYLSDLSSTL  949

Query  171   EGRARAASEQARQLESEREALQ----------QQHSVQVDQLRMQGQSVEAALRMERQAA  220
             E +  +  +  + + S+ + L+          Q  S  +  L          +R   +  
Sbjct  950   EKKLSSIKKDEQTISSKYKELEKDYLNIMADYQHSSQHLSNLEKAINEKNLNIRELNEKL  1009

Query  221   SEEKRKLAQLQVAYH---QLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEAL  274
                  +L   Q +Y    Q  +E +  +K      E +    +    +   +L + E  L
Sbjct  1010  MRLDDELLLKQRSYDTKVQELREENASLKDQCRTYESQLASLVSKYSETESELNKKEAEL  1069

Query  275   VAKQEVIDKLKEEAEQ  290
             V  Q+ I + +++  +
Sbjct  1070  VIFQKEITEYRDQLHK  1085


 Score = 40.2 bits (92),  Expect = 0.044, Method: Composition-based stats.
 Identities = 44/225 (20%), Positives = 84/225 (37%), Gaps = 42/225 (19%)

Query  54    CLEENQELRDAIRQSNQILRERCEELLH-FQASQRE-----------EKEFLMCKFQEAR  101
              L EN+ L   + + ++ L ++ +     F   + E           +K+ L+    E  
Sbjct  1851  LLRENRNLERKLHEVSEQLNKKFDSSARPFDEIEMEKEVLTLKSNLAQKDDLLSSLVERI  1910

Query  102   KLVE-----------RLGLEKLDLKR-----QKEQALREVEH----LKRCQQQMAEDKAS  141
             K +E               E L L R     QKE+   E++     LK      ++D   
Sbjct  1911  KQIEMFALKTQKDSNNHREENLQLHRQLGVLQKEKKDLELKLFDLDLKTYPISTSKDVRM  1970

Query  142   VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQ---QQHSVQ  198
             ++ Q++ L      S         EC+  +   R    Q  + + +++ +Q    +   +
Sbjct  1971  LQKQISDLEASFAASDIERIKGIDECRNRDRTIRQLEAQISKFDDDKKRIQSSVSRLEER  2030

Query  199   VDQLRMQGQSVEA-------ALRMERQAASEEKRKLAQLQVAYHQ  236
               QLR Q + V+A       ALR    A  EE+ ++  L+  + +
Sbjct  2031  NAQLRNQLEDVQASETQWKFALRRTEHALQEERERVKSLETDFDK  2075


>sp|P02469|LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus 
OX=10090 GN=Lamb1 PE=1 SV=3
Length=1786

 Score = 60.2 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 69/321 (21%), Positives = 122/321 (38%), Gaps = 54/321 (17%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM----CKFQ----  98
                T ++  + N++LR+ I+Q    L E   +L   +A   E  +  M     + Q    
Sbjct  1486  TNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTE  1545

Query  99    EARKLVERLGLEKLDLKRQ---KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQE  155
             + R+ VE L   ++ L++      +A   +E  KR  +  A D       V   L E ++
Sbjct  1546  DIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKS-ATDVKVTADMVKEALEEAEK  1604

Query  156   SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM  215
             +Q   E A K  QA E   +        +ESE  A ++  +    ++           ++
Sbjct  1605  AQVAAEKAIK--QADED-IQGTQNLLTSIESETAASEETLTNASQRIS----------KL  1651

Query  216   ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG-SERKRGMQLEDLKQQLQQAEEAL  274
             ER    E KRK AQ     +    EY   +  SV   ++  +     +L ++ ++ E  +
Sbjct  1652  ERN-VEELKRKAAQ-----NSGEAEYIEKVVYSVKQNADDVKKTLDGELDEKYKKVESLI  1705

Query  275   VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
               K E     +    + +++      L AQA+                   K  L E LE
Sbjct  1706  AQKTEESADARR---KAELLQNEAKTLLAQAN------------------SKLQLLEDLE  1744

Query  335   QLQREYSK-LKASCQESARIE  354
             +   +  K L+   QE  R+E
Sbjct  1745  RKYEDNQKYLEDKAQELVRLE  1765


>sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus OX=10090 GN=Myh14 
PE=1 SV=1
Length=2000

 Score = 60.2 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 70/357 (20%), Positives = 140/357 (39%), Gaps = 22/357 (6%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E LQ   +E Q++++  +QS + + E    L    A   EE+  L  + +   +L     
Sbjct  873   EVLQARAQELQKVQELQQQSAREVGE----LQGRVAQLEEERTRLAEQLRAEAELCSEAE  928

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
               +  L  +K++    V  L+    +  E    ++++   L   +QE +S LEA     Q
Sbjct  929   ETRARLAARKQELELVVTELEARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQ  988

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              L+        + ++ E +   L+ Q+S    + R+  +   A    +     E+ + L 
Sbjct  989   KLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERRL-LEERLAEFSSQAAEEEEKVKSLN  1047

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGM----------QLEDLKQQLQQAEEALVAKQ  278
             +L++ Y     + ++ +K    G +    +            E + +Q Q+AEE L    
Sbjct  1048  KLRLKYEATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLG  1107

Query  279   EVIDKLKEEAEQHKIV-------METVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
                D+L+    + +         ++++   +A     + D +AER AR K  +++  L E
Sbjct  1108  RKEDELQAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGE  1167

Query  332   QLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSP  388
             +LE L+ E      S      +   R++ V   +  L          +    QR S 
Sbjct  1168  ELEALRGELEDTLDSTNAQQELRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQ  1224


 Score = 40.6 bits (93),  Expect = 0.029, Method: Composition-based stats.
 Identities = 47/286 (16%), Positives = 112/286 (39%), Gaps = 15/286 (5%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
             QELR    Q+   + E+ E+    +    + +  L  +  E +  +  L   + + ++++
Sbjct  1216  QELRQRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSRQEGEQKR  1275

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
              +   +++ ++         ++    ++     EL+   + L  A  +   L     +A 
Sbjct  1276  RRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAE  1335

Query  179   EQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL--AQLQVA  233
              Q    ++L  E    +     +V  L  +   +   +  E  A     R+L   Q Q++
Sbjct  1336  SQLHDTQELLQEETRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLS  1395

Query  234   YHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL-------VAKQEVIDKLKE  286
               +  QE +  +  +   + R+   + E L Q+L +  EA+          Q+ +D    
Sbjct  1396  EWRRRQEEEAAVLEAGEEARRRAAREAETLTQRLAEKTEAVERLERARRRLQQELDDATV  1455

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
             +  Q K ++ T+   + + D   A+   E+ A  +  E +E ++ +
Sbjct  1456  DLGQQKQLLSTLEKKQRKFDQLLAE---EKAAVLRAVEDRERIEAE  1498


 Score = 37.9 bits (86),  Expect = 0.20, Method: Composition-based stats.
 Identities = 60/314 (19%), Positives = 125/314 (40%), Gaps = 15/314 (5%)

Query  41    LPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
             +  +Q A E L +   +  EL+ A+ ++ +    R + L   + +Q    E      +  
Sbjct  1093  VEQKQRAEELLAQLGRKEDELQAALLRAEEEGGARAQLLKSLREAQAGLAE-AQEDLEAE  1151

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
             R    +   ++ DL  + E    E+E          E ++  + +VT L   L+E     
Sbjct  1152  RVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKALEEESRAH  1211

Query  161   EAATKECQALEGRARAASEQARQLESER------EALQQQHSVQVDQLRMQGQSVEAALR  214
             E + +E +  +  ++A  E A QLE  R      E  +     +V +L+ +  S++ + +
Sbjct  1212  EVSMQELR--QRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSRQ  1269

Query  215   MERQAASEEKRKLAQLQ---VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
                Q     + +L ++Q       +   E    ++ +    E       E   + ++  +
Sbjct  1270  EGEQKRRRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGK  1329

Query  272   EALVAKQEVIDK---LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKEL  328
             E   A+ ++ D    L+EE      +   V  L+A+A   +   + E  ARE+   + + 
Sbjct  1330  ELSSAESQLHDTQELLQEETRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQS  1389

Query  329   LQEQLEQLQREYSK  342
              Q QL + +R   +
Sbjct  1390  TQAQLSEWRRRQEE  1403


 Score = 32.5 bits (72),  Expect = 9.1, Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 91/224 (41%), Gaps = 14/224 (6%)

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
             L  E   L   K+   + V  L+R ++   +  + ++ QVT L  EL        AA   
Sbjct  1530  LRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDEL-------TAAEDA  1582

Query  167   CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
                LE   +A   Q  +    R+   ++   Q+ +     +      R +R  A   ++K
Sbjct  1583  KLRLEVTVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKK  1642

Query  227   LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             L                  + +V   ++ + +Q+++L +++++      + ++ +  L  
Sbjct  1643  LELELEELKAQTSAAGQGKEEAVKQLKKMQ-VQMKELWREVEETR----SSRDEMFTLSR  1697

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQ  330
             E E+    +E   VL+ Q ++  +D +A RQA++   E  E + 
Sbjct  1698  ENEKKLKGLEA-EVLRLQEELAASD-RARRQAQQDRDEMAEEVA  1739


>sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090 
GN=Dctn1 PE=1 SV=3
Length=1281

 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 64/342 (19%), Positives = 152/342 (44%), Gaps = 11/342 (3%)

Query  62   RDAIRQSNQILRERCEELLHFQASQREEKEFLMC---KFQEARKLVERLGLEKLDLKRQK  118
             + +R   + L E+ E L   ++  + + + L     + ++ ++   ++  ++ DL+R+ 
Sbjct  217  EEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRL  276

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
            ++A +E +     +++  E+ A     +     + + ++ R E+  +E +AL+ R    +
Sbjct  277  KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELT  336

Query  179  EQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
                 L+    E+ +     S Q+ QL  Q   ++ AL   R  +S EK++  +LQ    
Sbjct  337  TDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLME  396

Query  236  QLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKI  293
            +  QE +   +      E     +  +++LK+Q+  A  A    + + D+     E+ + 
Sbjct  397  KKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRE  456

Query  294  VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
            + ETV  L+A  ++   + + +  ARE   E +E L     +++    +++A+ +  A  
Sbjct  457  LRETVGDLEAMNEM---NDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADY  513

Query  354  EDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
            +   K++ +++           +   A   +++ PP E  DF
Sbjct  514  QQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 72/356 (20%), Positives = 151/356 (42%), Gaps = 32/356 (9%)

Query  41   LPSEQGAPETLQRCLEENQELRDAIR----QSNQILRE------RCEELLHFQASQREEK  90
            LPS     E L+  + + +E  + +R    +    L+E      + E++  +++  +E++
Sbjct  210  LPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQ  269

Query  91   EFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
              L  + +EARK  +     K     +       +E     ++   E   S++ +V +L 
Sbjct  270  ADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALK  329

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD----------  200
              + E  + LE    E +       A+S Q +QLE +   L+       D          
Sbjct  330  ERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHV  389

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI-KSSVVGSERKRGMQ  259
            +L+   +     L + RQ     + +L+Q +    +L ++ D  +    +V     R + 
Sbjct  390  KLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLN  449

Query  260  LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAR  319
            LE+  ++L++    L A  E+ D+L+E A + ++       L+ Q D+  A     R+A+
Sbjct  450  LEEKVRELRETVGDLEAMNEMNDELQENARETELE------LREQLDMAGARV---REAQ  500

Query  320  EKLAEKKELLQEQLEQLQREYSKLKASCQESAR-IEDMRKRHVEVSQAPLPPAPAY  374
            +++   +E +    +Q  ++Y +L A  Q+  R + + ++  VE  Q P P    +
Sbjct  501  KRVEAAQETVA-DYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  555


>sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 
15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
Length=864

 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 43/220 (20%), Positives = 94/220 (43%), Gaps = 18/220 (8%)

Query  59   QELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +EL D  ++  Q+ RE+       +   RE++E +  K  E ++L   L  E   L+  +
Sbjct  384  KELDDISQEIAQLQREKY----SLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELE  439

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ---ESQSRLEAATKECQALEGRAR  175
             Q     + L    QQ A+ +  +         E Q     ++++++   + ++ E    
Sbjct  440  AQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLN  499

Query  176  AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY-  234
             A  +  +L+ E   L+Q     +   R+Q +++  +L+  +   ++ + KL+QL  +  
Sbjct  500  RAKSELNRLQQEETQLEQ----SIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQ  555

Query  235  --HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
              H+  ++YD  +     G+       L +L + +  AE 
Sbjct  556  EAHRSLEQYDQVLD----GAHGASLTDLANLSEGVSLAER  591


 Score = 49.8 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 91/220 (41%), Gaps = 34/220 (15%)

Query  135  MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
            ++++ A ++ +  SL  +++E +  +   T E Q L+      +   ++LE++++  Q  
Sbjct  389  ISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQD-  447

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
               ++D++  Q   +   L   RQ   +E                +  + +K+ +   E 
Sbjct  448  ---RLDEMDQQKAKLRDMLSDVRQKCQDE---------------TQMISSLKTQIQSQES  489

Query  255  KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV--PVLKAQADIYKADF  312
                 L+  +  L +A+  L   Q+   +L++  +  ++ +ET+   +   Q +I +A  
Sbjct  490  ----DLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQA--  543

Query  313  QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
               R    +L E ++     LE    +Y ++      ++ 
Sbjct  544  ---RSKLSQLHESRQEAHRSLE----QYDQVLDGAHGASL  576


 Score = 45.6 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/156 (19%), Positives = 69/156 (44%), Gaps = 17/156 (11%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRE----------RCEELLHFQASQREEKEFLMCKF  97
             E +++   E QEL++ + +    L+E          R +E+   +A  R+    +  K 
Sbjct  411  EEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKC  470

Query  98   QEARKLVERLGLE----KLDLKRQKE---QALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
            Q+  +++  L  +    + DLK Q++   +A  E+  L++ + Q+ +   + + Q+ +++
Sbjct  471  QDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETII  530

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLES  186
              L+ +Q  +  A  +   L    + A     Q + 
Sbjct  531  KSLKSTQDEINQARSKLSQLHESRQEAHRSLEQYDQ  566


>sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 
PE=1 SV=3
Length=1961

 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 59/344 (17%), Positives = 135/344 (39%), Gaps = 18/344 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R+ +     R  E+   Q+    EK  L  + Q   +L       +  L  +K++    
Sbjct  857   VREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAKTELCAEAEELRARLTAKKQELEEI  916

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                L+   ++  E    ++A+   +   +QE + +LE      Q L+        + ++L
Sbjct  917   CHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKL  976

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E ++  ++ Q+     + ++  +   A    +     E+ + LA+L+  +  +  + +  
Sbjct  977   EEDQIIMEDQNCKLAKEKKL-LEDRVAEFTTDLMEEEEKSKSLAKLKNKHEAMITDLEER  1035

Query  245   IKSSVVGSERKRG-------------MQLEDLKQQLQQAEEALVAKQEVIDK----LKEE  287
             ++      +                  Q+ +L+ Q+ + +  L  K+E +      ++EE
Sbjct  1036  LRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEE  1095

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
             A Q  + ++ +  L+ Q    + D ++ER  R K  ++K  L E+LE L+ E      S 
Sbjct  1096  AAQKNMALKKIRELETQISELQEDLESERACRNKAEKQKRDLGEELEALKTELEDTLDST  1155

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                  +   R++ V + +  L        + +    Q+ S   E
Sbjct  1156  AAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVE  1199


 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 60/340 (18%), Positives = 134/340 (39%), Gaps = 22/340 (6%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L + LEE     D + ++   L++  ++LL     QR+    L  K ++  +L+    
Sbjct  1396  EGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEK  1455

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                     ++++A  E           A +K +    +   L E  E ++ LE   K+ +
Sbjct  1456  TISAKYAEERDRAEAE-----------AREKETKALSLARALEEAMEQKAELERLNKQFR  1504

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                    ++ +   +   E E   +    QV++++ Q + +E  L+    A    +  L 
Sbjct  1505  TEMEDLMSSKDDVGKSVHELEKSNRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQ  1564

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
              ++  + +  Q  D   +       R+      +L+ + +Q   A+ A++++   LK+  
Sbjct  1565  AMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLKDLE  1624

Query  289   E-------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
                       +  ++ +  L+AQ      D    R +RE++  + +  +++L+ ++ E  
Sbjct  1625  AHIDTANKNREEAIKQLRKLQAQMKDCMRDVDDTRASREEILAQAKENEKKLKSMEAEMI  1684

Query  342   KLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             +L+     + R     KR  +  +  L    A  S   AL
Sbjct  1685  QLQEELAAAER----AKRQAQQERDELADEIANSSGKGAL  1720


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 61/338 (18%), Positives = 140/338 (41%), Gaps = 21/338 (6%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +T ++   ++ +L D I +    L+ +  EL    A + EE +  + + +E     
Sbjct  1044  QELEKTRRKLEGDSTDLSDQIAE----LQAQIAELKMQLAKKEEELQAALARVEEEAAQK  1099

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
                  +  +L+ Q  +   ++E  + C+ +  + K  +  ++ +L  EL+++     A  
Sbjct  1100  NMALKKIRELETQISELQEDLESERACRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQ  1159

Query  165   KECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             +     E       +   ++A+  E++ + ++Q+HS  V++L  Q +  +       +A 
Sbjct  1160  ELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKATLEKAK  1219

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                + +  +L      L Q   +          +K   QL++L+ +  + E         
Sbjct  1220  QTLENERGELANEVKALLQGKGDS-----EHKRKKVEAQLQELQVKFSEGERVRT-----  1269

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE-KLAEKKELLQEQLEQLQRE  339
               +L ++  + ++ +++V  L  Q+D   +    +  A E +L + +ELLQE+  Q    
Sbjct  1270  --ELADKVSKLQVELDSVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSL  1327

Query  340   YSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
              +KLK    E     +  +   E ++  L    A L +
Sbjct  1328  STKLKQMEDEKNSFREQLEEEEEEAKRNLEKQIATLHA  1365


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 58/257 (23%), Positives = 118/257 (46%), Gaps = 27/257 (11%)

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
             CK  + +KL+E    E      ++E+  + +  LK   + M          +T L   L+
Sbjct  988   CKLAKEKKLLEDRVAEFTTDLMEEEEKSKSLAKLKNKHEAM----------ITDLEERLR  1037

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR---MQGQSVEA  211
               + + +   K  + LEG +   S+Q  +L+++   L+ Q + + ++L+    + +   A
Sbjct  1038  REEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAA  1097

Query  212   ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
                M  +   E + ++++LQ        E +   ++     +R  G +LE LK +L+   
Sbjct  1098  QKNMALKKIRELETQISELQEDL-----ESERACRNKAEKQKRDLGEELEALKTELEDTL  1152

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
             ++  A+QE+  K ++E    K  +E       +A  ++A  Q   + R+K ++  E L E
Sbjct  1153  DSTAAQQELRSKREQEVSILKKTLED------EAKTHEAQIQ---EMRQKHSQAVEELAE  1203

Query  332   QLEQLQREYSKLKASCQ  348
             QLEQ +R  + L+ + Q
Sbjct  1204  QLEQTKRVKATLEKAKQ  1220


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 49/305 (16%), Positives = 120/305 (39%), Gaps = 23/305 (8%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              +T  R  +E  +L   +    Q +    ++   F     EEK  +  K+ E R   E  
Sbjct  1413  EKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKT-ISAKYAEERDRAEAE  1471

Query  108   GLEKL----DLKRQKEQALR--------------EVEHLKRCQQQMAEDKASVKAQVTSL  149
               EK      L R  E+A+               E+E L   +  + +    ++    +L
Sbjct  1472  AREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSNRAL  1531

Query  150   LGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV  209
               +++E +++LE    E QA E          + ++++ E   Q    Q ++ + Q    
Sbjct  1532  EQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQ  1591

Query  210   EAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
                +  E     E++RK   + +A  +  +     +++ +  + + R   ++ L++   Q
Sbjct  1592  VREMEAE----LEDERKQRSIAMAARKKLEMDLKDLEAHIDTANKNREEAIKQLRKLQAQ  1647

Query  270   AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL  329
              ++ +    +     +E   Q K   + +  ++A+    + +  A  +A+ +  ++++ L
Sbjct  1648  MKDCMRDVDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDEL  1707

Query  330   QEQLE  334
              +++ 
Sbjct  1708  ADEIA  1712


 Score = 41.7 bits (96),  Expect = 0.012, Method: Composition-based stats.
 Identities = 52/261 (20%), Positives = 110/261 (42%), Gaps = 20/261 (8%)

Query  93    LMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR--------CQQQMAEDKASVKA  144
             L  + Q+ ++L++    +KL L  + +Q   E    +          ++ + +  A++ A
Sbjct  1306  LESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEEAKRNLEKQIATLHA  1365

Query  145   QVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRM  204
             QVT +  ++++    LE A +  + L+      S++      E+ A   +      +L+ 
Sbjct  1366  QVTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQRL----EEKVAAYDKLEKTKTRLQQ  1421

Query  205   QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
             +   +   L  +RQ+ S  ++K    Q  + QL  E            +R      E   
Sbjct  1422  ELDDLLVDLDHQRQSVSNLEKK----QKKFDQLLAEEKTISAKYAEERDRAEAEAREKET  1477

Query  265   QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAE  324
             + L  A  AL    E   +L+   +Q +  ME +  + ++ D+ K+  + E+  R  L +
Sbjct  1478  KALSLA-RALEEAMEQKAELERLNKQFRTEMEDL--MSSKDDVGKSVHELEKSNR-ALEQ  1533

Query  325   KKELLQEQLEQLQREYSKLKA  345
             + E ++ QLE+L+ E    + 
Sbjct  1534  QVEEMKTQLEELEDELQATED  1554


 Score = 41.4 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 60/344 (17%), Positives = 133/344 (39%), Gaps = 24/344 (7%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF------LMCK  96
             + +   E +++  +   +++D +R  +     R E L   + ++++ K        L  +
Sbjct  1630  ANKNREEAIKQLRKLQAQMKDCMRDVDDTRASREEILAQAKENEKKLKSMEAEMIQLQEE  1689

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
                A +   +   E+ +L  +   +  +       ++++    A ++ ++    G  +  
Sbjct  1690  LAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEALIALLEEELEEEQGNTELI  1749

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               RL+ A  +   +          A++ E+ R    QQ   Q  +L+ + Q +E+A++ +
Sbjct  1750  NDRLKKANLQIDQINTDLNLERSHAQKNENAR----QQLERQNKELKAKLQEMESAVKSK  1805

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
                    K  +A L+    QL ++ DN  K     S++ R  + + LK  L Q E+    
Sbjct  1806  Y------KASIAALEAKIAQLEEQLDNETKERQAASKQVRRAE-KKLKDVLLQVEDERRN  1858

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
              ++  D+  + + + K        LK Q +  + + Q    +R KL  + E   E  + +
Sbjct  1859  AEQFKDQADKASTRLKQ-------LKRQLEEAEEEAQRANASRRKLQRELEDATETADAM  1911

Query  337   QREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              RE S LK   +       + +R V               +  A
Sbjct  1912  NREVSSLKNKLRRGDMPFVVTRRIVRKGTGDCSDEEVDGKADGA  1955


 Score = 41.4 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 48/288 (17%), Positives = 111/288 (39%), Gaps = 8/288 (3%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L+    E ++  D+     ++  +R +E+   + +  +E +    + QE R   ++  
Sbjct  1139  EELEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMR---QKHS  1195

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                 +L  Q EQ  R    L++ +Q +  ++  +  +V +LL    +S+ + +    + Q
Sbjct  1196  QAVEELAEQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQ  1255

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              L+ +         +L  +   LQ +    V  L  Q  S  + L  +  A   + +   
Sbjct  1256  ELQVKFSEGERVRTELADKVSKLQVELD-SVTGLLNQSDSKSSKLTKDFSALESQLQDTQ  1314

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +L    ++        +K         R    E+ ++  +  E+ +      +  +K++ 
Sbjct  1315  ELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEEAKRNLEKQIATLHAQVTDMKKKM  1374

Query  289   EQHKIVMETVP----VLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
             E     +ET       L+   +      + +  A +KL + K  LQ++
Sbjct  1375  EDGVGCLETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQE  1422


 Score = 38.3 bits (87),  Expect = 0.17, Method: Composition-based stats.
 Identities = 49/314 (16%), Positives = 117/314 (37%), Gaps = 27/314 (9%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
               + + + + + E ++   A+ Q  + ++ + EEL     +  + K  L    Q  +   
Sbjct  1511  MSSKDDVGKSVHELEKSNRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQF  1570

Query  105   ERL--------GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             ER           +K  L RQ  +   E+E  ++ +      +  ++  +  L   +  +
Sbjct  1571  ERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLKDLEAHIDTA  1630

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 E A K+ + L+ + +          + RE +  Q      +L+    S+EA +   
Sbjct  1631  NKNREEAIKQLRKLQAQMKDCMRDVDDTRASREEILAQAKENEKKLK----SMEAEMIQL  1686

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++  +  +R   Q Q    +L  E  N      +  E KR ++      + +        
Sbjct  1687  QEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEALIALLEEEL-------  1739

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
                     +EE    +++ + +     Q D    D   ER   +K    ++ L+ Q ++L
Sbjct  1740  --------EEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKEL  1791

Query  337   QREYSKLKASCQES  350
             + +  +++++ +  
Sbjct  1792  KAKLQEMESAVKSK  1805


 Score = 34.8 bits (78),  Expect = 1.9, Method: Composition-based stats.
 Identities = 46/264 (17%), Positives = 101/264 (38%), Gaps = 1/264 (0%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K  M  +   + + E +    +EN++   ++      L+E        +   ++E++ L 
Sbjct  1649  KDCMRDVDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELA  1708

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +   +         EK  L+        E+E  +   + + +       Q+  +  +L 
Sbjct  1709  DEIANSSGKGALALEEKRRLEALIALLEEELEEEQGNTELINDRLKKANLQIDQINTDLN  1768

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
               +S  +      Q LE + +    + +++ES  ++  +     ++    Q +       
Sbjct  1769  LERSHAQKNENARQQLERQNKELKAKLQEMESAVKSKYKASIAALEAKIAQLEEQLDNET  1828

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
              ERQAAS++ R+ A+ ++    L  E +            K   +L+ LK+QL++AEE  
Sbjct  1829  KERQAASKQVRR-AEKKLKDVLLQVEDERRNAEQFKDQADKASTRLKQLKRQLEEAEEEA  1887

Query  275   VAKQEVIDKLKEEAEQHKIVMETV  298
                     KL+ E E      + +
Sbjct  1888  QRANASRRKLQRELEDATETADAM  1911


>sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo 
sapiens OX=9606 GN=MAP1A PE=1 SV=6
Length=2803

 Score = 59.9 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 57/338 (17%), Positives = 146/338 (43%), Gaps = 23/338 (7%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             L++R  E    Q  + E K+ ++ +  +  +  E +  +   + ++ E    + E +K+ 
Sbjct  1349  LKDRTSE----QKKEPEPKDEVLQQKDKTLEHKEVVEPKDTAIYQKDEALHVKNEAVKQQ  1404

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREAL  191
              + + +    ++ + T+L  + +  + + +   ++ +ALE + +   E+ + LE +  AL
Sbjct  1405  DKALEQKGRDLEQKDTALEQKDKALEPKDKDLEEKDKALEQKDKIPEEKDKALEQKDTAL  1464

Query  192   QQQ---HSVQVDQLRMQGQSVEAALRM--ERQAASEEKRKLAQLQVAYHQLFQEYDNHIK  246
             +Q+      +   L  + + +E   ++  E+  A ++K +  + +     + +  D  ++
Sbjct  1465  EQKDKALEPKDKDLEQKDRVLEQKEKIPEEKDKALDQKVRSVEHKAPEDTVAEMKDRDLE  1524

Query  247   SSVVGSERKRGMQLEDLKQQL-QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
              +    E+    Q ++ K ++ ++ ++AL  K   + +  E  EQ+   +E     + Q 
Sbjct  1525  QTDKAPEQ--KHQAQEQKDKVSEKKDQALEQKYWALGQKDEALEQNIQALEENHQTQEQE  1582

Query  306   DIYKAD-FQAERQAREKLAEKKELLQEQLEQLQREYSK--LKASCQESARIEDMRKRHVE  362
              + + D  +  +   EK  EK + ++E+LE L  +     L+ S  +  R  +  +++  
Sbjct  1583  SLVQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKALGLEESLVQEGRAREQEEKYWR  1642

Query  363   VS--------QAPLPPAPAYLSSPLALPSQRRSPPEEP  392
                        +P    PA     LA   +  SP ++ 
Sbjct  1643  GQDVVQEWQETSPTREEPAGEQKELAPAWEDTSPEQDN  1680


>sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus OX=9031 
GN=DCTN1 PE=1 SV=2
Length=1224

 Score = 59.5 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 51/253 (20%), Positives = 106/253 (42%), Gaps = 26/253 (10%)

Query  49   ETLQRCLEENQELRDAIRQSNQ---ILRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
            E  +R +EE  +  DAI  +     +  ER E L     S +E+ E+L    +  +  +E
Sbjct  281  EAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDSLKEKVEYLTMDLEILKHEIE  340

Query  106  RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
              G +      Q +Q   +   LK    +M +  AS K +   L  ++++  + LE+  +
Sbjct  341  EKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHVKLQKQMEKKNTELESLRQ  400

Query  166  ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM-----ERQAA  220
            + + L+   +                  Q    VD+L+ Q  +   A  M     ER   
Sbjct  401  QREKLQEEVK------------------QAEKTVDELKEQVDAALGAEEMVETLTERNLD  442

Query  221  SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             EEK +  +  V   +   E ++ ++ +   +E +   QL+    ++++AE+ + A QE 
Sbjct  443  LEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDLAAARVREAEKRVEAAQET  502

Query  281  IDKLKEEAEQHKI  293
            +   ++  ++++ 
Sbjct  503  VADYQQTIKKYRE  515


 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 67/351 (19%), Positives = 148/351 (42%), Gaps = 47/351 (13%)

Query  85   SQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKA  144
            S  +E+E L  + ++  + +E L ++    + + +  L+E+E  K   +Q+ E K+ ++ 
Sbjct  205  SPTKEEENLRSQVRDLEEKLETLKIK----RNEDKAKLKELEKYKIQLEQVQEWKSKMQE  260

Query  145  QVTSLLGELQESQSR----------------------------LEAATKECQALEGRARA  176
            Q   L   L+E++                               E A +  ++L+    +
Sbjct  261  QQADLQRRLKEAKKEAKDALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDS  320

Query  177  ASEQARQLESEREALQQQH----------SVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
              E+   L  + E L+ +           S QV QL  Q   ++ AL   R  ++ EK++
Sbjct  321  LKEKVEYLTMDLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQE  380

Query  227  LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKL  284
              +LQ    +   E ++  +      E  +  +  +++LK+Q+  A  A    + + ++ 
Sbjct  381  HVKLQKQMEKKNTELESLRQQREKLQEEVKQAEKTVDELKEQVDAALGAEEMVETLTERN  440

Query  285  KEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
             +  E+ + + ETV  L+A  ++   + + +  ARE   E +E L     +++    +++
Sbjct  441  LDLEEKVRELRETVGDLEAMNEM---NDELQENARETELELREQLDLAAARVREAEKRVE  497

Query  345  ASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
            A+ +  A  +   K++ E++          +S   A   +++ PP E  DF
Sbjct  498  AAQETVADYQQTIKKYRELTAHLQDVNRELMSQQEASAEKQQQPPPEIFDF  548


 Score = 41.7 bits (96),  Expect = 0.013, Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 92/234 (39%), Gaps = 25/234 (11%)

Query  146  VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ  205
            V S   E +  +S++    ++ + L+ +      + ++LE  +  L+Q    +      Q
Sbjct  203  VPSPTKEEENLRSQVRDLEEKLETLKIKRNEDKAKLKELEKYKIQLEQVQEWKSKMQEQQ  262

Query  206  GQSVE--AALRMERQAASEEKRKLA----------QLQVAYHQLFQEYDNHIKS---SVV  250
                      + E + A E K +            ++     ++ +E    ++    S+ 
Sbjct  263  ADLQRRLKEAKKEAKDALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDSLK  322

Query  251  GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKA  310
                   M LE LK ++++      A    + +L+E+  + K  +  +  L A       
Sbjct  323  EKVEYLTMDLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSA-------  375

Query  311  DFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVS  364
               +E+Q   KL ++ E    +LE L+++  KL+   +++ +  D  K  V+ +
Sbjct  376  ---SEKQEHVKLQKQMEKKNTELESLRQQREKLQEEVKQAEKTVDELKEQVDAA  426


>sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein 
C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) 
OX=284812 GN=SPBC800.10c PE=4 SV=1
Length=1116

 Score = 58.7 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/223 (14%), Positives = 87/223 (39%), Gaps = 18/223 (8%)

Query  143  KAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQL  202
             A+   L  E+ + +S+L    K    L+  +R  +     ++++   +++ +  ++ + 
Sbjct  495  SAEQLKLAAEVPKLESQLSQVKKSNDDLQKSSRDVAANLSDVKAKVSEIRKAYDEELAKA  554

Query  203  RMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL---FQEYDNHIKSSVVGSERKRGMQ  259
            +     +   +   +    +  R+ + L+   + L    ++    ++  V  SE  + M 
Sbjct  555  K----QISLDIETNKAQTEQVNREYSILEATLNALQKQNKQKGEVLEQVVAESEAAKNMV  610

Query  260  ------LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ  313
                  ++ LK ++   E+ L      +D++ +         + V   K   +    + +
Sbjct  611  ESSNASIQQLKSEVADKEQTLAQLHLQLDEMTQRLVSLDEESKAVSQRKLDLEYKINNSK  670

Query  314  AERQ-AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
             +   A E+  E  + L+ +    ++E SKL+   +     E+
Sbjct  671  TQLATATEEYHEHSKQLEAE----KQELSKLEDGLKSVNLTEE  709


>sp|Q6P9Q6|FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus 
OX=10090 GN=Fkbp15 PE=1 SV=2
Length=1216

 Score = 58.7 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 52/341 (15%), Positives = 115/341 (34%), Gaps = 4/341 (1%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
            +QR ++EN+ L+  + + +  + E+ +++       +    ++        K    L   
Sbjct  565  IQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQR---YVEQSNLMMEKRNNSLQTA  621

Query  111  KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
              + + +   A +E   +           + ++ ++T+   +  E Q +L    KE   L
Sbjct  622  TENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLL  681

Query  171  EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             G          +L    E   Q       Q R Q +    +L  E      EK  L + 
Sbjct  682  RGHVTRLQADLSELREASEQ-TQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEKN  740

Query  231  QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
                 +   +     ++ +    +    +L+ L+Q L++A  +          L +   Q
Sbjct  741  LSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQLTLAQAELQ  800

Query  291  HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
             +   +   +L +  D +   ++     R+   +K  LLQ++   LQ + +      +  
Sbjct  801  SQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQDECLALQAQIAAFTEQKEHM  860

Query  351  ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
             R+E  + +      A  P             S R     E
Sbjct  861  QRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELE  901


>sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 
PE=1 SV=4
Length=1960

 Score = 58.7 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 59/344 (17%), Positives = 135/344 (39%), Gaps = 18/344 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R+ +     R  E+   Q+    EK  L  + Q   +L       +  L  +K++    
Sbjct  857   VREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEI  916

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                L+   ++  E    ++A+   +   +QE + +LE      Q L+        + ++L
Sbjct  917   CHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKL  976

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E ++  ++ Q+     + ++  +   A          E+ + LA+L+  +  +  + +  
Sbjct  977   EEDQIIMEDQNCKLAKEKKL-LEDRVAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEER  1035

Query  245   IKSSVVGSERKRG-------------MQLEDLKQQLQQAEEALVAKQEVIDK----LKEE  287
             ++      +                  Q+ +L+ Q+ + +  L  K+E +      ++EE
Sbjct  1036  LRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEE  1095

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
             A Q  + ++ +  L+ Q    + D ++ER +R K  ++K  L E+LE L+ E      S 
Sbjct  1096  AAQKNMALKKIRELETQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDST  1155

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                  +   R++ V + +  L        + +    Q+ S   E
Sbjct  1156  AAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVE  1199


 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 59/340 (17%), Positives = 135/340 (40%), Gaps = 22/340 (6%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L + LEE     D + ++   L++  ++LL     QR+    L  K ++  +L+    
Sbjct  1395  EGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEK  1454

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                     ++++A  E           A +K +    +   L E  E ++ LE   K+ +
Sbjct  1455  TISAKYAEERDRAEAE-----------AREKETKALSLARALEEAMEQKAELERLNKQFR  1503

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                    ++ +   +   E E  ++    QV++++ Q + +E  L+    A    +  L 
Sbjct  1504  TEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQ  1563

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
              ++  + +  Q  D   +       R+      +L+ + +Q   A+ A++++   LK+  
Sbjct  1564  AMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLKDLE  1623

Query  289   E-------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
                       +  ++ +  L+AQ      +    R +RE++  + +  +++L+ ++ E  
Sbjct  1624  AHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMI  1683

Query  342   KLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             +L+     + R     KR  +  +  L    A  S   AL
Sbjct  1684  QLQEELAAAER----AKRQAQQERDELADEIANSSGKGAL  1719


 Score = 46.0 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 53/328 (16%), Positives = 134/328 (41%), Gaps = 13/328 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +T ++   ++ +L D I +    L+ +  EL    A + EE +  + + +E     
Sbjct  1044  QELEKTRRKLEGDSTDLSDQIAE----LQAQIAELKMQLAKKEEELQAALARVEEEAAQK  1099

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
                  +  +L+ Q  +   ++E  +  + +  + K  +  ++ +L  EL+++     A  
Sbjct  1100  NMALKKIRELETQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQ  1159

Query  165   KECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             +     E       +   ++A+  E++ + ++Q+HS  V++L  Q +  +       +A 
Sbjct  1160  ELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEELADQLEQTKRVKATLEKAK  1219

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                + +  +L      L Q   +          +K   QL++L+ +  + E       + 
Sbjct  1220  QTLENERGELANEVKALLQGKGDS-----EHKRKKVEAQLQELQVKFSEGERVRTELADK  1274

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREY  340
             + KL+ E +    ++       ++     +  +++ Q  ++L +++   +  L    ++ 
Sbjct  1275  VTKLQVELDSVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQM  1334

Query  341   SKLKASCQESARIEDMRKRHVEVSQAPL  368
                K S +E    E+  KR++E   A L
Sbjct  1335  EDEKNSFREQLEEEEEAKRNLEKQIATL  1362


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 49/305 (16%), Positives = 120/305 (39%), Gaps = 23/305 (8%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              +T  R  +E  +L   +    Q +    ++   F     EEK  +  K+ E R   E  
Sbjct  1412  EKTKTRLQQELDDLLVDLDHQRQSVSNLEKKQKKFDQLLAEEKT-ISAKYAEERDRAEAE  1470

Query  108   GLEKL----DLKRQKEQALR--------------EVEHLKRCQQQMAEDKASVKAQVTSL  149
               EK      L R  E+A+               E+E L   +  + +    ++    +L
Sbjct  1471  AREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRAL  1530

Query  150   LGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV  209
               +++E +++LE    E QA E          + ++++ E   Q    Q ++ + Q    
Sbjct  1531  EQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQ  1590

Query  210   EAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
                +  E     E++RK   + +A  +  +     +++ +  + + R   ++ L++   Q
Sbjct  1591  VREMEAE----LEDERKQRSMAMAARKKLEMDLKDLEAHIDTANKNREEAIKQLRKLQAQ  1646

Query  270   AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL  329
              ++ +    +     +E   Q K   + +  ++A+    + +  A  +A+ +  ++++ L
Sbjct  1647  MKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDEL  1706

Query  330   QEQLE  334
              +++ 
Sbjct  1707  ADEIA  1711


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 118/257 (46%), Gaps = 27/257 (11%)

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
             CK  + +KL+E    E      ++E+  + +  LK   + M          +T L   L+
Sbjct  988   CKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAKLKNKHEAM----------ITDLEERLR  1037

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR---MQGQSVEA  211
               + + +   K  + LEG +   S+Q  +L+++   L+ Q + + ++L+    + +   A
Sbjct  1038  REEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAA  1097

Query  212   ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
                M  +   E + ++++LQ        E +   ++     +R  G +LE LK +L+   
Sbjct  1098  QKNMALKKIRELETQISELQEDL-----ESERASRNKAEKQKRDLGEELEALKTELEDTL  1152

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
             ++  A+QE+  K ++E    K  +E       +A  ++A  Q   + R+K ++  E L +
Sbjct  1153  DSTAAQQELRSKREQEVSILKKTLED------EAKTHEAQIQ---EMRQKHSQAVEELAD  1203

Query  332   QLEQLQREYSKLKASCQ  348
             QLEQ +R  + L+ + Q
Sbjct  1204  QLEQTKRVKATLEKAKQ  1220


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 53/260 (20%), Positives = 112/260 (43%), Gaps = 19/260 (7%)

Query  93    LMCKFQEARKLVERLGLEKLDLKRQKEQALRE-------VEHLKRCQQQMAEDKASVKAQ  145
             L  + Q+ ++L++    +KL L  + +Q   E       +E  +  ++ + +  A++ AQ
Sbjct  1306  LESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQ  1365

Query  146   VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ  205
             VT +  ++++    LE A +  + L+      S++      E+ A   +      +L+ +
Sbjct  1366  VTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQRL----EEKVAAYDKLEKTKTRLQQE  1421

Query  206   GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
                +   L  +RQ+ S  ++K    Q  + QL  E            +R      E   +
Sbjct  1422  LDDLLVDLDHQRQSVSNLEKK----QKKFDQLLAEEKTISAKYAEERDRAEAEAREKETK  1477

Query  266   QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK  325
              L  A  AL    E   +L+   +Q +  ME +  + ++ D+ K+  + E+  R  L ++
Sbjct  1478  ALSLA-RALEEAMEQKAELERLNKQFRTEMEDL--MSSKDDVGKSVHELEKSKR-ALEQQ  1533

Query  326   KELLQEQLEQLQREYSKLKA  345
              E ++ QLE+L+ E    + 
Sbjct  1534  VEEMKTQLEELEDELQATED  1553


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 59/334 (18%), Positives = 132/334 (40%), Gaps = 24/334 (7%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF------LMCK  96
             + +   E +++  +   +++D +R+ +     R E L   + ++++ K        L  +
Sbjct  1629  ANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEE  1688

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
                A +   +   E+ +L  +   +  +       ++++    A ++ ++    G  +  
Sbjct  1689  LAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELI  1748

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               RL+ A  +   +          A++ E+ R    QQ   Q  +L+ + Q +E+A++ +
Sbjct  1749  NDRLKKANLQIDQINTDLNLERSHAQKNENAR----QQLERQNKELKAKLQEMESAVKSK  1804

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
                    K  +A L+    QL ++ DN  K     S++ R  + + LK  L Q E+    
Sbjct  1805  Y------KASIAALEAKIAQLEEQLDNETKERQAASKQVRRTE-KKLKDVLLQVEDERRN  1857

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
              ++  D+  + + + K        LK Q +  + + Q    +R KL  + E   E  + +
Sbjct  1858  AEQFKDQADKASTRLKQ-------LKRQLEEAEEEAQRANASRRKLQRELEDATETADAM  1910

Query  337   QREYSKLKASCQESARIEDMRKRHVEVSQAPLPP  370
              RE S LK   +       + +R V         
Sbjct  1911  NREVSSLKNKLRRGDLPFVVTRRIVRKGTGDCSD  1944


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 53/320 (17%), Positives = 133/320 (42%), Gaps = 22/320 (7%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L+  L++ QEL     +    L  + +++   + S RE+ E      +   K +  L  +
Sbjct  1306  LESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQ  1365

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               D+K++ E  +  +E  +  ++++ +D   +  +       L+E  +  +   K    L
Sbjct  1366  VTDMKKKMEDGVGCLETAEEAKRRLQKDLEGLSQR-------LEEKVAAYDKLEKTKTRL  1418

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             +                   L+++   + DQL  + +++ A    ER  A  E R+    
Sbjct  1419  QQELDDLLVDLDHQRQSVSNLEKKQ-KKFDQLLAEEKTISAKYAEERDRAEAEAREKETK  1477

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ------LQQAEEALVAKQEVIDKL  284
              ++  +  +E           +++ R    + +  +      + + E++  A ++ ++++
Sbjct  1478  ALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEM  1537

Query  285   KEEAEQHKIVMETVPVLKAQADI----YKADFQAERQAR-EKLAEKKELLQEQLEQLQRE  339
             K + E+ +  ++     K + ++     KA F+ + Q R E+  EKK+ L  Q+ +++ E
Sbjct  1538  KTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAE  1597

Query  340   YSKLKASCQESARIEDMRKR  359
                L+   ++ +     RK+
Sbjct  1598  ---LEDERKQRSMAMAARKK  1614


 Score = 41.4 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 50/314 (16%), Positives = 122/314 (39%), Gaps = 27/314 (9%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
               + + + + + E ++ + A+ Q  + ++ + EEL     +  + K  L    Q  +   
Sbjct  1510  MSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQF  1569

Query  105   ERL--------GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             ER           +K  L RQ  +   E+E  ++ +      +  ++  +  L   +  +
Sbjct  1570  ERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLKDLEAHIDTA  1629

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 E A K+ + L+ + +    +     + RE +  Q      +L+    S+EA +   
Sbjct  1630  NKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLK----SMEAEMIQL  1685

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++  +  +R   Q Q    +L  E  N      +  E KR ++                 
Sbjct  1686  QEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLE---------------AR  1730

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
               ++ ++L+EE    +++ + +     Q D    D   ER   +K    ++ L+ Q ++L
Sbjct  1731  IAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKEL  1790

Query  337   QREYSKLKASCQES  350
             + +  +++++ +  
Sbjct  1791  KAKLQEMESAVKSK  1804


 Score = 38.7 bits (88),  Expect = 0.11, Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 103/265 (39%), Gaps = 3/265 (1%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K  M  L   + + E +    +EN++   ++      L+E        +   ++E++ L 
Sbjct  1648  KDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELA  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +   +         EK  L+ +  Q   E+E  +   + + +       Q+  +  +L 
Sbjct  1708  DEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLN  1767

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD-QLRMQGQSVEAAL  213
               +S  +      Q LE + +    + +++ES  ++  +     ++ ++    + ++   
Sbjct  1768  LERSHAQKNENARQQLERQNKELKAKLQEMESAVKSKYKASIAALEAKIAQLEEQLDNET  1827

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA  273
             +  + A+ + +R   +L+    Q+  E  N           K   +L+ LK+QL++AEE 
Sbjct  1828  KERQAASKQVRRTEKKLKDVLLQVEDERRNA--EQFKDQADKASTRLKQLKRQLEEAEEE  1885

Query  274   LVAKQEVIDKLKEEAEQHKIVMETV  298
                      KL+ E E      + +
Sbjct  1886  AQRANASRRKLQRELEDATETADAM  1910


>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus OX=9986 
GN=MYH11 PE=2 SV=2
Length=1972

 Score = 58.7 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 52/355 (15%), Positives = 131/355 (37%), Gaps = 20/355 (6%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
             ++  ++    I++  Q      +EL        EEK  L  + Q   +L       ++ L
Sbjct  854   MQAKEDELQKIKERQQKAESELQELQQKHTQLSEEKNLLQEQLQAETELYAEAEEMRVRL  913

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
               +K++    +  ++   ++  +    ++A+   +  ++ + + +LE      Q L+   
Sbjct  914   AAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEK  973

Query  175   RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
               A  + ++LE +   +  Q++    + ++  +   + L        E+ + L +L+  +
Sbjct  974   VTAEAKIKKLEDDILVMDDQNNKLSKERKL-LEERISDLTTNLAEEEEKAKNLTKLKNKH  1032

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
               +  E +  +K      +    ++   +  +     E +   Q  I +LK +  + +  
Sbjct  1033  ESMISELEVRLKKEEKSRQELEKLK-RKMDGEASDLHEQIADLQAQIAELKMQLAKKEEE  1091

Query  295   ME------------------TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             ++                   +  L+      + D  +ER AR K  ++K  L E+LE L
Sbjct  1092  LQAALARLEDETSQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEAL  1151

Query  337   QREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
             + E      +      +   R++ V V +  L        + +    Q+ +   E
Sbjct  1152  KTELEDTLDTTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVE  1206


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 59/325 (18%), Positives = 121/325 (37%), Gaps = 13/325 (4%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQREE-KEFLMCKFQEARKLVERLGLEKLDLKRQ  117
             QELR    Q   +L++  +E      +Q +E ++      +E  + +E+    K +L + 
Sbjct  1166  QELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVEELTEQLEQFKRAKANLDKT  1225

Query  118   KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA  177
             K+   +E   L    + + + K  V+ +   L  +LQE QS+     +    L  +    
Sbjct  1226  KQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQLQELQSKCSDGERARAELNDKVHKL  1285

Query  178   SEQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
               +   +    SE E    + + +V  L  Q Q  +  L+ E +       KL QL+   
Sbjct  1286  QNEVESVTGMLSEAEGKAIKLAKEVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDER  1345

Query  235   HQLFQEYDNHIKSSVVGSERK---------RGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             + L ++ D  +++                    +L+D    ++  EE     Q+ I+ L 
Sbjct  1346  NSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVESLEEGKKRFQKEIESLT  1405

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             ++ E+     + +   K +      D   +   + +L    E  Q++ +QL  E   + +
Sbjct  1406  QQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISS  1465

Query  346   SCQESARIEDMRKRHVEVSQAPLPP  370
                +     +   R  E     L  
Sbjct  1466  KYADERDRAEAEAREKETKALSLAR  1490


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 115/299 (38%), Gaps = 22/299 (7%)

Query  74    ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE--QALREVEHLKRC  131
             +R ++L   +  QR    +L  +  +  +L  ++       ++++E      E++ +K  
Sbjct  808   KRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKIKER  867

Query  132   QQQMAEDKASVKAQVTSL-------LGELQESQSRLEAATKECQALEGRARAASE---QA  181
             QQ+   +   ++ + T L         +LQ        A +    L  + +   E   + 
Sbjct  868   QQKAESELQELQQKHTQLSEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM  927

Query  182   RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL----  237
                  E E   QQ   +  ++  Q   +E  L  E  A  + + +    +    +L    
Sbjct  928   EARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDI  987

Query  238   --FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE---EALVAKQEVIDKLKEEAEQHK  292
                 + +N +       E +      +L ++ ++A+   +     + +I +L+   ++ +
Sbjct  988   LVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEE  1047

Query  293   IVMETVPVLKAQADIYKADFQAERQ-AREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
                + +  LK + D   +D   +    + ++AE K  L ++ E+LQ   ++L+    + 
Sbjct  1048  KSRQELEKLKRKMDGEASDLHEQIADLQAQIAELKMQLAKKEEELQAALARLEDETSQK  1106


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 54/345 (16%), Positives = 134/345 (39%), Gaps = 13/345 (4%)

Query  39    LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ  98
             + L  E+ + + L++   +       + +    L+ +  EL    A + EE +  + + +
Sbjct  1041  VRLKKEEKSRQELEKLKRKMDGEASDLHEQIADLQAQIAELKMQLAKKEEELQAALARLE  1100

Query  99    EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
             +          +  +L+        +++  +  + +  + K  +  ++ +L  EL+++  
Sbjct  1101  DETSQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLD  1160

Query  159   RLEAATKECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
                   +     E       +A  E+ R  E++ + ++Q+H+  V++L  Q +  + A  
Sbjct  1161  TTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVEELTEQLEQFKRAKA  1220

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
                +     +++ A L      L Q      K  V   ++K  +QL++L+ +    E A 
Sbjct  1221  NLDKTKQTLEKENADLAGELRVLGQ-----AKQEVEHKKKKLEVQLQELQSKCSDGERAR  1275

Query  275   VAKQEVIDKLKEEAEQHKIVMETVP----VLKAQADIYKADFQAERQAREKLAEKKELLQ  330
                 + + KL+ E E    ++         L  +     +  Q  ++  ++   +K  + 
Sbjct  1276  AELNDKVHKLQNEVESVTGMLSEAEGKAIKLAKEVASLGSQLQDTQELLQEETRQKLNVS  1335

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
              +L QL+ E + L+    E    +   +RH+      L  +   L
Sbjct  1336  TKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKL  1380


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 64/333 (19%), Positives = 131/333 (39%), Gaps = 17/333 (5%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q++  ++ R E +      Q + K+F        ++ +E     + ++    +
Sbjct  1625  DLKDLELQADSAIKGREEAIKQLLKLQAQMKDF--------QRELEDARASRDEIFATAK  1676

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
             +  ++ + L+    Q+ ED A+ +        E +E    L ++     AL+   R    
Sbjct  1677  ENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEA  1736

Query  180   QARQLESEREALQQQHSVQVDQLR---MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQ  236
             +  QLE E E  Q       D++R    Q + +   L  ER  A + +    QL+    +
Sbjct  1737  RIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKE  1796

Query  237   L---FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKI  293
             L    QE +  +KS    +      ++  L++Q+   E+    KQ     LK+  ++ K 
Sbjct  1797  LKSKLQEMEGAVKSKFKSTIAALEAKIAQLEEQV---EQEAREKQAAAKALKQRDKKLKE  1853

Query  294   VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
             ++  V   +  A+ YK   +      ++L  + E  +E+ +++     KL+    E+   
Sbjct  1854  MLLQVEDERKMAEQYKEQAEKGNAKVKQLKRQLEEAEEESQRINANRRKLQRELDEATES  1913

Query  354   EDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRR  386
              +   R V   ++ L         P      RR
Sbjct  1914  NEAMGREVNALKSKLRRGNETSFVPTRRSGGRR  1946


 Score = 41.0 bits (94),  Expect = 0.026, Method: Composition-based stats.
 Identities = 56/325 (17%), Positives = 128/325 (39%), Gaps = 33/325 (10%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E LQ  L   ++       + + +RE    +   Q     E+       ++ R L E L
Sbjct  1089  EEELQAALARLEDETSQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEEL  1148

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR----LEAA  163
                K +L+   +    + E   + +Q++   K ++  +  S   ++QE + +    +E  
Sbjct  1149  EALKTELEDTLDTTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQVVEEL  1208

Query  164   TKECQALEGRARAASEQARQLESEREAL----------QQQHSVQVDQLRMQGQSVEAAL  213
             T++ +  +       +  + LE E   L          +Q+   +  +L +Q Q +++  
Sbjct  1209  TEQLEQFKRAKANLDKTKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQLQELQSKC  1268

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM--QLEDLKQ------  265
                 +A +E   K+ +LQ     +          ++  ++    +  QL+D ++      
Sbjct  1269  SDGERARAELNDKVHKLQNEVESVTGMLSEAEGKAIKLAKEVASLGSQLQDTQELLQEET  1328

Query  266   --------QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
                     +L+Q E+   + QE +D+  E  +  +  + T+ +  + +     DF     
Sbjct  1329  RQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFA---S  1385

Query  318   AREKLAEKKELLQEQLEQLQREYSK  342
               E L E K+  Q+++E L ++Y +
Sbjct  1386  TVESLEEGKKRFQKEIESLTQQYEE  1410


 Score = 39.8 bits (91),  Expect = 0.050, Method: Composition-based stats.
 Identities = 46/244 (19%), Positives = 95/244 (39%), Gaps = 3/244 (1%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             +EN++   ++      L+E        +     EKE L  +   +      L  EK  L+
Sbjct  1676  KENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLE  1735

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
              +  Q   E+E  +   + M++       Q   L  EL   +S  +      Q LE + +
Sbjct  1736  ARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNK  1795

Query  176   AASEQARQLESE-REALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
                 + +++E   +   +   +    ++    + VE   R ++ AA   K++  +L+   
Sbjct  1796  ELKSKLQEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAAAKALKQRDKKLKEML  1855

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
              Q+  E +  +         K   +++ LK+QL++AEE          KL+ E ++    
Sbjct  1856  LQV--EDERKMAEQYKEQAEKGNAKVKQLKRQLEEAEEESQRINANRRKLQRELDEATES  1913

Query  295   METV  298
              E +
Sbjct  1914  NEAM  1917


 Score = 34.4 bits (77),  Expect = 2.7, Method: Composition-based stats.
 Identities = 51/301 (17%), Positives = 116/301 (39%), Gaps = 9/301 (3%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
             L+  ++L   + +  +   +   E  +  +   +E++    + +E       L     + 
Sbjct  1436  LDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEA  1495

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
                KE+  R  + LK   + +   K  V   V  L    +  ++++E    + + LE   
Sbjct  1496  LEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDEL  1555

Query  175   RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM---ERQAASEEKRKLAQLQ  231
             +A  +   +LE   +AL+ Q    +     Q +     L+    E +   E++RK   L 
Sbjct  1556  QATEDAKLRLEVNMQALKVQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALA  1615

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGM---QLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
              A  +  +     ++     + + R     QL  L+ Q++  +  L   +   D++   A
Sbjct  1616  AAAKKKLEGDLKDLELQADSAIKGREEAIKQLLKLQAQMKDFQRELEDARASRDEIFATA  1675

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
             ++++   +++     Q      D  A  +AR++   +KE L E+L       + L+   +
Sbjct  1676  KENEKKAKSLEADLMQLQ---EDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKR  1732

Query  349   E  349
              
Sbjct  1733  R  1733


 Score = 32.9 bits (73),  Expect = 6.7, Method: Composition-based stats.
 Identities = 62/336 (18%), Positives = 133/336 (40%), Gaps = 42/336 (13%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             +G  E +++ L+   +++D  R+       R E     + ++++ K       Q      
Sbjct  1638  KGREEAIKQLLKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQ------  1691

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +    +R ++QA  E E L          + +++ +   L   + + +       
Sbjct  1692  --LQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE----L  1745

Query  165   KECQ----ALEGRARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVE  210
             +E Q    A+  R R A++QA QL +E           E+ +QQ   Q  +L+ + Q +E
Sbjct  1746  EEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELKSKLQEME  1805

Query  211   AALRMERQAA-SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
              A++ + ++  +  + K+AQL+    Q  +E     K+     ++ + M L+ ++ + + 
Sbjct  1806  GAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAAAKALKQRDKKLKEMLLQ-VEDERKM  1864

Query  270   AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL  329
             AE+     ++   K+K+   Q +   E    + A               R KL  + +  
Sbjct  1865  AEQYKEQAEKGNAKVKQLKRQLEEAEEESQRINAN--------------RRKLQRELDEA  1910

Query  330   QEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQ  365
              E  E + RE + LK+  +       +  R     +
Sbjct  1911  TESNEAMGREVNALKSKLRRGNETSFVPTRRSGGRR  1946


>sp|Q60902|EP15R_MOUSE Epidermal growth factor receptor substrate 
15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
Length=907

 Score = 58.3 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 39/191 (20%), Positives = 85/191 (45%), Gaps = 14/191 (7%)

Query  59   QELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +EL D  ++  Q+ RE+       +   RE++E +  K  E ++L   L  E   L+  +
Sbjct  382  KELDDISQEIAQLQREKY----SLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELE  437

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES---QSRLEAATKECQALEGRAR  175
             Q     + L    QQ A+ +  +         E Q     ++++++   + ++ E    
Sbjct  438  AQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQIQSQESDLKSQEDDLN  497

Query  176  AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY-  234
             A  +  +L+ E   L+Q     +   R Q +++  +L+  +   ++ + KL+QLQ ++ 
Sbjct  498  RAKSELNRLQQEETQLEQ----SIQAGRAQLETILRSLKCTQDDINQARSKLSQLQESHL  553

Query  235  --HQLFQEYDN  243
              H+  ++YD 
Sbjct  554  EAHRSLEQYDQ  564


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 75/163 (46%), Gaps = 9/163 (6%)

Query  135  MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
            ++++ A ++ +  SL  +++E +  +   T E Q L+      +   ++LE++++  Q  
Sbjct  387  ISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQD-  445

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
               ++D++  Q   +   L   RQ   +E + ++ L+       Q  ++ +KS      R
Sbjct  446  ---RLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQ----IQSQESDLKSQEDDLNR  498

Query  255  KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMET  297
             +  +L  L+Q+  Q E+++ A +  ++ +    +  +  +  
Sbjct  499  AKS-ELNRLQQEETQLEQSIQAGRAQLETILRSLKCTQDDINQ  540


 Score = 40.6 bits (93),  Expect = 0.027, Method: Composition-based stats.
 Identities = 31/156 (20%), Positives = 69/156 (44%), Gaps = 17/156 (11%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRE----------RCEELLHFQASQREEKEFLMCKF  97
             E +++   E QEL++ + +    L+E          R +E+   +A  R+    +  K 
Sbjct  409  EEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKC  468

Query  98   QEARKLVERLGLE----KLDLKRQKE---QALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
            Q+  + +  L  +    + DLK Q++   +A  E+  L++ + Q+ +   + +AQ+ ++L
Sbjct  469  QDETQTISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRAQLETIL  528

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLES  186
              L+ +Q  +  A  +   L+     A     Q + 
Sbjct  529  RSLKCTQDDINQARSKLSQLQESHLEAHRSLEQYDQ  564


>sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris OX=9615 
GN=MYH9 PE=2 SV=1
Length=1960

 Score = 58.3 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 59/344 (17%), Positives = 135/344 (39%), Gaps = 18/344 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R+       R  E+   Q+    EK  L  + Q   +L       +  L  +K++    
Sbjct  857   VREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEI  916

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                L+   ++  E    ++A+   +   +QE + +LE      Q L+        + ++L
Sbjct  917   CHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKL  976

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E ++  ++ Q+     + ++  +   A          E+ + LA+L+  +  +  + +  
Sbjct  977   EEDQIIMEDQNCKLAKEKKL-LEDRIAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEER  1035

Query  245   IKSSVVGSERKRG-------------MQLEDLKQQLQQAEEALVAKQEVIDK----LKEE  287
             ++      +                  Q+ +L+ Q+ + +  L  K+E +      ++EE
Sbjct  1036  LRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAKKEEELQAALARVEEE  1095

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
             A Q  + ++ +  L++Q    + D ++ER +R K  ++K  L E+LE L+ E      S 
Sbjct  1096  ATQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDST  1155

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                  +   R++ V + +  L        + +    Q+ S   E
Sbjct  1156  AAQQELRSKREQEVNILKKTLEEEARTHEAQIQEMRQKHSQAVE  1199


 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 54/345 (16%), Positives = 136/345 (39%), Gaps = 21/345 (6%)

Query  54    CLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLD  113
             CLE  +E +  +++  + L +R EE +       + K  L  +  +    ++       +
Sbjct  1379  CLETAEEAKRKLQKDLEGLGQRYEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRRTASN  1438

Query  114   LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGR  173
             L++++++  + +   K    + AE++   +A+      +       LE A ++   LE  
Sbjct  1439  LEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERL  1498

Query  174   ARAASEQARQLESEREALQQQ----------HSVQVDQLRMQGQSVEAALRMERQAASEE  223
              +    +   L S ++ + +              QV++++ Q + +E  L+    A    
Sbjct  1499  NKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRL  1558

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             +  L  ++  + +  Q  D   +       R+      +L+ + +Q   A+ A++++   
Sbjct  1559  EVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDEKKQRSMAVAARKKLEMD  1618

Query  284   LKEEAE-------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             LK+               ++ +  L+AQ      +    R +RE++  + +  +++++ +
Sbjct  1619  LKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCVRELDDTRASREEILAQAKENEKKMKSM  1678

Query  337   QREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             + E  +L+     + R     KR  +  +  L    A  S   AL
Sbjct  1679  EAEMIQLQEELAAAER----AKRQAQQERDELADEIANSSGKGAL  1719


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 65/326 (20%), Positives = 134/326 (41%), Gaps = 28/326 (9%)

Query  47    APETLQRCLEENQELRDA---IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             A E   R   + QEL +    +    +   ERC+ L   +   ++  + L  + +E    
Sbjct  899   AEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESA  958

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
              ++L LEK+  + + ++   +   ++    ++A++K  ++ ++      L E + + ++ 
Sbjct  959   RQKLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKSL  1018

Query  164   TKECQALEGRARAASEQARQLESEREALQQ-----------------QHSVQVDQLRMQG  206
              K     E       E+ R+ E +R+ L++                 +   Q+ +L+MQ 
Sbjct  1019  AKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQL  1078

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
                E  L+       EE  +         +  +E ++ I       E +R  + +  KQ+
Sbjct  1079  AKKEEELQAALARVEEEATQKNMAL----KKIRELESQISELQEDLESERASRNKAEKQK  1134

Query  267   LQQAEEALVAKQEVIDKLKEEAEQHK---IVMETVPVLKAQADIYKADFQAE-RQAREKL  322
                 EE    K E+ D L   A Q +      + V +LK   +      +A+ ++ R+K 
Sbjct  1135  RDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEARTHEAQIQEMRQKH  1194

Query  323   AEKKELLQEQLEQLQREYSKLKASCQ  348
             ++  E L EQLEQ +R  + L+ + Q
Sbjct  1195  SQAVEELAEQLEQTKRVKANLEKAKQ  1220


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 55/328 (17%), Positives = 134/328 (41%), Gaps = 13/328 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   +T ++   ++ +L D I +    L+ +  EL    A + EE +  + + +E     
Sbjct  1044  QELEKTRRKLEGDSTDLNDQIAE----LQAQIAELKMQLAKKEEELQAALARVEEEATQK  1099

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
                  +  +L+ Q  +   ++E  +  + +  + K  +  ++ +L  EL+++     A  
Sbjct  1100  NMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQ  1159

Query  165   KECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             +     E       +   E+AR  E++ + ++Q+HS  V++L  Q +  +       +A 
Sbjct  1160  ELRSKREQEVNILKKTLEEEARTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAK  1219

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                + +  +L      L Q   +          +K   QL++L+ +  + E       + 
Sbjct  1220  QTLENERGELANEVKVLQQGKGDS-----EHKRKKAEAQLQELQVKFTEGERVRTELADK  1274

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREY  340
             + KL+ E +    ++       ++     +  +++ Q  ++L +++   +  L    ++ 
Sbjct  1275  VTKLQVELDNVMGLLTQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQM  1334

Query  341   SKLKASCQESARIEDMRKRHVEVSQAPL  368
                K S +E    E+  KR++E   A L
Sbjct  1335  EDEKNSFKEQLEEEEEAKRNLEKQIATL  1362


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 122/300 (41%), Gaps = 20/300 (7%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
               + + + + + E ++ + A+ Q  + ++ + EEL     +  + K  L    Q  +   
Sbjct  1510  MSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQF  1569

Query  105   ERL--------GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             ER           +K  L RQ  +   E+E  K+ +      +  ++  +  L   +  +
Sbjct  1570  ERDLQGRDEQSEEKKKQLVRQVREMEAELEDEKKQRSMAVAARKKLEMDLKDLEAHIDSA  1629

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 + A K+ + L+ + +    +      +  A +++   Q  +   + +S+EA +   
Sbjct  1630  NKNRDEAIKQLRKLQAQMKDCVREL----DDTRASREEILAQAKENEKKMKSMEAEMIQL  1685

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++  +  +R   Q Q    +L  E  N      +  E KR ++   + Q  ++ EE    
Sbjct  1686  QEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEAR-IAQLEEELEEEQGN  1744

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
              + V D+LK+   Q   +   + + ++ A       Q    AR++L  + + L+ +L+++
Sbjct  1745  TELVNDRLKKANLQIDQINTDLNLERSHA-------QKNENARQQLERQNKELKVKLQEM  1797


 Score = 41.7 bits (96),  Expect = 0.012, Method: Composition-based stats.
 Identities = 54/260 (21%), Positives = 111/260 (43%), Gaps = 19/260 (7%)

Query  93    LMCKFQEARKLVERLGLEKLDLKRQKEQALRE-------VEHLKRCQQQMAEDKASVKAQ  145
             L  + Q+ ++L++    +KL L  + +Q   E       +E  +  ++ + +  A++ AQ
Sbjct  1306  LESQLQDTQELLQEENRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKRNLEKQIATLHAQ  1365

Query  146   VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ  205
             VT +  ++++    LE A +  + L+       E   Q   E+ A   +      +L+ +
Sbjct  1366  VTDMKKKMEDGVGCLETAEEAKRKLQKDL----EGLGQRYEEKVAAYDKLEKTKTRLQQE  1421

Query  206   GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
                +   L  +R+ AS  ++K    Q  + QL  E            +R      E   +
Sbjct  1422  LDDLLVDLDHQRRTASNLEKK----QKKFDQLLAEEKTISAKYAEERDRAEAEAREKETK  1477

Query  266   QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK  325
              L  A  AL    E   +L+   +Q +  ME +  + ++ D+ K+  + E+  R  L ++
Sbjct  1478  ALSLA-RALEEAMEQKAELERLNKQFRTEMEDL--MSSKDDVGKSVHELEKSKR-ALEQQ  1533

Query  326   KELLQEQLEQLQREYSKLKA  345
              E ++ QLE+L+ E    + 
Sbjct  1534  VEEMKTQLEELEDELQATED  1553


 Score = 41.4 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 54/314 (17%), Positives = 126/314 (40%), Gaps = 26/314 (8%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF------LMCK  96
             + +   E +++  +   +++D +R+ +     R E L   + ++++ K        L  +
Sbjct  1629  ANKNRDEAIKQLRKLQAQMKDCVRELDDTRASREEILAQAKENEKKMKSMEAEMIQLQEE  1688

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
                A +   +   E+ +L  +   +  +       ++++    A ++ ++    G  +  
Sbjct  1689  LAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELV  1748

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               RL+ A  +   +          A++ E+ R    QQ   Q  +L+++ Q +E  ++ +
Sbjct  1749  NDRLKKANLQIDQINTDLNLERSHAQKNENAR----QQLERQNKELKVKLQEMEGTVKSK  1804

Query  217   RQAA-SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
              +A+ +  + K+AQL+       +E     K  V  +E+K    L  +  + + AE+   
Sbjct  1805  YKASITALEAKIAQLEEQLDNETKERQAACKQ-VRRAEKKLKDVLLQVDDERRNAEQFKD  1863

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
                +   +LK+              LK Q +  + + Q    +R KL  + E   E  + 
Sbjct  1864  QADKASTRLKQ--------------LKRQLEEAEEEAQRANASRRKLQRELEDATETADA  1909

Query  336   LQREYSKLKASCQE  349
             + RE S LK   + 
Sbjct  1910  MNREVSSLKNKLRR  1923


 Score = 36.0 bits (81),  Expect = 0.78, Method: Composition-based stats.
 Identities = 41/265 (15%), Positives = 101/265 (38%), Gaps = 3/265 (1%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K  +  L   + + E +    +EN++   ++      L+E        +   ++E++ L 
Sbjct  1648  KDCVRELDDTRASREEILAQAKENEKKMKSMEAEMIQLQEELAAAERAKRQAQQERDELA  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +   +         EK  L+ +  Q   E+E  +   + + +       Q+  +  +L 
Sbjct  1708  DEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELVNDRLKKANLQIDQINTDLN  1767

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD-QLRMQGQSVEAAL  213
               +S  +      Q LE + +    + +++E   ++  +     ++ ++    + ++   
Sbjct  1768  LERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNET  1827

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA  273
             +  + A  + +R   +L+    Q+  E  N           K   +L+ LK+QL++AEE 
Sbjct  1828  KERQAACKQVRRAEKKLKDVLLQVDDERRNA--EQFKDQADKASTRLKQLKRQLEEAEEE  1885

Query  274   LVAKQEVIDKLKEEAEQHKIVMETV  298
                      KL+ E E      + +
Sbjct  1886  AQRANASRRKLQRELEDATETADAM  1910


>sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec 
PE=1 SV=2
Length=4687

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 52/252 (21%), Positives = 112/252 (44%), Gaps = 22/252 (9%)

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             +QK+ A  E+E  K+  +Q    KA V+ ++T+L  +L+E+  +     +E Q L+    
Sbjct  2298  KQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVT  2357

Query  176   AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
              A+ Q  Q+E E  +++    VQ+++L      +EA  R       +  ++  + +    
Sbjct  2358  EAARQRSQVEEELFSVR----VQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKM  2413

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
             +   E    +  +   + R R +  EDL QQ   AE+ L  K + + +      + +++ 
Sbjct  2414  KQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQ  2473

Query  296   ETVPVLKAQADIYKAD------------------FQAERQAREKLAEKKELLQEQLEQLQ  337
             +   + + QA   +AD                   +AERQ + +++ + E L+ ++ ++ 
Sbjct  2474  QQKELAQEQARRLQADKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMS  2533

Query  338   REYSKLKASCQE  349
             R  ++ +   Q 
Sbjct  2534  RAQARAEEDAQR  2545


 Score = 57.2 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 56/303 (18%), Positives = 125/303 (41%), Gaps = 7/303 (2%)

Query  63    DAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL  122
             +++ Q    LR R  EL    +   +     + + +E  +L E+   E+ +   + E AL
Sbjct  1450  ESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAAL  1509

Query  123   REVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
              +   L    +  A+ KA  + +   L   +QE  +R E A  + Q  +   +   +  R
Sbjct  1510  EKQRQLA---EAHAQAKAQAELEARELQRRMQEEVTRREEAAVDAQQQKRSIQEELQHLR  1566

Query  183   QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
             Q        + Q     ++ RM+ +     +R++ +    ++        A     +E +
Sbjct  1567  QSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEDELQALRARAEEAE  1626

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                + +   +ER R  Q++D  Q+ +QAE  L  + +   +   E ++    ++ + +  
Sbjct  1627  AQKRQAQEEAERLRR-QVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELKLQA  1685

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVE  362
              +A+ +    +AER  + ++A +      ++E LQ +         +  R   +++ HV 
Sbjct  1686  EEAERWLCQAEAERARQVQVALETAQRSAEVE-LQSKRPSFAEKTAQLER--TLQEEHVT  1742

Query  363   VSQ  365
             V+Q
Sbjct  1743  VTQ  1745


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 63/311 (20%), Positives = 134/311 (43%), Gaps = 26/311 (8%)

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL-  160
             + ++RL  E  +  RQ+ Q   E+  ++   +++ + KA ++A+  +L+   +++  R  
Sbjct  2347  EELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFL  2406

Query  161   -EAATKECQALEGRAR---AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
              E A K  Q  E  AR   AA E AR  +   E L QQ ++    L+ + Q+V+ A R+ 
Sbjct  2407  EEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL-  2465

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             +  A   +++    Q    +L  + +   +  V  ++  +     + ++QL+ + EA   
Sbjct  2466  KAEAELLQQQKELAQEQARRLQADKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERL  2525

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA--------------REKL  322
             K   + ++     + +   +     + QA+           A              R++ 
Sbjct  2526  K-LRMAEMSRAQARAEEDAQR---FRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQS  2581

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESA-RIEDMRK-RHVEVSQAPLPPAPAYLSSPLA  380
              +  E L+E + +L+RE  KLK   +    + E+M+  +  ++ Q       ++LS   +
Sbjct  2582  DQDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDS  2641

Query  381   LPSQRRSPPEE  391
             L  + R   +E
Sbjct  2642  LLQRERFIEQE  2652


 Score = 51.8 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 58/299 (19%), Positives = 128/299 (43%), Gaps = 14/299 (5%)

Query  67    QSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVE  126
             ++N+ LR R +     Q     + +    K +  R+   R   E+  ++ Q+E A +E+E
Sbjct  1777  KANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVR-QRELAEQELE  1835

Query  127   HLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES  186
               ++  +  A+ + + + ++  L  E ++ + + +   +E   L+  A AA+++ ++LE+
Sbjct  1836  KQRQLTEGTAQQRLAAEQELIRLRAETEQGEHQRQLLEEELARLQHEATAATQKRQELEA  1895

Query  187   EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK---RKLAQLQVAYHQLFQEYDN  243
             E   ++ +  V +       +   +     +Q    E    R+LA+       L +E   
Sbjct  1896  ELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEARR  1955

Query  244   HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKA  303
             H + +   + R+R      L ++L    EA   K E    LKE+  +++        L+ 
Sbjct  1956  HRELAEEDAARQRAEADGVLTEKLAAISEATRLKTEAEIALKEKEAENER-------LRR  2008

Query  304   QADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVE  362
              A+    +    R+  E+ A+ K  ++E+L QL++         +        ++R VE
Sbjct  2009  LAE---DEAFQRRRLEEQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVE  2064


 Score = 43.7 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 61/265 (23%), Positives = 110/265 (42%), Gaps = 31/265 (12%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ----EARKLV  104
             ETL+R  EE +       Q     RER  E+      QR+  E           EAR+L 
Sbjct  1479  ETLRRMEEEER----LAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEARELQ  1534

Query  105   ERLGLEKL-------DLKRQKEQALREVEHLKRCQQQMAEDKAS-----------VKAQV  146
              R+  E         D ++QK     E++HL++  +   + KA            ++ ++
Sbjct  1535  RRMQEEVTRREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEI  1594

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG  206
               +  +L+ ++ +   A  E QAL  RA  A  Q RQ + E E L++Q   +  + R   
Sbjct  1595  RVVRLQLETTERQRGGAEDELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAE  1654

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ-  265
               +   ++ E +AA E++R L  L     Q  +E +  +  +     R+  + LE  ++ 
Sbjct  1655  AELALRVKAEAEAAREKQRALQALDELKLQ-AEEAERWLCQAEAERARQVQVALETAQRS  1713

Query  266   ---QLQQAEEALVAKQEVIDKLKEE  287
                +LQ    +   K   +++  +E
Sbjct  1714  AEVELQSKRPSFAEKTAQLERTLQE  1738


 Score = 41.7 bits (96),  Expect = 0.013, Method: Composition-based stats.
 Identities = 43/243 (18%), Positives = 106/243 (44%), Gaps = 9/243 (4%)

Query  49    ETLQRCLEENQELRDAIR-QSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E LQ+  E  QE    ++    Q+ ++  EE   FQ +   E+     +  E     ERL
Sbjct  2470  ELLQQQKELAQEQARRLQADKEQMAQQLVEETQGFQRTLEAER----QRQLEMSAEAERL  2525

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              L   ++ R + +A  + +  ++  +++ E     +      +  +Q  + + + + ++ 
Sbjct  2526  KLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDQDA  2585

Query  168   QALEGRARAASEQARQLESEREALQ----QQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             + L         +  +L+ E + LQ    +  +VQ +Q+  + Q+++ +   E+ +  + 
Sbjct  2586  ERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQR  2645

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             +R + Q +    QLFQ+     K      +R++    ++ ++ +   EEA   ++E  + 
Sbjct  2646  ERFIEQEKAKLEQLFQDEVAKAKQLQEEQQRQQQQMEQEKQELVASMEEARRRQREAEEG  2705

Query  284   LKE  286
             ++ 
Sbjct  2706  VRR  2708


 Score = 41.0 bits (94),  Expect = 0.027, Method: Composition-based stats.
 Identities = 48/256 (19%), Positives = 115/256 (45%), Gaps = 13/256 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E +++  EE   L  A +++ ++ +   E+L    A QR   E ++ +  +A +   RL 
Sbjct  2411  EKMKQVAEEAARLSVAAQEAARLRQLAEEDL----AQQRALAEKMLKEKMQAVQEATRLK  2466

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E   L++QKE A  +   L+  ++QMA+    +  +       L+  + R    + E +
Sbjct  2467  AEAELLQQQKELAQEQARRLQADKEQMAQ---QLVEETQGFQRTLEAERQRQLEMSAEAE  2523

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLR------MQGQSVEAALRMERQAASE  222
              L+ R    S    + E + +  ++Q     ++L        +  ++   L ++RQ + +
Sbjct  2524  RLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDQ  2583

Query  223   EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
             +  +L +      +  ++     K   + SE  + +Q E + Q+ Q  +++ +++++ + 
Sbjct  2584  DAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLL  2643

Query  283   KLKEEAEQHKIVMETV  298
             + +   EQ K  +E +
Sbjct  2644  QRERFIEQEKAKLEQL  2659


 Score = 39.8 bits (91),  Expect = 0.061, Method: Composition-based stats.
 Identities = 65/373 (17%), Positives = 143/373 (38%), Gaps = 43/373 (12%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             +E  A E  +R  EE     +A   + Q  R   EEL H + S   E +    + + A +
Sbjct  1526  AELEARELQRRMQEEVTRREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAER  1585

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                R+  E   ++ Q E   R+              +   + ++ +L    +E++++   
Sbjct  1586  SRMRIEEEIRVVRLQLETTERQ--------------RGGAEDELQALRARAEEAEAQKRQ  1631

Query  163   ATKECQALEGRARAASEQARQ----------LESEREALQQQHSVQVDQLRMQGQ-----  207
             A +E + L  + +  S++ RQ           E+E    +Q+    +D+L++Q +     
Sbjct  1632  AQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELKLQAEEAERW  1691

Query  208   --SVEAALRMERQAASEEKRKLAQLQVAYHQ-LFQEYDNHIKSSVVG----------SER  254
                 EA    + Q A E  ++ A++++   +  F E    ++ ++               
Sbjct  1692  LCQAEAERARQVQVALETAQRSAEVELQSKRPSFAEKTAQLERTLQEEHVTVTQLREEAE  1751

Query  255   KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
             +R  Q  + ++  ++AE  L   Q   ++      Q + V +   + +A A+  K + + 
Sbjct  1752  RRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAER  1811

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAY  374
             E + R K AE++ + Q +L + + E  +         R+   ++     ++         
Sbjct  1812  EARRRGK-AEEQAVRQRELAEQELEKQRQLTEGTAQQRLAAEQELIRLRAETEQGEHQRQ  1870

Query  375   LSSPLALPSQRRS  387
             L        Q  +
Sbjct  1871  LLEEELARLQHEA  1883


 Score = 37.1 bits (84),  Expect = 0.35, Method: Composition-based stats.
 Identities = 60/313 (19%), Positives = 127/313 (41%), Gaps = 43/313 (14%)

Query  12    EMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ-  70
             + VQ +    A+ ++L ++  L +     L +++   +  Q+ +EE Q  +  +    Q 
Sbjct  2457  QAVQEATRLKAEAELLQQQKELAQEQARRLQADK--EQMAQQLVEETQGFQRTLEAERQR  2514

Query  71    ---------ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLD-------L  114
                       L+ R  E+   QA   E+ +    + +E  + + R  L   +       L
Sbjct  2515  QLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTL  2574

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS-RLEAATKECQALEGR  173
             + Q++Q+ ++ E L+    ++  +K  +K +   L  + +E Q+ + E   +E QAL+  
Sbjct  2575  EIQRQQSDQDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKS  2634

Query  174   ARAASEQA----RQLESEREALQQQHSVQVDQLRMQ------------------GQSVEA  211
               +  +      R +E E+  L+Q    +V + +                      S+E 
Sbjct  2635  FLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLQEEQQRQQQQMEQEKQELVASMEE  2694

Query  212   ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
             A R +R+A    +RK  +LQ    Q  Q+     + +    ER + ++ E+ +  L  +E
Sbjct  2695  ARRRQREAEEGVRRKQEELQRLEQQRQQQEKLLAEENQRLRERLQRLE-EEHRAALAHSE  2753

Query  272   EALVAKQEVIDKL  284
             E   ++      L
Sbjct  2754  EIATSQAAATKAL  2766


 Score = 35.2 bits (79),  Expect = 1.4, Method: Composition-based stats.
 Identities = 70/370 (19%), Positives = 133/370 (36%), Gaps = 28/370 (8%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   L + S QGA E L+      + L++A  Q+     +  E         R + E   
Sbjct  1229  KTISLVIRSTQGAEEVLK---THEEHLKEA--QAVPATLQELEVTKASLKKLRAQAEAQQ  1283

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
               F   R  +         L+++  +   EVE  +    Q+ E   +V AQ      EL+
Sbjct  1284  PVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELE  1343

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQ-------QHSVQVDQLRMQGQ  207
             +   +L    +    L    + A  +  Q+++   A  Q       Q    ++++   G+
Sbjct  1344  QLGRQLRYYRESADPLSSWLQDAKSRQEQIQAVPIANSQAAREQLRQEKALLEEIERHGE  1403

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              VE   +  +Q  +  K    QL     QL        K  V         +  DL+ + 
Sbjct  1404  KVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRY  1463

Query  268   Q------------QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                           +E     ++E     ++ AE+ + + E    L+ Q  +  A+  A+
Sbjct  1464  SELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQL--AEAHAQ  1521

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
              +A+ +L  ++   + Q E  +RE + + A  Q+ +  E+++  H+  S      A A  
Sbjct  1522  AKAQAELEARELQRRMQEEVTRREEAAVDAQQQKRSIQEELQ--HLRQSSEAEIQAKAQQ  1579

Query  376   SSPLALPSQR  385
                      R
Sbjct  1580  VEAAERSRMR  1589


 Score = 33.7 bits (75),  Expect = 4.5, Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 89/239 (37%), Gaps = 11/239 (5%)

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
              +  RQ++ AL EVE LK   ++    +   + +    L   QE+  +   A ++  A  
Sbjct  2138  EEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFV  2197

Query  172   GRARAASEQARQLES----EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
              + R    Q    +     ER   + + + +  +   + +        + +   EE  +L
Sbjct  2198  VQQREEELQQTLQQEQNMLERLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERL  2257

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
              Q      Q   +     +     +E++   + +  +  L+Q + A    ++     ++ 
Sbjct  2258  KQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQT  2317

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
               Q   V + +  L+ Q +            +  L E+ + L+ ++ +  R+ S+++  
Sbjct  2318  LRQKAQVEQELTTLRLQLE-------ETDHQKSILDEELQRLKAEVTEAARQRSQVEEE  2369


>sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm 
OS=Chlamydomonas reinhardtii OX=3055 GN=ODA11 PE=3 SV=2
Length=4499

 Score = 58.3 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 59/369 (16%), Positives = 136/369 (37%), Gaps = 30/369 (8%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFL----------  93
                 P+T    ++  + +  A R++NQ   ER E  LH     + + + L          
Sbjct  2929  NYTTPKTFLELIKLYKNVLAAKRKANQDNTERLENGLHKLHKVQADVDILVEEAKVKAVE  2988

Query  94    -MCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGE  152
                K   A    E++G+EK  +  +   A  E E      ++++E +AS +  + +    
Sbjct  2989  VEHKVASANIFAEQVGVEKEKVNAENAAAQVEAEKCAVIAKEVSEKQASCEKDLAAAEPL  3048

Query  153   LQESQSRLEAATK----ECQALEGRARAASE--------QARQLESEREALQQQHSVQVD  200
             + E+ + LE  TK    E ++L+       +             + +     Q+    VD
Sbjct  3049  VAEAMAALETVTKKDLGEAKSLKKPPPGVDDITAVVIILLENNPKDKSWQAAQKLMNNVD  3108

Query  201   QLRMQGQSVEAALRMER--QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
             +   + +S ++ +   +  +   +  R    L+    +   +           +     +
Sbjct  3109  KFLERVKSFKSVIDAGQVARKTVDACRPYLALEWFNREAIGKKSAAAAGLCEWA--VNII  3166

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             +  D+ Q+++   + L A    +++        +   E V +L A+    +  ++     
Sbjct  3167  KYYDVVQEVEPKRQELAAANAKLEEANVTLAAVE---EKVALLNAKVQELEQQYKEANDD  3223

Query  319   REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSP  378
             +E    + E  Q +LE   R  + L +  +  A   +  ++  EV    +  A A++S  
Sbjct  3224  KEAAIRESERCQRKLELANRLINALASEGERWALTVEQLRKSYEVLTGDMLLAAAFVSYA  3283

Query  379   LALPSQRRS  387
                 ++ R+
Sbjct  3284  GPFTAKFRA  3292


>sp|Q5T1M5|FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens 
OX=9606 GN=FKBP15 PE=1 SV=2
Length=1219

 Score = 57.9 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 56/314 (18%), Positives = 133/314 (42%), Gaps = 41/314 (13%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQR---EEKEFLMCK--------FQE  99
            +QR ++EN+ L+  I + +  + E+ +++       +   E+   +M K         + 
Sbjct  567  IQRIIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSNLMMEKRNNSLQTATEN  626

Query  100  ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGE  152
             +  V     EK  +  +   A  +V HL+       + +  ++ Q+T        L G+
Sbjct  627  TQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQMQLTESLKETDLLRGQ  686

Query  153  LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
            L + Q++L    +  +  + + ++  +  +QLE +  +L+++ +     LR++ +S+E  
Sbjct  687  LTKVQAKLSELQETSEQAQSKFKSEKQNRKQLELKVTSLEEELT----DLRVEKESLEKN  742

Query  213  LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS----SVVGSERKRGMQLEDLKQQLQ  268
            L   ++ +++E+ +  +      + +QE  + ++     + V +++    QL  ++ +LQ
Sbjct  743  LSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLKKTRVSTDQAAAEQLSLVQAELQ  802

Query  269  QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKEL  328
               EA              A      ++    + AQ D Y       +Q   +L EK   
Sbjct  803  TQWEAKCEHLL--------ASAKDEHLQQYQEVCAQRDAY-------QQKLVQLQEKCLA  847

Query  329  LQEQLEQLQREYSK  342
            LQ Q+  L ++  +
Sbjct  848  LQAQITALTKQNEQ  861


 Score = 56.0 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 109/268 (41%), Gaps = 6/268 (2%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            +     T  R L   QE      +      +     L   A Q++E E  M    E+ K 
Sbjct  621  QTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQMQ-LTESLKE  679

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
             + L  +   ++ +  +     E  +   +   +++  ++ +VTSL  EL + +   E+ 
Sbjct  680  TDLLRGQLTKVQAKLSELQETSEQAQSKFKSEKQNRKQLELKVTSLEEELTDLRVEKESL  739

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             K    L  R + ++++  Q E E + +++ +  ++D+LR   +     +  ++ AA + 
Sbjct  740  EK---NLSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLKKTR--VSTDQAAAEQL  794

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
                A+LQ  +    +      K   +   ++   Q +  +Q+L Q +E  +A Q  I  
Sbjct  795  SLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDAYQQKLVQLQEKCLALQAQITA  854

Query  284  LKEEAEQHKIVMETVPVLKAQADIYKAD  311
            L ++ EQH   +E      +  +   +D
Sbjct  855  LTKQNEQHIKELEKNKSQMSGVEAAASD  882


 Score = 49.5 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 98/257 (38%), Gaps = 10/257 (4%)

Query  39   LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ  98
            L + + Q     LQ  L E+ +  D +R     ++ +  EL       + + +      +
Sbjct  657  LKMTAHQKKETELQMQLTESLKETDLLRGQLTKVQAKLSELQETSEQAQSKFKSEKQNRK  716

Query  99   EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            +    V  L  E  DL+ +KE   +    L   +++ A++++  + ++  +    QE   
Sbjct  717  QLELKVTSLEEELTDLRVEKESLEKN---LSERKKKSAQERSQAEEEIDEIRKSYQEELD  773

Query  159  RLEAATKECQ--ALEGRARAASEQARQLESEREALQQQHSVQV-DQLRMQGQSVEAALRM  215
            +L    K+ +    +  A   S    +L+++ EA  +       D+   Q Q V A    
Sbjct  774  KLRQLLKKTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDA  833

Query  216  ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
             +Q   + + K   LQ     L ++ + HIK       +  G++          +E+   
Sbjct  834  YQQKLVQLQEKCLALQAQITALTKQNEQHIKELEKNKSQMSGVE----AAASDPSEKVKK  889

Query  276  AKQEVIDKLKEEAEQHK  292
               +V   L+ E E  +
Sbjct  890  IMNQVFQSLRREFELEE  906


>sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens 
OX=9606 GN=MYO5C PE=1 SV=2
Length=1742

 Score = 57.9 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 53/261 (20%), Positives = 113/261 (43%), Gaps = 26/261 (10%)

Query  86    QREEKEFL-MCKFQEARKLVERLGL--EKLDLKRQKEQALREVEHLKRCQQQMAEDKASV  142
             Q+  + +L   +FQ  R+ V  + L      L+++ E   +E   L      +A  +A  
Sbjct  863   QKYARAWLARRRFQSIRRFVLNIQLTYRVQRLQKKLEDQNKENHGLVEKLTSLAALRAGD  922

Query  143   KAQVTSLLGELQESQSRLEAATKE----CQALEGRARAASEQARQLESEREALQQQHSVQ  198
               ++  L  EL+++ +      ++      A+E +     +   +LE+++E +Q +   +
Sbjct  923   VEKIQKLEAELEKAATHRRNYEEKGKRYRDAVEEKLAKLQKHNSELETQKEQIQLKLQEK  982

Query  199   VDQLRMQGQSVEAAL-----RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE  253
              ++L+ +  ++   L     + ERQ    EK         +    Q+Y+  I+S     +
Sbjct  983   TEELKEKMDNLTKQLFDDVQKEERQRMLLEKS--------FELKTQDYEKQIQSLKEEIK  1034

Query  254   --RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQ-ADIYKA  310
               +   MQL+ L +      + L A+   + K  +   + +  +E   +L+AQ  D+ K 
Sbjct  1035  ALKDEKMQLQHLVEGEHVTSDGLKAEVARLSKQVKTISEFEKEIE---LLQAQKIDVEKH  1091

Query  311   DFQAERQAREKLAEKKELLQE  331
                 +R+ REK++E  + L E
Sbjct  1092  VQSQKREMREKMSEITKQLLE  1112


 Score = 42.5 bits (98),  Expect = 0.009, Method: Composition-based stats.
 Identities = 26/178 (15%), Positives = 78/178 (44%), Gaps = 8/178 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + +    ++ Q+L   + +  + ++ + EEL + Q  + +E+E    K  EA+  +    
Sbjct  1216  QQISELEKQKQDLEIRLNEQAEKMKGKLEELSN-QLHRSQEEEGTQRKALEAQNEIHT--  1272

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              EK  L  + ++     +HLK+  +  +E K + + + + L  E ++ +  L+   +  +
Sbjct  1273  KEKEKLIDKIQEMQEASDHLKKQFETESEVKCNFRQEASRLTLENRDLEEELDMKDRVIK  1332

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
              L+ + +  S+   +      +   +  + + Q + + ++     ++ +    + K +
Sbjct  1333  KLQDQVKTLSKTIGKANDVHSSSGPKEYLGMLQYKREDEA-----KLIQNLILDLKPR  1385


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 74/182 (41%), Gaps = 8/182 (4%)

Query  77    EELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMA  136
             +E+ H Q   REE + +    +     +    +   D K+Q  +  ++ + L   + ++ 
Sbjct  1178  QEINHLQKLFREEND-INESIRHEVTRLTSENMMIPDFKQQISELEKQKQDL---EIRLN  1233

Query  137   EDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHS  196
             E    +K ++  L  +L  SQ   E    + +ALE +    +++  +L  + + +Q+   
Sbjct  1234  EQAEKMKGKLEELSNQLHRSQ---EEEGTQRKALEAQNEIHTKEKEKLIDKIQEMQEASD  1290

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
                 Q   + + V+   R E    + E R L +      ++ ++  + +K+      +  
Sbjct  1291  HLKKQFETESE-VKCNFRQEASRLTLENRDLEEELDMKDRVIKKLQDQVKTLSKTIGKAN  1349

Query  257   GM  258
              +
Sbjct  1350  DV  1351


>sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle 
OS=Cyprinus carpio OX=7962 PE=2 SV=2
Length=1935

 Score = 57.9 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 54/325 (17%), Positives = 134/325 (41%), Gaps = 13/325 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  +   ++ L    ERCE L+  +     + +    + ++  ++ 
Sbjct  875   EEKMVSLLQEKNDLQLQVTAESENLSDAEERCEGLIKSKIQLEAKLKETNERLEDEEEIN  934

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  935   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDESIAKLT  994

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  995   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1050

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE--DLKQQLQQAEEALVAKQEVID  282
             R   +L+       +   +         E+ +    E   L  +++  +      Q+ I 
Sbjct  1051  RAKRKLEGDLKLAQESIMDLENEKQQSDEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIK  1110

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
             +L+   E+ +  +E     +A+ +  +AD   E    E+++E+ E              K
Sbjct  1111  ELQARIEELEEEIEAERAARAKVEKQRADLSRE---LEEISERLEEAGGATAAQIEMNKK  1167

Query  343   LKASCQESAR-IEDMRKRHVEVSQA  366
              +A  Q+  R +E+   +H   + A
Sbjct  1168  REAEFQKMRRDLEESTLQHEATAAA  1192


 Score = 45.6 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 51/328 (16%), Positives = 120/328 (37%), Gaps = 16/328 (5%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
                 E K+ L  + Q+A + +E +  +   L++ K++   EVE L    ++     A++ 
Sbjct  1385  EELEEAKKKLAQRLQDAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLD  1444

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAAS--------------EQARQLESERE  189
              +  +    L E + + E +  E +  +  AR+ S              +    L+ E +
Sbjct  1445  KKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDHLETLKRENK  1504

Query  190   ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
              LQQ+ S   +QL   G+S+   L   ++    EK ++           +  ++ I    
Sbjct  1505  NLQQEISDLTEQLGETGKSIH-ELEKAKKTVESEKSEIQTALEEAEGTLEHEESKILRVQ  1563

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
             +   + +      L ++ ++ E+     Q VID ++   +           +K + +   
Sbjct  1564  LELNQVKSEIDRKLAEKDEEMEQIKRNSQRVIDSMQSTLDSEVRSRNDALRVKKKMEGDL  1623

Query  310   ADFQAE-RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPL  368
              + + +   A  + AE ++ L+    QL+     L  + +    +++        +    
Sbjct  1624  NEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDEAVRGQEDMKEQVAMVERRNSLMQ  1683

Query  369   PPAPAYLSSPLALPSQRRSPPEEPPDFC  396
                    ++       R+   +E  D  
Sbjct  1684  AEIEELRAALEQTERGRKVAEQELVDAS  1711


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/310 (16%), Positives = 109/310 (35%), Gaps = 4/310 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   EN E    + +   ++ +       +     E K  +  + +    L   +   + 
Sbjct  1280  RLQTENGEFSRQLEEKEALVSQLTRGKQAYTQQIEELKRHIEEEVKAKNALAHAVQSARH  1339

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1340  DCDLLREQYEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1399

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  + E      +  E  +Q+   +V+ L +  +   +      +      + LA+ + 
Sbjct  1400  DAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQ  1459

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K +   S     M+   E+    L+  +      Q+ I  L E+  +
Sbjct  1460  KYEESQAELEGAQKEARSLSTELFKMKNSYEEALDHLETLKRENKNLQQEISDLTEQLGE  1519

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +   K   +  K++ Q   E        E+ ++L+ QLE  Q +    +   +
Sbjct  1520  TGKSIHELEKAKKTVESEKSEIQTALEEAEGTLEHEESKILRVQLELNQVKSEIDRKLAE  1579

Query  349   ESARIEDMRK  358
             +   +E +++
Sbjct  1580  KDEEMEQIKR  1589


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 70/353 (20%), Positives = 148/353 (42%), Gaps = 44/353 (12%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E +  K  E  +L+ ++
Sbjct  1036  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENEKQQSDEKIKKKDFEISQLLSKI  1095

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A V+ Q   L  EL+E   RLE A 
Sbjct  1096  EDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEA-  1154

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQ-AASEE  223
                         A+    ++  +REA  Q+    +++  +Q ++  AALR E+  + +E 
Sbjct  1155  ----------GGATAAQIEMNKKREAEFQKMRRDLEESTLQHEATAAALRKEQADSVAEL  1204

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI--  281
               ++  LQ    +L +E   +             M+++DL   ++   +A    +++   
Sbjct  1205  GEQIDNLQRVKQKLEKEKSEY------------KMEIDDLTSNMEAVAKAKANLEKMCRT  1252

Query  282   --DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
               D+L E   +    +  +  + AQ    +A  Q E     +  E+KE L  QL + ++ 
Sbjct  1253  LEDQLSEIKTKSDENVRQLNDMNAQ----RARLQTENGEFSRQLEEKEALVSQLTRGKQA  1308

Query  340   YSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             Y++         +IE++++   E  +A    A A  S+       R    EE 
Sbjct  1309  YTQ---------QIEELKRHIEEEVKAKNALAHAVQSARHDCDLLREQYEEEQ  1352


 Score = 33.7 bits (75),  Expect = 4.2, Method: Composition-based stats.
 Identities = 45/262 (17%), Positives = 101/262 (39%), Gaps = 18/262 (7%)

Query  23    DQDVLGEESPLGKPAMLHLPSE--QGAPETLQRCLEENQELRDAIRQSNQILRERCEELL  80
             D+ V G+E    + AM+   +   Q   E L+  LE+ +  R    Q      ER   L 
Sbjct  1659  DEAVRGQEDMKEQVAMVERRNSLMQAEIEELRAALEQTERGRKVAEQELVDASERVGLLH  1718

Query  81    HFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA  140
                 S    K+ L     + +  V+    E  + + + ++A+ +   +    ++  +  A
Sbjct  1719  SQNTSLINTKKKLEADLVQVQGEVDDAVQEARNAEEKAKKAITDAAMMAEELKKEQDTSA  1778

Query  141   SVKAQVTSLLGELQESQSRLEAAT--------KECQALEGRARAASEQA---RQLESERE  189
              ++    +L   +++ Q RL+ A         K+ Q LE R R    +    ++  ++  
Sbjct  1779  HLERMKKNLEVTVKDLQHRLDEAESLAMKGGKKQLQKLESRVRELEAEVEAEQRRGADAV  1838

Query  190   ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                +++  +V +L  Q +      +       +   KL      Y +  +E +    + +
Sbjct  1839  KGVRKYERRVKELTYQTE----EDKKNVIRLQDLVDKLQLKVKVYKRQAEEAEEQTNTHL  1894

Query  250   VGSERKRGMQLEDLKQQLQQAE  271
                 + +  +LE+ +++   AE
Sbjct  1895  SRYRKVQH-ELEEAQERADVAE  1915


>sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan 
OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
Length=1637

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 49/342 (14%), Positives = 115/342 (34%), Gaps = 40/342 (12%)

Query  32   PLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQIL-RERCEELLHFQASQREEK  90
             +  P +  LPS           L+   +   A++Q    L ++  E     +    E +
Sbjct  455  TISSPQLAILPSNNSETPVDSVQLKALNDQLAALKQEKAELSKQHNEVFERLKTQDSELQ  514

Query  91   EFLMCKFQEARKLVERLGLEKLDLKRQKEQ-------ALREVEHLKRCQQQMAEDKASVK  143
            + +  +   A      +  +  +L+ QK++          E++   +    +  +     
Sbjct  515  DAISQR-NIAMMEYSEVTEKLSELRNQKQKLSRQVRDKEEELDGAMQKNDSLRNELRKSD  573

Query  144  AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREAL------QQQHSV  197
                 L   ++++        K  +  E   R    + R+  S  E         +  S 
Sbjct  574  KTRRELELHIEDAVIEAAKEKKLREHAEDCCRQLQMELRKGSSSVETTMPLSISSEMSSY  633

Query  198  QVDQLRMQ----GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSS-----  248
            ++++L +Q        +    ME +A  E+  +L    +A  +  Q+    +K +     
Sbjct  634  EIERLELQFSEKLSHQQTRHNMELEALREQFSELENANLALTKELQQTQERLKYTQMESI  693

Query  249  ----------VVGSERKRGMQLED---LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
                          + ++    E+   L  ++    ++L   Q   D++ +E    +  +
Sbjct  694  TDSAETLLELKKQHDLEKSSWFEEKQRLSSEVNLKSKSLKELQAEDDEIFKELRMKREAI  753

Query  296  ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
                   A+   + +D   E+ AR  L      + E+LE L+
Sbjct  754  TLWERQMAEIIQWVSD---EKDARGYLQALATKMTEELEYLK  792


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 72/187 (39%), Gaps = 5/187 (3%)

Query  196  SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERK  255
            SVQ+  L  Q     AAL+ E+   S++  ++ +         Q+  +    +++     
Sbjct  475  SVQLKALNDQL----AALKQEKAELSKQHNEVFERLKTQDSELQDAISQRNIAMMEYSEV  530

Query  256  RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
               +L +L+ Q Q+    +  K+E +D   ++ +  +  +      + + +++  D   E
Sbjct  531  TE-KLSELRNQKQKLSRQVRDKEEELDGAMQKNDSLRNELRKSDKTRRELELHIEDAVIE  589

Query  316  RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
                +KL E  E    QL+   R+ S    +    +   +M    +E  +       ++ 
Sbjct  590  AAKEKKLREHAEDCCRQLQMELRKGSSSVETTMPLSISSEMSSYEIERLELQFSEKLSHQ  649

Query  376  SSPLALP  382
             +   + 
Sbjct  650  QTRHNME  656


>sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec 
PE=1 SV=3
Length=4691

 Score = 57.5 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 53/276 (19%), Positives = 111/276 (40%), Gaps = 13/276 (5%)

Query  63    DAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL  122
             +++ Q    LR R  EL    +   +     + + +E  +L E+   E+ +   + E AL
Sbjct  1455  ESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAAL  1514

Query  123   REVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
              +   L    +  A+ KA  + +   L   +QE  +R E A  + Q  +   +   +  R
Sbjct  1515  EKQRQLA---EAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLR  1571

Query  183   QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
             Q        + Q     ++ RM+ +     +R++ +    ++        A     +E +
Sbjct  1572  QSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAE  1631

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                + +   +ER R      ++ + Q+  +A       +    E A + +  ++ +  L+
Sbjct  1632  AQKRQAQEEAERLRR----QVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELR  1687

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
              QA+      +AER+ R+  AE+   +Q  LE  QR
Sbjct  1688  LQAE------EAERRLRQAEAERARQVQVALETAQR  1717


 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 56/298 (19%), Positives = 120/298 (40%), Gaps = 18/298 (6%)

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             +QK+ A  E+E  K+  +Q    KA V+ ++T+L  +L+E+  +     +E Q L+    
Sbjct  2303  KQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVT  2362

Query  176   AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
              A+ Q  Q+E E  +++    VQ+++L      +EA  R       +  ++  + +    
Sbjct  2363  EAARQRSQVEEELFSVR----VQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKM  2418

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
             +   E    +  +   + R R +  EDL QQ   AE+ L  K + + +      + +++ 
Sbjct  2419  KQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQ  2478

Query  296   ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
             +   + + QA               +L E KE + +QL +  + + +   + ++      
Sbjct  2479  QQKELAQEQA--------------RRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMS  2524

Query  356   MRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIH  413
                  +++  A +  A A          ++     E         Q +   + TL+I 
Sbjct  2525  AEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQ  2582


 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 63/311 (20%), Positives = 134/311 (43%), Gaps = 26/311 (8%)

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL-  160
             + ++RL  E  +  RQ+ Q   E+  ++   +++ + KA ++A+  +L+   +++  R  
Sbjct  2352  EELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFL  2411

Query  161   -EAATKECQALEGRAR---AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
              E A K  Q  E  AR   AA E AR  +   E L QQ ++    L+ + Q+V+ A R+ 
Sbjct  2412  EEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL-  2470

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             +  A   +++    Q    +L ++ +   +  V  ++  +     + ++QL+ + EA   
Sbjct  2471  KAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERL  2530

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA--------------REKL  322
             K   + ++     + +   +     + QA+           A              R++ 
Sbjct  2531  K-LRMAEMSRAQARAEEDAQR---FRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQS  2586

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESA-RIEDMRK-RHVEVSQAPLPPAPAYLSSPLA  380
                 E L+E + +L+RE  KLK   +    + E+M+  +  ++ Q       ++LS   +
Sbjct  2587  DHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDS  2646

Query  381   LPSQRRSPPEE  391
             L  + R   +E
Sbjct  2647  LLQRERFIEQE  2657


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 53/297 (18%), Positives = 123/297 (41%), Gaps = 10/297 (3%)

Query  67    QSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVE  126
             ++N+ LR R +     Q     + +    K +  R+   R   E+  ++ Q+E A +E+E
Sbjct  1782  KANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVR-QRELAEQELE  1840

Query  127   HLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES  186
               ++  +  A+ + + + ++  L  E ++ + + +   +E   L+  A AA+++ ++LE+
Sbjct  1841  KQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEA  1900

Query  187   EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK  246
             E   ++ +  V +       +   +     +Q    E  +  +L         E    ++
Sbjct  1901  ELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFREL--------AEEAARLR  1952

Query  247   SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             +    ++R+R +  ED  +Q  +AE  L  K   I +      + +I ++       +  
Sbjct  1953  ALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLR  2012

Query  307   IYKAD-FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVE  362
                 D     R+  E+ A  K  ++E+L QL++         +        ++R VE
Sbjct  2013  RLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVE  2069


 Score = 44.1 bits (102),  Expect = 0.002, Method: Composition-based stats.
 Identities = 63/365 (17%), Positives = 135/365 (37%), Gaps = 28/365 (8%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
               +G  + L+   EE +  +   ++  + LR + ++    +     E    +    EA +
Sbjct  1615  GAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAR  1674

Query  103   LVERLGLEKLDLKRQKEQALREVEHL----------------KRCQQQMAEDKASVKAQV  146
               +R      +L+ Q E+A R +                   +  + ++   +AS   + 
Sbjct  1675  EKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKT  1734

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG  206
               L   LQE    +    +E    E RA+  +E  R  E     L++      + LR++ 
Sbjct  1735  AQLERTLQEEHVTVAQLREEA---ERRAQQQAEAERAREEAERELERWQLKANEALRLRL  1791

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
             Q+ E A +     A  EK+K    + A  +   E     +  +   E ++  QL +    
Sbjct  1792  QAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAE----  1847

Query  267   LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
                A++ L A+QE+I        + +   +   +L+ +    + +  A  Q R++L  + 
Sbjct  1848  -GTAQQRLAAEQELI----RLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAEL  1902

Query  327   ELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRR  386
               ++ ++E L    ++ +   + ++     R          L    A L +      ++R
Sbjct  1903  AKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQR  1962

Query  387   SPPEE  391
                EE
Sbjct  1963  QLAEE  1967


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 57/368 (15%), Positives = 136/368 (37%), Gaps = 20/368 (5%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L++  EE+   + A+ +  ++L+E+ + +       + E E L  + + A++   RL  +
Sbjct  2438  LRQLAEEDLAQQRALAE--KMLKEKMQAVQE-ATRLKAEAELLQQQKELAQEQARRLQED  2494

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
             K  + +Q  +  +  +     ++Q   + ++   ++   + E+  +Q+R E   +  +  
Sbjct  2495  KEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQ  2554

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                      +      E+  L Q   +Q    R Q       LR        EK KL Q 
Sbjct  2555  AEEIGEKLHRTELATQEKVTLVQTLEIQ----RQQSDHDAERLREAIAELEREKEKLKQE  2610

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL-KEEAE  289
                     +E     +  ++   +         K  L Q E  +  ++  +++L ++E  
Sbjct  2611  AKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVA  2670

Query  290   QHKIVMETVPV------------LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
             + K + E                + +  +  +   +AE   R K  E + L Q++ +Q +
Sbjct  2671  KAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEK  2730

Query  338   REYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCC  397
                 + +   +   R+E+  +  +  S+     A +  + P    +      E  P++  
Sbjct  2731  LLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTF  2790

Query  398   PKCQYQAP  405
                + + P
Sbjct  2791  EGLRQKVP  2798


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 44/247 (18%), Positives = 109/247 (44%), Gaps = 9/247 (4%)

Query  49    ETLQRCLEENQELRDAIRQ-SNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E LQ+  E  QE    +++   Q+ ++  EE   FQ +   E+     +  E     ERL
Sbjct  2475  ELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAER----QRQLEMSAEAERL  2530

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              L   ++ R + +A  + +  ++  +++ E     +      +  +Q  + + + +  + 
Sbjct  2531  KLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDA  2590

Query  168   QALEGRARAASEQARQLESEREALQ----QQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             + L         +  +L+ E + LQ    +  +VQ +Q+  + Q+++ +   E+ +  + 
Sbjct  2591  ERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQR  2650

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             +R + Q +    QLFQ+     K      +R++    ++ ++ +   EEA   ++E  + 
Sbjct  2651  ERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEG  2710

Query  284   LKEEAEQ  290
             ++ + E+
Sbjct  2711  VRRKQEE  2717


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 66/375 (18%), Positives = 138/375 (37%), Gaps = 47/375 (13%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             +E  A E  +R  EE     +A   + Q  R   EEL H + S   E +    + + A +
Sbjct  1531  AELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAER  1590

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                R+  E   ++ Q E   R+              +   + ++ +L    +E++++   
Sbjct  1591  SRMRIEEEIRVVRLQLETTERQ--------------RGGAEGELQALRARAEEAEAQKRQ  1636

Query  163   ATKECQALEGRARAASEQARQ----------LESEREALQQQHSVQVDQLRMQGQSVEAA  212
             A +E + L  + +  S++ RQ           E+E    +Q+    +D+LR+Q +  EA 
Sbjct  1637  AQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAE--EAE  1694

Query  213   LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED----------  262
              R+ +  A   ++    L+ A      E  +   S    + +      E+          
Sbjct  1695  RRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREE  1754

Query  263   ----------LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
                        ++  ++AE  L   Q   ++      Q + V +   + +A A+  K + 
Sbjct  1755  AERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEA  1814

Query  313   QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAP  372
             + E + R K AE++ + Q +L + + E  +  A      R+   ++     ++       
Sbjct  1815  EREARRRGK-AEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQ  1873

Query  373   AYLSSPLALPSQRRS  387
               L        Q  +
Sbjct  1874  RQLLEEELARLQHEA  1888


 Score = 40.6 bits (93),  Expect = 0.037, Method: Composition-based stats.
 Identities = 48/256 (19%), Positives = 114/256 (45%), Gaps = 13/256 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E +++  EE   L  A +++ ++ +   E+L    A QR   E ++ +  +A +   RL 
Sbjct  2416  EKMKQVAEEAARLSVAAQEAARLRQLAEEDL----AQQRALAEKMLKEKMQAVQEATRLK  2471

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E   L++QKE A  +   L+  ++QMA+    +  +       L+  + R    + E +
Sbjct  2472  AEAELLQQQKELAQEQARRLQEDKEQMAQ---QLVEETQGFQRTLEAERQRQLEMSAEAE  2528

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLR------MQGQSVEAALRMERQAASE  222
              L+ R    S    + E + +  ++Q     ++L        +  ++   L ++RQ +  
Sbjct  2529  RLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDH  2588

Query  223   EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
             +  +L +      +  ++     K   + SE  + +Q E + Q+ Q  +++ +++++ + 
Sbjct  2589  DAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLL  2648

Query  283   KLKEEAEQHKIVMETV  298
             + +   EQ K  +E +
Sbjct  2649  QRERFIEQEKAKLEQL  2664


 Score = 38.3 bits (87),  Expect = 0.17, Method: Composition-based stats.
 Identities = 43/271 (16%), Positives = 113/271 (42%), Gaps = 17/271 (6%)

Query  12    EMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQI  71
             + VQ +    A+ ++L ++  L +     L  ++   +  Q+ +EE Q  +  +    Q 
Sbjct  2462  QAVQEATRLKAEAELLQQQKELAQEQARRL--QEDKEQMAQQLVEETQGFQRTLEAERQR  2519

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
                        Q     E E L  +  E  +   R   +    ++Q E+   ++   +  
Sbjct  2520  -----------QLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELA  2568

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES--ERE  189
              Q+      +++ Q      + +  +  +    +E + L+  A+    ++ ++++  + +
Sbjct  2569  TQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQ  2628

Query  190   ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
              LQ+  ++Q   L  +   ++    +E++ A  E  +L Q +VA  +  +E     +  +
Sbjct  2629  ILQETQALQKSFLSEKDSLLQRERFIEQEKAKLE--QLFQDEVAKAKQLREEQQRQQQQM  2686

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                +++    +E+ +++ ++AEE +  KQE 
Sbjct  2687  EQEKQELMASMEEARRRQREAEEGVRRKQEE  2717


 Score = 34.8 bits (78),  Expect = 1.9, Method: Composition-based stats.
 Identities = 71/371 (19%), Positives = 139/371 (37%), Gaps = 30/371 (8%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   L + S QGA E L+      ++L++A  Q+     +  E         R + E   
Sbjct  1234  KTISLVIRSTQGAEEVLK---THEEQLKEA--QAVPATLQELEATKASLKKLRAQAEAQQ  1288

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
               F   R  +         L+++  +   EVE  +    Q+ E   +V AQ      EL+
Sbjct  1289  PVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELE  1348

Query  155   ESQSRLEAATKECQALEGRARAASEQARQL--------ESEREALQQQHSVQVDQLRMQG  206
             +   +L    +    L    + A  +  Q+        ++ RE L+Q+ ++ ++++   G
Sbjct  1349  QLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEKAL-LEEIERHG  1407

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
             + VE   +  +Q  +  K    QL     QL        K  V         +  DL+ +
Sbjct  1408  EKVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTR  1467

Query  267   LQ------------QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
                            +E     ++E     ++ AE+ + + E    L+ Q  +  A+  A
Sbjct  1468  YSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQL--AEAHA  1525

Query  315   ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAY  374
             + +A+ +L  ++   + Q E  +RE + + A  Q+ +  E+++  H+  S      A A 
Sbjct  1526  QAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQ--HLRQSSEAEIQAKAQ  1583

Query  375   LSSPLALPSQR  385
                       R
Sbjct  1584  QVEAAERSRMR  1594


 Score = 32.9 bits (73),  Expect = 7.5, Method: Composition-based stats.
 Identities = 43/256 (17%), Positives = 103/256 (40%), Gaps = 20/256 (8%)

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA--  169
              +  RQ++ AL EVE LK   ++    +   + +    L   QE+  +   A ++  A  
Sbjct  2143  EEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFV  2202

Query  170   -----------------LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
                              +  R R+ +E AR+   E E  ++Q   +  Q R Q +  E  
Sbjct  2203  VQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAE-R  2261

Query  213   LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
             L+   +  ++ + +         +  ++       +   + +++     ++++  + AE+
Sbjct  2262  LKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQ  2321

Query  273   ALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
              L  K +V  +L     Q +       +L  +    KA+     + R ++ E+   ++ Q
Sbjct  2322  TLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQ  2381

Query  333   LEQLQREYSKLKASCQ  348
             +E+L +  ++++A  +
Sbjct  2382  MEELGKLKARIEAENR  2397


>sp|P49824|MYH7_CANLF Myosin-7 OS=Canis lupus familiaris OX=9615 
GN=MYH7 PE=1 SV=3
Length=1935

 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 142/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  874   EEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  933

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  R+++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  934   AELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  993

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  994   KEKKALQEAHQQALDDLQAEEDKVNTLTKAKV----KLEQQVDDLEGSLEQEKKVRMDLE  1049

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +L  L  +++  +      Q+ +
Sbjct  1050  RAKRKLEGDL-KLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKL  1108

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1109  KELQARIEELEEELEAERTARAKVEKLRSDLSRE---LEEISERLEEAGGATSVQIEMNK  1165

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1166  KREAEFQKMRRDLEEATLQHEATAAA  1191


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 61/340 (18%), Positives = 120/340 (35%), Gaps = 45/340 (13%)

Query  41    LPSEQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEEL  79
             +  EQ     LQ+ L+E Q                     +LR  + +  + + ER EE 
Sbjct  1094  IEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA  1153

Query  80    LHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAED  138
                 + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   
Sbjct  1154  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1213

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ  198
             K  ++ + +    EL +  S +E   K    LE   R   +Q  +  S+ E   Q+    
Sbjct  1214  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEE-TQRSVND  1272

Query  199   VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE-----  253
             +   R + Q+    L  +         +L + ++ Y Q  ++    ++  V         
Sbjct  1273  LTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHA  1332

Query  254   -RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              +      + L++Q ++  EA    Q V+ K   E  Q +   ET  + +          
Sbjct  1333  LQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRT---------  1383

Query  313   QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                    E+L E K+ L ++L+  +     + A C    +
Sbjct  1384  -------EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1416


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 54/311 (17%), Positives = 128/311 (41%), Gaps = 6/311 (2%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L+R LEE  + ++A+  + Q  R  C+ L      + E K  L     +A   V +  
Sbjct  1313  EDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWR  1372

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              +      Q+ +   E+E  K+   Q  +D       V +    L++++ RL+   ++  
Sbjct  1373  TKYETDAIQRTE---ELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLM  1429

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                 R+ AA+    + +   + +  +   + ++ + + +S +   R       + K    
Sbjct  1430  VDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYE  1489

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  + + + F+  + +++  +     + G   + + + L++  + L A++  +    EEA
Sbjct  1490  E-SLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHE-LEKVRKQLEAEKLELQSALEEA  1547

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
             E      E   +L+AQ +  +   + ER+  EK  E ++  +  L  +    + L A  +
Sbjct  1548  EASLEH-EEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETR  1606

Query  349   ESARIEDMRKR  359
                    ++K+
Sbjct  1607  SRNEALRVKKK  1617


 Score = 42.9 bits (99),  Expect = 0.005, Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 114/312 (37%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1279  KLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARH  1338

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1339  DCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1398

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + LA+ + 
Sbjct  1399  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQ  1458

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+   
Sbjct  1459  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGS  1518

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q +  K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1519  SGKTIHELEKVRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1578

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1579  KDEEMEQAKRNH  1590


 Score = 41.0 bits (94),  Expect = 0.021, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 129/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  R+
Sbjct  1035  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARI  1094

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLG----ELQESQSRLEAA  163
               E+  L  Q ++ L+E++      ++  E + + +A+V  L      EL+E   RLE A
Sbjct  1095  EDEQ-ALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA  1153

Query  164   TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                        +    + +++  + E    QH      LR +     A L  +       
Sbjct  1154  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1213

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             K+KL + +  +     +  ++++  +        M      Q  +   +A   ++ V D 
Sbjct  1214  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDL  1273

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               + A+      E    L  Q D  +A      + +    ++ E L+ QLE+  +  + L
Sbjct  1274  TSQRAKLQTENGE----LSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNAL  1329

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1330  AHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRT  1373


 Score = 39.8 bits (91),  Expect = 0.049, Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 81/220 (37%), Gaps = 23/220 (10%)

Query  87    REEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV  146
             +E    +  +    +  +E L       +R ++ A +E+       Q +     S+  Q 
Sbjct  1668  KENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQK  1727

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESE----------REALQQQHS  196
               +  +L + Q+ +E A +EC+  E +A+ A   A  +  E           E +++   
Sbjct  1728  KKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNME  1787

Query  197   VQVDQLRMQGQSVE----AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV--  250
               +  L+ +    E       + + Q      R+L     A  +   E    ++ S    
Sbjct  1788  QTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRI  1847

Query  251   -------GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
                      +RK  ++L+DL  +LQ   +A   + E  ++
Sbjct  1848  KELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEE  1887


 Score = 38.3 bits (87),  Expect = 0.14, Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 106/249 (43%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  +E+ +  R    Q      ER + L     S   +K+ +     + +  V
Sbjct  1682  QAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEV  1741

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1742  EEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAE  1801

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E EA Q++++  V  +R      E  ++       E+
Sbjct  1802  QIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMR----KSERRIKELTYQTEED  1857

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             ++ L +LQ    +L Q      K     +E +    L   ++   +L +AEE     +  
Sbjct  1858  RKNLLRLQDLVDKL-QLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQ  1916

Query  281   IDKLKEEAE  289
             ++KL+ ++ 
Sbjct  1917  VNKLRAKSR  1925


 Score = 33.7 bits (75),  Expect = 3.9, Method: Composition-based stats.
 Identities = 55/308 (18%), Positives = 111/308 (36%), Gaps = 16/308 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ET +R  +  QE    + +      +   EL   +     EK  L    +EA   +E   
Sbjct  1496  ETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEHEE  1555

Query  109   LEKLDLKRQKEQALREVEH-LKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              + L  + +  Q   E+E  L    ++M + K +    V SL   L         A +  
Sbjct  1556  GKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVK  1615

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             + +EG       Q          +  +   QV  L+   +  +  L    +A  + K  +
Sbjct  1616  KKMEGDLNEMEIQLSHAN----RMAAEAQKQVKGLQSLLKDTQIQLDDAVRANDDLKENI  1671

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             A ++   + L Q     +++ V  +ER R +  ++L +  ++ +        +I++ K+ 
Sbjct  1672  AIVE-RRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKM  1730

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
                         + + Q ++ +A  Q  R A EK  +         E+L++E        
Sbjct  1731  DA---------DLSQLQTEVEEA-VQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLE  1780

Query  348   QESARIED  355
             +    +E 
Sbjct  1781  RMKKNMEQ  1788


>sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 
PE=2 SV=1
Length=1959

 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/344 (18%), Positives = 135/344 (39%), Gaps = 18/344 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +++       R  E+  FQA    EK  L  + Q   +L       +  L  +K++    
Sbjct  857   VKEKQLAAENRLSEMETFQAQLMAEKMQLQEQLQAEAELCAEAEEIRARLTAKKQELEEI  916

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
                L+   ++  E    ++A+   +   +QE + +LE      Q L+        + ++L
Sbjct  917   CHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKL  976

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E +   L+ Q+     + ++    + +          E+ + LA+L+  +  +  + +  
Sbjct  977   EEDVIVLEDQNLKLAKEKKLLEDRM-SEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEER  1035

Query  245   IKSSVVGSERKRG-------------MQLEDLKQQLQQAEEALVAKQEVIDK----LKEE  287
             ++      +                  Q+ +L+ Q+ + +  L  K+E +      ++EE
Sbjct  1036  LRREEKQRQELEKTRRKLEGDSSDLHDQIAELQAQIAELKIQLSKKEEELQAALARVEEE  1095

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
             A Q  + ++ +  L++Q    + D ++ER +R K  ++K  L E+LE L+ E      S 
Sbjct  1096  AAQKNMALKKIRELESQITELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDST  1155

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                  +   R++ V V +  L        + +    Q+ S   E
Sbjct  1156  AAQQELRSKREQEVTVLKKTLEDEAKTHEAQIQEMRQKHSQAIE  1199


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 137/345 (40%), Gaps = 21/345 (6%)

Query  54    CLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLD  113
             CLE  +E +  +++  + L +R EE +       + K  L  +  +    ++       +
Sbjct  1379  CLEIAEEAKKKLQKDLESLTQRYEEKIAAYDKLEKTKTRLQQELDDIAVDLDHQRQTVSN  1438

Query  114   LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGR  173
             L++++++  + +   K    + AE++   +A+      +       LE A ++   LE  
Sbjct  1439  LEKKQKKFDQLLAEEKNISAKYAEERDRAEAEAREKETKALSLARALEEAIEQKAELERV  1498

Query  174   ARAASEQARQLESEREALQQ---QHSVQVDQLRMQGQSVEA---ALRMERQAASEEKRKL  227
              +    +   L S ++ + +   +       L  Q + ++     L  E QA  + K +L
Sbjct  1499  NKQFRTEMEDLMSSKDDVGKSVHELEKAKRALEQQVEEMKTQLEELEDELQATEDAKLRL  1558

Query  228   AQLQVA----YHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
                Q A    + +     D   +       R+      +L+ + +Q   A+ A++++   
Sbjct  1559  EVNQQAMKAQFDRDLLGRDEQNEEKRKQLIRQVREMEVELEDERKQRSIAVAARKKLELD  1618

Query  284   LKEEA-------EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             LK+         +     ++ V  L+AQ   Y  + +  R +RE++  + +  +++L+ +
Sbjct  1619  LKDLESHIDTANKNRDEAIKHVRKLQAQMKDYMRELEDTRTSREEILAQAKENEKKLKSM  1678

Query  337   QREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             + E  +L+     + R     KR  +  +  L    A  S   AL
Sbjct  1679  EAEMIQLQEELAAAER----AKRQAQQERDELADEIANSSGKGAL  1719


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 47/289 (16%), Positives = 123/289 (43%), Gaps = 14/289 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKE---FLMCKFQEARKLVE  105
             +T+    ++ ++    + +   I  +  EE    +A  RE++     L    +EA +   
Sbjct  1434  QTVSNLEKKQKKFDQLLAEEKNISAKYAEERDRAEAEAREKETKALSLARALEEAIEQKA  1493

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
              L       + + E  +   + + +   ++ + K +++ QV  +  +L+E +  L+A   
Sbjct  1494  ELERVNKQFRTEMEDLMSSKDDVGKSVHELEKAKRALEQQVEEMKTQLEELEDELQATED  1553

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
                 LE   +A      Q + +     +Q+  +  QL  Q + +E  L  ER+  S    
Sbjct  1554  AKLRLEVNQQAMKA---QFDRDLLGRDEQNEEKRKQLIRQVREMEVELEDERKQRSIAVA  1610

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
                +L++    L    D   K+     +  R +Q + +K  +++ E+   +++E++ + K
Sbjct  1611  ARKKLELDLKDLESHIDTANKNRDEAIKHVRKLQAQ-MKDYMRELEDTRTSREEILAQAK  1669

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
             E  ++       +  ++A+    + +  A  +A+ +  ++++ L +++ 
Sbjct  1670  ENEKK-------LKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIA  1711


 Score = 41.0 bits (94),  Expect = 0.021, Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 90/239 (38%), Gaps = 18/239 (8%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ----EARKLVERLGLEK  111
             EE  +    ++  ++ +    EE L  +  QR+E E    K +    +    +  L  + 
Sbjct  1012  EEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSSDLHDQIAELQAQI  1071

Query  112   LDLKRQKEQALREVEH-LKRCQQQMAEDKASVKA------QVTSLLGELQESQSRLEAAT  164
              +LK Q  +   E++  L R +++ A+   ++K       Q+T L  +L+  ++    A 
Sbjct  1072  AELKIQLSKKEEELQAALARVEEEAAQKNMALKKIRELESQITELQEDLESERASRNKAE  1131

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             K+ + L     A   +         A Q+  S +  ++ +  +++E   +       E +
Sbjct  1132  KQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVTVLKKTLEDEAKTHEAQIQEMR  1191

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             +K       + Q  +E    ++ +          +     ++ + + E  V  Q   D 
Sbjct  1192  QK-------HSQAIEELAEQLEQTKRVKANLEKAKQALESERAELSNEVKVLLQGKGDA  1243


 Score = 37.1 bits (84),  Expect = 0.35, Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 95/235 (40%), Gaps = 5/235 (2%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K  M  L   + + E +    +EN++   ++      L+E        +   ++E++ L 
Sbjct  1648  KDYMRELEDTRTSREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELA  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +   +         EK  L+ +  Q   E+E  +   + + +       Q+  +  +L 
Sbjct  1708  DEIANSSGKGALAMEEKRRLEARIAQLEEELEEEQGNTEIINDRLKKANLQIDQMNADLN  1767

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
               +S  +      Q +E + +    + +++ES   A++ ++   +  L  +   +E  L 
Sbjct  1768  AERSNAQKNENARQQMERQNKELKLKLQEMES---AVKSKYKATITALEAKIVQLEEQLD  1824

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG--MQLEDLKQQL  267
             ME +      +++ + +     +  + D+  +++    ++     M+L+ LK+QL
Sbjct  1825  METKERQAASKQVRRAEKKLKDILLQVDDERRNAEQFKDQADKANMRLKQLKRQL  1879


 Score = 36.0 bits (81),  Expect = 0.92, Method: Composition-based stats.
 Identities = 54/303 (18%), Positives = 126/303 (42%), Gaps = 22/303 (7%)

Query  74    ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ  133
             E+  EL       R E E LM    +  K V  L   K  L++Q E+   ++E L+   Q
Sbjct  1490  EQKAELERVNKQFRTEMEDLMSSKDDVGKSVHELEKAKRALEQQVEEMKTQLEELEDELQ  1549

Query  134   QMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQ  193
                + K  ++    ++  +        +   +E +      +    Q R++E E E  ++
Sbjct  1550  ATEDAKLRLEVNQQAMKAQFDRDLLGRDEQNEEKR------KQLIRQVREMEVELEDERK  1603

Query  194   QHSVQV---DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH------  244
             Q S+ V    +L +  + +E+ +    +   E  + + +LQ       +E ++       
Sbjct  1604  QRSIAVAARKKLELDLKDLESHIDTANKNRDEAIKHVRKLQAQMKDYMRELEDTRTSREE  1663

Query  245   -IKSSVVGSERKRGMQLE--DLKQQLQQAEEALVAKQ----EVIDKLKEEAEQHKIVMET  297
              +  +    ++ + M+ E   L+++L  AE A    Q    E+ D++   + +  + ME 
Sbjct  1664  ILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALAMEE  1723

Query  298   VPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
                L+A+    + + + E+   E + ++ +    Q++Q+  + +  +++ Q++       
Sbjct  1724  KRRLEARIAQLEEELEEEQGNTEIINDRLKKANLQIDQMNADLNAERSNAQKNENARQQM  1783

Query  358   KRH  360
             +R 
Sbjct  1784  ERQ  1786


 Score = 35.6 bits (80),  Expect = 1.0, Method: Composition-based stats.
 Identities = 62/345 (18%), Positives = 129/345 (37%), Gaps = 30/345 (9%)

Query  22    ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLH  81
             A Q +  E + L     + L  +  A    ++   + QEL+    +  ++  E  E +  
Sbjct  1218  AKQALESERAELSNEVKVLLQGKGDAEHKRKKVDAQLQELQVKFTEGERVKTELAERVNK  1277

Query  82    FQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLK------------  129
              Q         L     ++ KL +     +  L +  ++ L+E   LK            
Sbjct  1278  LQVELDNVTGLLNQSDSKSIKLAKDFSALESQL-QDTQELLQEETRLKLSFSTKLKQTED  1336

Query  130   ------RCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
                      ++  E K +++ Q++ L  +  E++ +++      +  E   +   +    
Sbjct  1337  EKNALKEQLEEEEEAKRNLEKQISVLQQQAVEARKKMDDGLGCLEIAEEAKKKLQKDLES  1396

Query  184   LE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
             L     E+ A   +      +L+ +   +   L  +RQ  S  ++K    Q  + QL  E
Sbjct  1397  LTQRYEEKIAAYDKLEKTKTRLQQELDDIAVDLDHQRQTVSNLEKK----QKKFDQLLAE  1452

Query  241   YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
               N         +R      E   + L  A  AL    E   +L+   +Q +  ME +  
Sbjct  1453  EKNISAKYAEERDRAEAEAREKETKALSLA-RALEEAIEQKAELERVNKQFRTEMEDL--  1509

Query  301   LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             + ++ D+ K+  + E+  R  L ++ E ++ QLE+L+ E    + 
Sbjct  1510  MSSKDDVGKSVHELEKAKR-ALEQQVEEMKTQLEELEDELQATED  1553


>sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 
PE=2 SV=1
Length=1935

 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 142/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  874   EEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  933

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  R+++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  934   AELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLT  993

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  994   KEKKALQEAHQQALDDLQAEEDKVNTLTKAKV----KLEQQVDDLEGSLEQEKKVRMDLE  1049

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +L  L  +++  +      Q+ +
Sbjct  1050  RAKRKLEGDL-KLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKL  1108

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1109  KELQARIEELEEELEAERTARAKVEKLRSDLSRE---LEEISERLEEAGGATSVQIEMNK  1165

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1166  KREAEFQKMRRDLEEATLQHEATAAA  1191


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 40/266 (15%), Positives = 106/266 (40%), Gaps = 14/266 (5%)

Query  51    LQRCLEENQELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             L   +  N +L++ I    + N +L+   EEL          ++    +  E  + V+ L
Sbjct  1657  LDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLL  1716

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRL  160
               +   L  QK++   ++  L+   ++  ++  + + +          +  EL++ Q   
Sbjct  1717  HSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTS  1776

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                 +  + +E   +    +  + E       ++   Q+ +L  + + +E  L  E++  
Sbjct  1777  AHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKK---QLQKLEARVRELENELEAEQKRN  1833

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             +E  + + + +    +L  + +   K+ +   +    +QL+ +K   +QAEEA       
Sbjct  1834  AESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLK-VKAYKRQAEEAEEQANTN  1892

Query  281   IDKLKEEAEQHKIVMETVPVLKAQAD  306
             + K ++   +     E   + ++Q +
Sbjct  1893  LSKFRKVQHELDEAEERADIAESQVN  1918


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 114/312 (37%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1279  KLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARH  1338

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1339  DCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1398

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + LA+ + 
Sbjct  1399  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQ  1458

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+   
Sbjct  1459  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGS  1518

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q +  K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1519  TGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1578

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1579  KDEEMEQAKRNH  1590


 Score = 43.7 bits (101),  Expect = 0.003, Method: Composition-based stats.
 Identities = 61/337 (18%), Positives = 119/337 (35%), Gaps = 45/337 (13%)

Query  44    EQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEELLHF  82
             EQ     LQ+ L+E Q                     +LR  + +  + + ER EE    
Sbjct  1097  EQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGA  1156

Query  83    QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAEDKAS  141
              + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   K  
Sbjct  1157  TSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQK  1216

Query  142   VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
             ++ + +    EL +  S +E   K    LE   R   +Q  +  S+ E   Q+    +  
Sbjct  1217  LEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEE-TQRSVNDLTS  1275

Query  202   LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE------RK  255
              R + Q+    L  +         +L + ++ Y Q  ++    ++  V          + 
Sbjct  1276  QRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS  1335

Query  256   RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                  + L++Q ++  EA    Q V+ K   E  Q +   ET  + +             
Sbjct  1336  ARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRT------------  1383

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                 E+L E K+ L ++L+  +     + A C    +
Sbjct  1384  ----EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1416


 Score = 41.4 bits (95),  Expect = 0.018, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 129/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  R+
Sbjct  1035  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARI  1094

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLG----ELQESQSRLEAA  163
               E+  L  Q ++ L+E++      ++  E + + +A+V  L      EL+E   RLE A
Sbjct  1095  EDEQ-ALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA  1153

Query  164   TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                        +    + +++  + E    QH      LR +     A L  +       
Sbjct  1154  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1213

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             K+KL + +  +     +  ++++  +        M      Q  +   +A   ++ V D 
Sbjct  1214  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDL  1273

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               + A+      E    L  Q D  +A      + +    ++ E L+ QLE+  +  + L
Sbjct  1274  TSQRAKLQTENGE----LSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNAL  1329

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1330  AHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRT  1373


 Score = 41.0 bits (94),  Expect = 0.025, Method: Composition-based stats.
 Identities = 48/258 (19%), Positives = 97/258 (38%), Gaps = 37/258 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ++LQ  L++ Q   D   ++N  L+E    +             L  + +E R +VE+  
Sbjct  1644  KSLQSLLKDTQIQLDDAVRANDDLKENIAIVER-------RNNLLQAELEELRAVVEQTE  1696

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                    R ++ A +E+       Q +     S+  Q   +  +L + Q+ +E A +EC+
Sbjct  1697  -------RSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECR  1749

Query  169   ALEGRARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVE----AALR  214
               E +A+ A   A  +  E           E +++     +  L+ +    E       +
Sbjct  1750  NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGK  1809

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV---------GSERKRGMQLEDLKQ  265
              + Q      R+L     A  +   E    ++ S             +RK  ++L+DL  
Sbjct  1810  KQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVD  1869

Query  266   QLQQAEEALVAKQEVIDK  283
             +LQ   +A   + E  ++
Sbjct  1870  KLQLKVKAYKRQAEEAEE  1887


 Score = 35.6 bits (80),  Expect = 1.0, Method: Composition-based stats.
 Identities = 55/308 (18%), Positives = 111/308 (36%), Gaps = 16/308 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ET +R  +  QE    + +      +   EL   +     EK  L    +EA   +E   
Sbjct  1496  ETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEE  1555

Query  109   LEKLDLKRQKEQALREVEH-LKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              + L  + +  Q   E+E  L    ++M + K +    V SL   L         A +  
Sbjct  1556  GKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVK  1615

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             + +EG       Q          +  +   QV  L+   +  +  L    +A  + K  +
Sbjct  1616  KKMEGDLNEMEIQLSHAN----RMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENI  1671

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             A ++   + L Q     +++ V  +ER R +  ++L +  ++ +        +I++ K+ 
Sbjct  1672  AIVE-RRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKM  1730

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
                         + + Q ++ +A  Q  R A EK  +         E+L++E        
Sbjct  1731  DA---------DLSQLQTEVEEA-VQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLE  1780

Query  348   QESARIED  355
             +    +E 
Sbjct  1781  RMKKNMEQ  1788


>sp|P07942|LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens 
OX=9606 GN=LAMB1 PE=1 SV=2
Length=1786

 Score = 57.2 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/312 (20%), Positives = 122/312 (39%), Gaps = 36/312 (12%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
                T ++  + N+ELR+ I+Q    L +   +L   +A   E    L  +     + ++ 
Sbjct  1486  TNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANE---VLKMEMPSTPQQLQN  1542

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
             L  +  +    + ++L +VE +    Q  A D A  +  +       + +      A   
Sbjct  1543  LTEDIRE----RVESLSQVEVI---LQHSAADIARAEMLLEEAKRASKSATDVKVTADMV  1595

Query  167   CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
              +ALE   +A     + ++   E +Q   ++ +  +  +  + E  L    Q  SE +R 
Sbjct  1596  KEALEEAEKAQVAAEKAIKQADEDIQGTQNL-LTSIESETAASEETLFNASQRISELERN  1654

Query  227   LAQL--QVAYHQLFQEYDNHIKSSVVGS-ERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             + +L  + A +    EY   +  +V  S E  +     +L ++ ++ E  +  K E    
Sbjct  1655  VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESAD  1714

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK-  342
              + +AE  +   +T   L AQA+                   K  L + LE+   +  + 
Sbjct  1715  ARRKAEMLQNEAKT---LLAQAN------------------SKLQLLKDLERKYEDNQRY  1753

Query  343   LKASCQESARIE  354
             L+   QE AR+E
Sbjct  1754  LEDKAQELARLE  1765


>sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 
GN=Dctn1 PE=1 SV=2
Length=1280

 Score = 56.8 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/254 (19%), Positives = 109/254 (43%), Gaps = 15/254 (6%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHF------QASQREEKEFLMCKFQEARKLV  104
            LQR L+E +E ++A+    + + E  +           +    E  E L  + +  ++ V
Sbjct  272  LQRRLKEAKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERV  331

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
            + L  +   LK + E+   +        +Q+ E  A +K    +L+     S S  +   
Sbjct  332  DELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKD---ALVRMRDLSSSEKQEHV  388

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM-----ERQA  219
            K  + +E + +      +Q E  +E L Q  S  +D+L+ Q  +   A  M     +R  
Sbjct  389  KLQKLMEKKNQELEVVRQQRERLQEELSQAES-TIDELKEQVDAALGAEEMVEMLTDRNL  447

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
              EEK +  +  V   +   E ++ ++ +   +E +   QL+    ++++A++ + A QE
Sbjct  448  NLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQE  507

Query  280  VIDKLKEEAEQHKI  293
             +   ++  ++++ 
Sbjct  508  TVADYQQTIKKYRQ  521


 Score = 55.2 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 67/337 (20%), Positives = 139/337 (41%), Gaps = 45/337 (13%)

Query  101  RKLVERLGLEKLDLKRQKEQ---ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
            R  V  L  +   L+ ++ +    L+E+E  K   +Q+ E K+ ++ Q   L   L+E++
Sbjct  221  RDQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEAK  280

Query  158  SRLEA---------------------------ATKECQALEGRARAASEQARQLESEREA  190
               EA                           A +  ++L+    A  E+  +L ++ E 
Sbjct  281  EAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEI  340

Query  191  LQQQH----------SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
            L+ +           S Q+ QL  Q   ++ AL   R  +S EK++  +LQ    +  QE
Sbjct  341  LKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQE  400

Query  241  YDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
             +   +      E     +  +++LK+Q+  A  A    + + D+     E+ + + ETV
Sbjct  401  LEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETV  460

Query  299  PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              L+A  ++   + + +  ARE   E +E L     +++    +++A+ +  A  +   K
Sbjct  461  GDLEAMNEM---NDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIK  517

Query  359  RHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
            ++ +++           +   A   +++ PP E  DF
Sbjct  518  KYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDF  554


 Score = 50.2 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 53/278 (19%), Positives = 108/278 (39%), Gaps = 30/278 (11%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEE------LLHFQASQREEKEF-LMCKFQEAR  101
            E+LQ+ +E  +E  D +    +IL+   EE         +Q  Q EE+   L       R
Sbjct  318  ESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMR  377

Query  102  KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             L      E + L++  E+  +E+E +++ ++++ E+ +    Q  S + EL+E      
Sbjct  378  DLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELS----QAESTIDELKEQVDAAL  433

Query  162  AATKECQALEGRARAASEQARQL----------ESEREALQQQHSVQVDQLRMQGQSVEA  211
             A +  + L  R     E+ R+L              + LQ+       +LR Q     A
Sbjct  434  GAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGA  493

Query  212  ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ------  265
             +R  ++     +  +A  Q    + +++   H++        ++   +E  +Q      
Sbjct  494  RVREAQKRVEAAQETVADYQQTIKK-YRQLTAHLQDVNRELTNQQEASVERQQQPPPETF  552

Query  266  --QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVL  301
              +++ AE    AK   ++  + E  Q    M  +   
Sbjct  553  DFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAF  590


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 92/230 (40%), Gaps = 24/230 (10%)

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
             E +  + ++    ++ + L  +      + ++LE  +  L+Q    +      Q     
Sbjct  215  KEEEGLRDQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQEWKSKMQEQQ-----  269

Query  211  AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
                      ++ +R+L + + A   L +  + +++     ++      L+      + A
Sbjct  270  ----------ADLQRRLKEAKEAKEAL-EAKERYMEEMADTADAIEMATLDK-----EMA  313

Query  271  EEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQ  330
            EE   + Q+ ++ LKE  ++    +E   +LKA+ +   +D  A     ++L E+   L+
Sbjct  314  EERAESLQQEVEALKERVDELTTDLE---ILKAEIEEKGSDGAASSYQLKQLEEQNARLK  370

Query  331  EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
            + L +++   S  K    +  ++ + + + +EV +         LS   +
Sbjct  371  DALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAES  420


>sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculus 
OX=9986 GN=MYH7 PE=1 SV=1
Length=736

 Score = 56.8 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 139/305 (46%), Gaps = 14/305 (5%)

Query  48   PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             E     L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  438  EEKTVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMN  497

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              L  +K  L+ +  +  R+++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  498  AELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  557

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
            K+ +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  558  KKKKALQEAHQQALDDLQAEEDKVNTLTKAKV----KLEQQVDDLEGSLEQEKKVRMDLE  613

Query  225  RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAK-QEV  280
            R   +L+    +L QE    +++     +   +K+  +L  L  +++  E+AL ++ Q+ 
Sbjct  614  RAKRKLEGDL-KLTQESIMDLENDKQQLDERLKKKDFELNALNARIED-EQALGSQLQKK  671

Query  281  IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQRE  339
            + +L+   E+ +  +E     +A+ +  ++D   E  +  E+L E       Q+E  ++ 
Sbjct  672  LKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKR  731

Query  340  YSKLK  344
             ++ +
Sbjct  732  EAEFQ  736


>sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis 
elegans OX=6239 GN=mrck-1 PE=1 SV=3
Length=1592

 Score = 56.8 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/251 (13%), Positives = 100/251 (40%), Gaps = 30/251 (12%)

Query  56   EENQELRDAIRQSN---QILRERCEELLHFQASQREEKEFL---MCKFQEARKLVERLGL  109
            EE++     I Q     QIL +R E+    Q  Q+ + E +     K +E ++  ++L +
Sbjct  486  EEDRNYESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAESEKKLKELKERNKQLVM  545

Query  110  EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
            EK +++R+ +     ++ +   +  + + +  ++A++  +   L   +  ++    E + 
Sbjct  546  EKSEIQRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEK  605

Query  170  LEGRARAASEQARQLESEREALQQQHSV------------------------QVDQLRMQ  205
             + +     E+ +++E+E+ AL ++                            +  L+  
Sbjct  606  AKKQVADFEEKLKEIETEKIALIKKQEEVTIEARKSVETDDHLSEEVVAAKNTIASLQAT  665

Query  206  GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
             +  E  ++  +Q   EE+           +  + +    +  +  +  +  ++   L+ 
Sbjct  666  NEERETEIKKLKQRMDEERASHTAQSEQEMKQLEAHYERAQKMLQDNVEQMNVENRGLRD  725

Query  266  QLQQAEEALVA  276
            ++++  + + A
Sbjct  726  EIEKLSQQMAA  736


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/283 (14%), Positives = 105/283 (37%), Gaps = 33/283 (12%)

Query  113  DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES---QSRLEAATKECQA  169
            +++   ++   + E +++       +  + KA++   L E Q            ++E + 
Sbjct  431  EIRAIAQRCQGDAELMEKSVDGFMVELENEKAELVQKLKEAQTIIAQHVAENPRSEEDRN  490

Query  170  LEGRARAASEQARQLES--EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK---  224
             E       ++ + L    E EAL QQ     D++  + +     L+   +    EK   
Sbjct  491  YESTIAQLKDEIQILNKRLEDEALAQQQQKPKDEIVAESEKKLKELKERNKQLVMEKSEI  550

Query  225  -RKLAQLQVAYHQLFQEYDNHIKS---------SVVGSERKRGMQLEDLKQQLQQAEEAL  274
             R+L  +     Q+  E    ++           V  S       ++ L+ + ++A++ +
Sbjct  551  QRELDNINDHLDQVLVEKATVVQQRDDMQAELADVGDSLLTEKDSVKRLQDEAEKAKKQV  610

Query  275  VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ--  332
               +E +          +I  E + ++K Q ++     +A +         +E++  +  
Sbjct  611  ADFEEKL---------KEIETEKIALIKKQEEV---TIEARKSVETDDHLSEEVVAAKNT  658

Query  333  LEQLQREYSKLKASCQE-SARIEDMRKRHVEVSQAPLPPAPAY  374
            +  LQ    + +   ++   R+++ R  H   S+  +    A+
Sbjct  659  IASLQATNEERETEIKKLKQRMDEERASHTAQSEQEMKQLEAH  701


>sp|Q15025|TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens 
OX=9606 GN=TNIP1 PE=1 SV=2
Length=636

 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 61/338 (18%), Positives = 129/338 (38%), Gaps = 25/338 (7%)

Query  66   RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREV  125
             Q   IL+  CE+L     + + + +  + +  +A + +    LE   L           
Sbjct  202  EQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGAS  261

Query  126  EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
                  + +    KA    Q  S+          L AA K+ + LE +     E  +Q +
Sbjct  262  GRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWD  321

Query  186  SEREALQQQHSVQVDQLRMQGQSVEAAL------RMERQAASEEKRKLAQLQVAYHQLFQ  239
                +++QQ+  ++ +LR +   ++  +      R ++Q   + K  LA+ ++   +  +
Sbjct  322  QHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQRDFDRKLLLAKSKIEMEETDK  381

Query  240  EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE-------------  286
            E        +    +    QL  L +Q +  E+ +    + +++                
Sbjct  382  EQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFG  441

Query  287  ------EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREY  340
                     + + ++    +LK Q  I++ DFQ ER  RE++ E+KE L++Q+E+LQ + 
Sbjct  442  SPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQV  501

Query  341  SKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSP  378
            +   A  +     E  R+   +  +        Y   P
Sbjct  502  TLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEP  539


>sp|O65272|KEA2_ARATH K(+) efflux antiporter 2, chloroplastic 
OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=2
Length=1174

 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 96/256 (38%), Gaps = 24/256 (9%)

Query  97   FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              ++   V  L     +L+  +    REV   K  +    +D A    ++  L   L ++
Sbjct  97   LCQSSDSVGDLVGNDRNLEFAEGSDDREVTFSKEEKDTREQDSAPSLEELRDL---LNKA  153

Query  157  QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               LE A+      E +A+  SE A  L+ E  +     +  ++ ++        A    
Sbjct  154  TKELEVASLNSTMFEEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESVAKEAV  213

Query  217  RQAASEEKRKLAQLQVAYHQLFQE-YDNHIKSSVVGSERKR-------GMQLEDLKQQLQ  268
            ++A        A+LQVA   L  E Y+   +S V    + +          +++ ++ L 
Sbjct  214  QKATMALSLAEARLQVALESLEAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLA  273

Query  269  QAEEALVAKQEVIDKLKEEAEQHKIVME--TVPVLKAQADIYKADFQAERQAREKLAEKK  326
              EE L   Q   D+L++E ++     E   +  LKA+ D+      AE+          
Sbjct  274  SCEEQLRRLQVKKDELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQA---------  324

Query  327  ELLQEQLEQLQREYSK  342
              +  +LE  QR    
Sbjct  325  --VAFELEATQRVNDA  338


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 54/287 (19%), Positives = 105/287 (37%), Gaps = 47/287 (16%)

Query  48   PETLQRCLEENQELRDA-------IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
             E  QR  E    L+D        + Q+  +++E  +E     A +  +K  +     EA
Sbjct  168  EEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESV--AKEAVQKATMALSLAEA  225

Query  101  RKLVERLGLE--------KLDLKRQKEQALREV----EHLKRCQQQMAEDKASVK-AQVT  147
            R  V    LE        + +++   +     +      +K CQ+ +A  +  ++  QV 
Sbjct  226  RLQVALESLEAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRRLQVK  285

Query  148  SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
                ELQ+   RL  A +  Q    +A         L  +  A + + + +V+   +  Q
Sbjct  286  K--DELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEIALQ  343

Query  208  SVEAAL------RMERQAASEEKRK-------LAQLQVAYHQLFQEY-----DNHIKSSV  249
              E  L         +    + K         L+++    HQ  ++       + + +  
Sbjct  344  RAEKTLFGSQTQETTQGKVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDVGTQS  403

Query  250  VGSERKRGMQLEDLKQQLQ-QAEEA----LVAKQEVIDKLKEEAEQH  291
              S+ + G    D  ++ + +AE++    L  KQEV   L  E+  H
Sbjct  404  YESDNENGKPTADFAKEAEGEAEKSKNVVLTKKQEVQKDLPRESSSH  450


>sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7 
PE=1 SV=2
Length=1935

 Score = 56.8 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 142/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  874   EEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  933

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  R+++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  934   AELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLT  993

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  +++   + +
Sbjct  994   KEKKALQEAHQQALDDLQAEEDKVNTLTKAKV----KLEQQVDDLEGSLDQDKKVRMDLE  1049

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +L  L  +++  +      Q+ +
Sbjct  1050  RAKRKLEGDL-KLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKL  1108

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1109  KELQARIEELEEELEAERTARAKVEKLRSDLSRE---LEEISERLEEAGGATSVQIEMNK  1165

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1166  KREAEFQKMRRDLEEATLQHEATAAA  1191


 Score = 48.7 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 40/266 (15%), Positives = 105/266 (39%), Gaps = 14/266 (5%)

Query  51    LQRCLEENQELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             L   +  N +L++ I    + N +L+   EEL          ++    +  E  + V+ L
Sbjct  1657  LDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLL  1716

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRL  160
               +   L  QK++   ++  L+   ++  ++  + + +          +  EL++ Q   
Sbjct  1717  HSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTS  1776

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                 +    +E   +    +  + E       ++   Q+ +L  + + +E  L  E++  
Sbjct  1777  AHLERMKNNMEQTIKDLQHRLDEAEQIALKGGKK---QLQKLEARVRELENELEAEQKRN  1833

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             +E  + + + +    +L  + +   K+ +   +    +QL+ +K   +QAEEA       
Sbjct  1834  AESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLK-VKAYKRQAEEAEEQANTN  1892

Query  281   IDKLKEEAEQHKIVMETVPVLKAQAD  306
             + K ++   +     E   + ++Q +
Sbjct  1893  LSKFRKVQHELDEAEERADIAESQVN  1918


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 61/337 (18%), Positives = 120/337 (36%), Gaps = 45/337 (13%)

Query  44    EQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEELLHF  82
             EQ     LQ+ L+E Q                     +LR  + +  + + ER EE    
Sbjct  1097  EQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGA  1156

Query  83    QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAEDKAS  141
              + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   K  
Sbjct  1157  TSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQK  1216

Query  142   VKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQ  201
             ++ + +    EL +  S +E   K    LE   R   +Q  +  S+ E   Q+    + +
Sbjct  1217  LEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEE-TQRSVNDLTR  1275

Query  202   LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE------RK  255
              R + Q+    L  +         +L + ++ Y Q  ++    ++  V          + 
Sbjct  1276  QRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS  1335

Query  256   RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                  + L++Q ++  EA    Q V+ K   E  Q +   ET  + +             
Sbjct  1336  ARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRT------------  1383

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                 E+L E K+ L ++L+  +     + A C    +
Sbjct  1384  ----EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1416


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 54/311 (17%), Positives = 128/311 (41%), Gaps = 6/311 (2%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L+R LEE  + ++A+  + Q  R  C+ L      + E K  L     +A   V +  
Sbjct  1313  EDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWR  1372

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              +      Q+ +   E+E  K+   Q  +D       V +    L++++ RL+   ++  
Sbjct  1373  TKYETDAIQRTE---ELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLM  1429

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                 R+ AA+    + +   + +  +   + ++ + + +S +   R       + K    
Sbjct  1430  VDVERSNAAAAALDKKQRNFDKILVEWKQKYEESQSELESSQKEARSLSTELFKLKNAYE  1489

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  + + + F+  + +++  +     + G   + + + L++  + L A++  +    EEA
Sbjct  1490  E-SLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHE-LEKIRKQLEAEKLELQSALEEA  1547

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
             E      E   +L+AQ +  +   + ER+  EK  E ++  +  L  +    + L A  +
Sbjct  1548  EASLEH-EEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETR  1606

Query  349   ESARIEDMRKR  359
                    ++K+
Sbjct  1607  SRNEALRVKKK  1617


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 53/312 (17%), Positives = 113/312 (36%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1279  KLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARH  1338

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1339  DCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1398

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + L + + 
Sbjct  1399  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILVEWKQ  1458

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+   
Sbjct  1459  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGS  1518

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q +  K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1519  TGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1578

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1579  KDEEMEQAKRNH  1590


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 129/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L +  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  R+
Sbjct  1035  EGSLDQDKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARI  1094

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLG----ELQESQSRLEAA  163
               E+  L  Q ++ L+E++      ++  E + + +A+V  L      EL+E   RLE A
Sbjct  1095  EDEQ-ALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA  1153

Query  164   TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                        +    + +++  + E    QH      LR +     A L  +       
Sbjct  1154  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1213

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
             K+KL + +  +     +  ++++  +        M      Q  +   +A   ++ V D 
Sbjct  1214  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDL  1273

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
              ++ A+      E    L  Q D  +A      + +    ++ E L+ QLE+  +  + L
Sbjct  1274  TRQRAKLQTENGE----LSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNAL  1329

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1330  AHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRT  1373


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 48/258 (19%), Positives = 97/258 (38%), Gaps = 37/258 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ++LQ  L++ Q   D   ++N  L+E    +             L  + +E R +VE+  
Sbjct  1644  KSLQSLLKDTQIQLDDAVRANDDLKENIAIVER-------RNNLLQAELEELRAVVEQT-  1695

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                   +R ++ A +E+       Q +     S+  Q   +  +L + Q+ +E A +EC+
Sbjct  1696  ------ERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECR  1749

Query  169   ALEGRARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVE----AALR  214
               E +A+ A   A  +  E           E ++      +  L+ +    E       +
Sbjct  1750  NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKNNMEQTIKDLQHRLDEAEQIALKGGK  1809

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV---------GSERKRGMQLEDLKQ  265
              + Q      R+L     A  +   E    ++ S             +RK  ++L+DL  
Sbjct  1810  KQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVD  1869

Query  266   QLQQAEEALVAKQEVIDK  283
             +LQ   +A   + E  ++
Sbjct  1870  KLQLKVKAYKRQAEEAEE  1887


 Score = 35.6 bits (80),  Expect = 1.1, Method: Composition-based stats.
 Identities = 55/308 (18%), Positives = 111/308 (36%), Gaps = 16/308 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ET +R  +  QE    + +      +   EL   +     EK  L    +EA   +E   
Sbjct  1496  ETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEE  1555

Query  109   LEKLDLKRQKEQALREVEH-LKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              + L  + +  Q   E+E  L    ++M + K +    V SL   L         A +  
Sbjct  1556  GKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVK  1615

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             + +EG       Q          +  +   QV  L+   +  +  L    +A  + K  +
Sbjct  1616  KKMEGDLNEMEIQLSHAN----RMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENI  1671

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             A ++   + L Q     +++ V  +ER R +  ++L +  ++ +        +I++ K+ 
Sbjct  1672  AIVE-RRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKM  1730

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
                         + + Q ++ +A  Q  R A EK  +         E+L++E        
Sbjct  1731  DA---------DLSQLQTEVEEA-VQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLE  1780

Query  348   QESARIED  355
             +    +E 
Sbjct  1781  RMKNNMEQ  1788


>sp|E9Q557|DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp 
PE=1 SV=1
Length=2883

 Score = 56.8 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 60/341 (18%), Positives = 141/341 (41%), Gaps = 17/341 (5%)

Query  21    AADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIR--QSNQILRERCEE  78
             A  Q   G E    K   L +   Q      +  +   Q L DA +  Q      ER ++
Sbjct  1442  AQQQKATGSEMSQRK-QQLEIELRQVTQMRTEESMRYKQSLDDAAKTIQDKNKEIERLKQ  1500

Query  79    LLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAED  138
             L+  + ++R+  E    K Q  +  +++      +   + +   +E+  L+   ++++++
Sbjct  1501  LVDKETNERKCLEDENSKLQRVQYDLQKANNSATEAMSKLKVQEQELTRLRIDYERVSQE  1560

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQ  198
             +      +T +   L++ Q + + A +E   L+  A   S + + LE E EA+++    Q
Sbjct  1561  RTVKDQDITRIQSSLKDLQLQKQKAEEELSRLKRTASDESSKRKMLEEELEAMRRSLKEQ  1620

Query  199   VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
               ++    Q +E A  + ++ + ++ R+   +   + +  Q     ++   +  E  R  
Sbjct  1621  AVKITNLTQQLEQA-SIVKKRSEDDLRQQRDVLDGHVREKQRTQEELRRLSLDVEALRRQ  1679

Query  259   QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
              +++ ++ ++QA       Q+ I+       + KI +E +  L             E   
Sbjct  1680  LVQE-QENVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSL------------TENLT  1726

Query  319   REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
             +E L  ++EL   +LE       + +A   +++ I ++R +
Sbjct  1727  KEHLMLEEELRNLRLEYDDLRRGRSEADSDKNSTISELRSQ  1767


 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 54/335 (16%), Positives = 128/335 (38%), Gaps = 34/335 (10%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ--EARKLVERLG  108
             + R   EN++L+D I + N  +      L   +  +R E+  L  K    E  +  +RL 
Sbjct  1251  MDRLSRENRDLKDEIVRLNDSI------LQATEQRRRAEENALQQKACGSETMQKKQRLE  1304

Query  109   LEKLDLKRQKEQ----ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL----  160
             +E   + +Q+ +      + +E   +  Q   ++   +KA+         E ++ L    
Sbjct  1305  IELKQVIQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEYQEEAKRRWEYENELSKVR  1364

Query  161   ----EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 E         E           QL  ++E     +  Q+D L  + +S+   ++  
Sbjct  1365  NSYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLCEEVKRL  1424

Query  217   RQAASEEKRKL------AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
             +   ++    L      AQ Q A      +    ++  +    + R  +    KQ L  A
Sbjct  1425  KNTLAQTTENLRRVEENAQQQKATGSEMSQRKQQLEIELRQVTQMRTEESMRYKQSLDDA  1484

Query  271   EEALVAKQEVIDKLKEEAEQHKIVMETVP-----VLKAQADIYKADFQAERQAREKLAEK  325
              + +  K + I++LK+  ++     + +      + + Q D+ KA+  A     +   ++
Sbjct  1485  AKTIQDKNKEIERLKQLVDKETNERKCLEDENSKLQRVQYDLQKANNSATEAMSKLKVQE  1544

Query  326   KELLQEQLEQLQREYSKL---KASCQESARIEDMR  357
             +EL + +++  +    +    +   +  + ++D++
Sbjct  1545  QELTRLRIDYERVSQERTVKDQDITRIQSSLKDLQ  1579


 Score = 49.8 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 58/325 (18%), Positives = 128/325 (39%), Gaps = 15/325 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + +Q+  E+N   + ++ ++ + ++++ +E+   +A  +EE +       E  K+     
Sbjct  1309  QVIQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEYQEEAKRRWEYENELSKVRNSYD  1368

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E + LK Q E    E+   K    Q+   K       +    ++        +  +E +
Sbjct  1369  EEIISLKNQFET---EINITKTTIHQLTMQKE---EDTSGYRAQIDNLTRENRSLCEEVK  1422

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              L+      +E  R++E       QQ      ++  + Q +E  LR   Q  +EE  +  
Sbjct  1423  RLKNTLAQTTENLRRVEENA----QQQKATGSEMSQRKQQLEIELRQVTQMRTEESMRYK  1478

Query  229   QLQVAYHQLFQEYDNHIK--SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             Q      +  Q+ +  I+    +V  E      LED   +LQ+ +  L   Q+  +   E
Sbjct  1479  QSLDDAAKTIQDKNKEIERLKQLVDKETNERKCLEDENSKLQRVQYDL---QKANNSATE  1535

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                + K+  + +  L+   +    +   + Q   ++    + LQ Q ++ + E S+LK +
Sbjct  1536  AMSKLKVQEQELTRLRIDYERVSQERTVKDQDITRIQSSLKDLQLQKQKAEEELSRLKRT  1595

Query  347   CQESARIEDMRKRHVEVSQAPLPPA  371
               + +    M +  +E  +  L   
Sbjct  1596  ASDESSKRKMLEEELEAMRRSLKEQ  1620


 Score = 48.7 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 59/321 (18%), Positives = 134/321 (42%), Gaps = 20/321 (6%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMC---K  96
             H+  +Q   E L+R   + + LR  + Q  + +++      HFQ +  ++   L     +
Sbjct  1655  HVREKQRTQEELRRLSLDVEALRRQLVQEQENVKQAHLRNEHFQKAIEDKSRSLNESKIE  1714

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              +  + L E L  E L L+ +      E + L+R + +   DK    + ++ L  +LQ S
Sbjct  1715  IERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDK---NSTISELRSQLQIS  1771

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQ---QQHSVQVDQLRMQGQSVEAAL  213
              +R          L+       ++  + + +        Q+   Q  Q+  + +S+   +
Sbjct  1772  NNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKSQCTQVVQERESLLVKI  1831

Query  214   RMERQAASEEKRKLAQLQVAYH--QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
             ++      ++K +L +L+   +  +   E ++ +K  +   +++    L   K Q  + E
Sbjct  1832  KV----LEQDKARLQRLEDELNRAKATLEAESRVKQRLECEKQQIQNDLNQWKTQYSRKE  1887

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
             E +   +   +K + E    +  +E     + QA+I + + +  R+  +   E +  L+ 
Sbjct  1888  ETIRKIESEREKSEREKNSLRSEIE-----RLQAEIKRIEERCRRKLEDSSRETQSQLES  1942

Query  332   QLEQLQREYSKLKASCQESAR  352
             +  +LQ+E  KL+     S R
Sbjct  1943  ERCRLQKEIEKLRQRPYGSHR  1963


 Score = 37.1 bits (84),  Expect = 0.39, Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (38%), Gaps = 12/207 (6%)

Query  96    KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAE----DKASVKAQVTSLLG  151
             + +E  + + RL  E  D KR+++      +  K    Q+ +    +K ++  Q      
Sbjct  1115  QIKELNEKITRLTYEIEDEKRRRKTVEDRFDQQKNDYDQLQKARQCEKENLSWQKLESEK  1174

Query  152   ELQESQSRLEAATKECQALEGRARAASEQA----RQLESEREALQQQHSVQVDQLRMQGQ  207
              ++E +  +E      Q    R R    +          E   L+ ++  +++  +   +
Sbjct  1175  AIKEKEYEIERLRVLLQEEGARKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIK  1234

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
                  + M+++  S+  R         ++  ++    +  S++ +  +R    E+  QQ 
Sbjct  1235  ----EISMQKEDDSKNLRNQMDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQK  1290

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIV  294
                 E +  KQ +  +LK+  +Q    
Sbjct  1291  ACGSETMQKKQRLEIELKQVIQQRSED  1317


 Score = 36.4 bits (82),  Expect = 0.70, Method: Composition-based stats.
 Identities = 42/250 (17%), Positives = 97/250 (39%), Gaps = 25/250 (10%)

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D  R   + L+ +E LK    ++   +  ++        E       L+   ++ QA   
Sbjct  1024  DYYRFLSEMLKSLEDLKLKNTKIEVLEEELRL-ARDANSENCNKNKFLDQNLQKYQAECS  1082

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
             + +A      +L+ + E   +     +D+   Q + +   +        +EKR+   ++ 
Sbjct  1083  QFKAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKTVED  1142

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK----EEA  288
              + Q   +YD   K+     E     +LE        +E+A+  K+  I++L+    EE 
Sbjct  1143  RFDQQKNDYDQLQKARQCEKENLSWQKLE--------SEKAIKEKEYEIERLRVLLQEEG  1194

Query  289   EQHKIVMETVPVLKAQA--------DIYKADFQAERQAREKLAEKKE----LLQEQLEQL  336
              + +     +  ++           + Y+ +    +   ++++ +KE     L+ Q+++L
Sbjct  1195  ARKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQMDRL  1254

Query  337   QREYSKLKAS  346
              RE   LK  
Sbjct  1255  SRENRDLKDE  1264


 Score = 33.7 bits (75),  Expect = 4.2, Method: Composition-based stats.
 Identities = 49/249 (20%), Positives = 93/249 (37%), Gaps = 14/249 (6%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEAR  101
             QG    LQR  E  ++  +  ++       R +E         +E+E L+ K    ++ +
Sbjct  1779  QGLINDLQRERENLRQEIEKFQKQALEASNRIQESKSQCTQVVQERESLLVKIKVLEQDK  1838

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
               ++RL  E    K   E   R  + L+  +QQ+  D    K Q +     +++ +S  E
Sbjct  1839  ARLQRLEDELNRAKATLEAESRVKQRLECEKQQIQNDLNQWKTQYSRKEETIRKIESERE  1898

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
              + +E  +L         + +++E               +L    +  ++ L  ER    
Sbjct  1899  KSEREKNSLRSEIERLQAEIKRIEERCRR----------KLEDSSRETQSQLESERCRLQ  1948

Query  222   EEKRKLAQLQVAYHQLFQ-EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             +E  KL Q     H+  Q EY+  + SS +  +  R         + Q  ++  + K   
Sbjct  1949  KEIEKLRQRPYGSHRETQTEYEWTVDSSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLK  2008

Query  281   IDKLKEEAE  289
               K  EE  
Sbjct  2009  GKKSVEEVA  2017


>sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B 
PE=1 SV=4
Length=1983

 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 44/260 (17%), Positives = 99/260 (38%), Gaps = 6/260 (2%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQE  99
              L  EQ   +  QR   E  E   A+ +   +L    EEL          +     +  E
Sbjct  1698  QLKEEQAGRDEEQRLAAELHEQAQALERRASLLAAELEELRAALEQGERSRRLAEQELLE  1757

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
             A + +  L  +   L  QK++   ++  L    ++ A+++   + +    + +       
Sbjct  1758  ATERLNLLHSQNTGLLNQKKKLEADLAQLSGEVEEAAQERREAEEKAKKAITDAAMMAEE  1817

Query  160   LEAATKECQALEGRARAASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRM  215
             L+        LE   +   +  R+L++  E  +Q        QV +L  + + +EA L  
Sbjct  1818  LKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQKLEAKVRELEAELDA  1877

Query  216   ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEA  273
             E++  +E  + + + +    +L  + +   K+     +    +Q  ++  K+Q ++AE+ 
Sbjct  1878  EQKKHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKLQSKVKSYKRQFEEAEQQ  1937

Query  274   LVAKQEVIDKLKEEAEQHKI  293
                      K + E +  + 
Sbjct  1938  ANTNLAKYRKAQHELDDAEE  1957


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 60/313 (19%), Positives = 130/313 (42%), Gaps = 13/313 (4%)

Query  49    ETLQRCLEENQELRDAIRQSN---QILRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             E++ R  +E + L++A +Q+    Q   +R   L   +    ++ E L C  ++ +KL  
Sbjct  1036  ESVARLTKEKKALQEAHQQALGDLQAEEDRVSALTKAKLRLEQQVEDLECSLEQEKKLRM  1095

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
                  K  L+   +     V    + +QQ+ E      ++++ L   +++ Q       K
Sbjct  1096  DTERAKRKLEGDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLSLRVEDEQLLGAQMQK  1155

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
             + + L+ RA    E+     + R  +++Q +    +L    + +E A           ++
Sbjct  1156  KIKELQARAEELEEELEAERAARARVEKQRAEAARELEELSERLEEAGGASAGQREGCRK  1215

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             + A+L     +L +    H +++V    RK+     +L +Q+   +      ++   +L+
Sbjct  1216  REAELGRLRRELEEAALRH-EATVAALRRKQAEGAAELGEQVDSLQRVRQKLEKEKSELR  1274

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK---ELLQEQLEQLQREYSK  342
              E +     +ET+   KA A+         R   ++L+E K   E LQ QL     +  +
Sbjct  1275  MEVDDLAANVETLTRAKASAEKLC------RTYEDQLSEAKIKVEELQRQLADASTQRGR  1328

Query  343   LKASCQESARIED  355
             L+    E +R+ +
Sbjct  1329  LQTESGELSRLLE  1341


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 97/244 (40%), Gaps = 14/244 (6%)

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              + A++    LG E   L+   E+AL  +E LKR  + + E+ + +  QV+     +QE 
Sbjct  1516  LEAAQRESRGLGTELFRLRHGHEEALEALETLKRENKNLQEEISDLTDQVSLSGKSIQEL  1575

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
             +   +A   E   ++     A       E++   +Q    +++ Q++ +     A    E
Sbjct  1576  EKTKKALEGEKSEIQAALEEAEGALELEETKTLRIQ----LELSQVKAEVDRKLAEKDEE  1631

Query  217   RQAA-SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
                     +R +  LQ +     +  +  ++           ++L+ L    +QA EA  
Sbjct  1632  CANLRRNHQRAVESLQASLDAETRARNEALRLKKKMEGDLNDLELQ-LGHATRQATEAQA  1690

Query  276   AKQEVIDKLKEEAEQHKIVM-------ETVPVLKAQADIYKADFQAERQAREKLAEKKEL  328
             A + +  +LKEE               E    L+ +A +  A+ +  R A E+  E+   
Sbjct  1691  ATRLMQAQLKEEQAGRDEEQRLAAELHEQAQALERRASLLAAELEELRAALEQ-GERSRR  1749

Query  329   LQEQ  332
             L EQ
Sbjct  1750  LAEQ  1753


 Score = 38.7 bits (88),  Expect = 0.13, Method: Composition-based stats.
 Identities = 48/278 (17%), Positives = 111/278 (40%), Gaps = 25/278 (9%)

Query  96    KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQE  155
             +  +A + +  L  E   L+     A  + + L+     + ++K  +  Q       LQ 
Sbjct  890   RSAQAEEELAALRAELRGLRGALAAAEAKRQELEETHVSITQEKNDLALQ-------LQA  942

Query  156   SQSRLEAATKECQ-------ALEGRARAASEQARQLESEREAL---QQQHSVQVDQLRMQ  205
              Q  L  A + C         LEG+ +  SE+    E     L   +++   +  +L+  
Sbjct  943   EQDNLADAEERCHLLIKSKVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKD  1002

Query  206   GQSVE---AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
                +E   A    E+QA   + + L +   A  +         K ++  + ++    L+ 
Sbjct  1003  IDDLELTLAKAEKEKQATENKVKNLTEEMAALDESVARLTKEKK-ALQEAHQQALGDLQA  1061

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
              + ++    +A +  ++ ++ L+   EQ K +       K + +    D +  +++    
Sbjct  1062  EEDRVSALTKAKLRLEQQVEDLECSLEQEKKLRMDTERAKRKLE---GDLKLTQESVADA  1118

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESARI-EDMRKR  359
             A+ K+ L+E+L++   E S+L    ++   +   M+K+
Sbjct  1119  AQDKQQLEEKLKKKDSELSQLSLRVEDEQLLGAQMQKK  1156


 Score = 37.5 bits (85),  Expect = 0.27, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 85/229 (37%), Gaps = 18/229 (8%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             Q  L + +E    + +S   L  + +EL      + E    L  + ++       L  + 
Sbjct  944   QDNLADAEERCHLLIKSKVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDI  1003

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
              DL+    +A +E +  +   + + E+ A++   V  L  E +  Q   + A  + QA E
Sbjct  1004  DDLELTLAKAEKEKQATENKVKNLTEEMAALDESVARLTKEKKALQEAHQQALGDLQAEE  1063

Query  172   GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
              R  A       L   +  L+Q           Q + +E +L  E++   + +R   +L+
Sbjct  1064  DRVSA-------LTKAKLRLEQ-----------QVEDLECSLEQEKKLRMDTERAKRKLE  1105

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
                    +   +  +      E+ +    E  +  L+  +E L+  Q  
Sbjct  1106  GDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLSLRVEDEQLLGAQMQ  1154


 Score = 36.4 bits (82),  Expect = 0.67, Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 61/170 (36%), Gaps = 16/170 (9%)

Query  94    MCKFQEARKLVERLGLEKLDLKRQKEQALREVEH--LKRCQQQMAEDKASVKAQVTSLLG  151
             + K Q+    +ER+        R+ +  L E E   L+  ++Q+ +    ++A+V  L  
Sbjct  1818  LKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQK----LEAKVRELEA  1873

Query  152   ELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQ----------QHSVQVDQ  201
             EL   Q +   A K  +  E R +  + QA +       +Q            +  Q ++
Sbjct  1874  ELDAEQKKHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKLQSKVKSYKRQFEE  1933

Query  202   LRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG  251
                Q  +  A  R  +    + + +    +   ++L     + +      
Sbjct  1934  AEQQANTNLAKYRKAQHELDDAEERADMAETQANKLRARTRDALGPKHKE  1983


>sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP 
PE=1 SV=3
Length=2871

 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 57/317 (18%), Positives = 118/317 (37%), Gaps = 28/317 (9%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ--EARKLVERLG  108
             L R   EN++L+D I + N  +      L   +  +R E+  L  K    E  +  + L 
Sbjct  1239  LDRLSRENRDLKDEIVRLNDSI------LQATEQRRRAEENALQQKACGSEIMQKKQHLE  1292

Query  109   LEKLDLKRQKEQ----ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL----  160
             +E   + +Q+ +      + +E   +  Q   ++   +KA+         E ++ L    
Sbjct  1293  IELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVR  1352

Query  161   ----EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 E         E           QL  ++E     +  Q+D L  + +S+   ++  
Sbjct  1353  NNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEIKRL  1412

Query  217   RQAASEEKRKLA------QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
             +   ++    L       Q Q A      +    ++  +    + R  +    KQ L  A
Sbjct  1413  KNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYKQSLDDA  1472

Query  271   EEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ-AERQAREKLAEKKELL  329
              + +  K + I++LK+  ++     + +    A+    + D Q A   A E + + K   
Sbjct  1473  AKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETINKLKVQE  1532

Query  330   QEQLEQLQREYSKLKAS  346
             QE L +L+ +Y ++   
Sbjct  1533  QE-LTRLRIDYERVSQE  1548


 Score = 56.4 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 62/324 (19%), Positives = 129/324 (40%), Gaps = 14/324 (4%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMC---K  96
             HL  +Q   E L+R   E + LR  + Q  + +++      HFQ +  ++   L     +
Sbjct  1643  HLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESKIE  1702

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              +  + L E L  E L L+ +      E + L+R + +   DK    A +  L  +LQ S
Sbjct  1703  IERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDK---NATILELRSQLQIS  1759

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
              +R          L+       ++  + + +      +     +Q   Q      +L ++
Sbjct  1760  NNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCT-QVVQERESLLVK  1818

Query  217   RQAASEEKRKLAQLQVAYHQLFQ--EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
              +   ++K +L +L+   ++     E +  +K  +   +++    L   K Q  + EEA+
Sbjct  1819  IKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAI  1878

Query  275   VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
                +   +K + E    +  +E     + QA+I + + +  R+  +   E +  L+ +  
Sbjct  1879  RKIESEREKSEREKNSLRSEIE-----RLQAEIKRIEERCRRKLEDSTRETQSQLETERS  1933

Query  335   QLQREYSKLKASCQESARIEDMRK  358
             + QRE  KL+     S R      
Sbjct  1934  RYQREIDKLRQRPYGSHRETQTEC  1957


 Score = 54.5 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 55/323 (17%), Positives = 132/323 (41%), Gaps = 16/323 (5%)

Query  39    LHLPSEQGAPETLQRCLEENQELRDAIR--QSNQILRERCEELLHFQASQREEKEFLMCK  96
             L +   Q      +  +   Q L DA +  Q      ER ++L+  + + R+  E    +
Sbjct  1447  LEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENAR  1506

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              Q  +  +++      +   + +   +E+  L+   +++++++      +T     L+E 
Sbjct  1507  LQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQNSLKEL  1566

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
             Q + +   +E   L+  A   S + ++LE E E +++    Q  ++    Q +E A  + 
Sbjct  1567  QLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQA-SIV  1625

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++ + ++ R+   +   + +  Q     ++      E  R   L++ ++ ++QA      
Sbjct  1626  KKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQE-QESVKQAHLRNEH  1684

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
              Q+ I+       + KI +E +  L             E   +E L  ++EL   +LE  
Sbjct  1685  FQKAIEDKSRSLNESKIEIERLQSL------------TENLTKEHLMLEEELRNLRLEYD  1732

Query  337   QREYSKLKASCQESARIEDMRKR  359
                  + +A   ++A I ++R +
Sbjct  1733  DLRRGRSEADSDKNATILELRSQ  1755


 Score = 51.8 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 66/318 (21%), Positives = 134/318 (42%), Gaps = 24/318 (8%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + +Q+  E+N   + ++ ++ + ++++ +E+   +A  +EE +       E  K+     
Sbjct  1297  QVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYD  1356

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E + LK Q E    E+   K    Q+   K    +   + +  L      L     E +
Sbjct  1357  EEIISLKNQFET---EINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSE---EIK  1410

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              L+      +E  R++E +     QQ      ++  + Q +E  LR   Q  +EE  +  
Sbjct  1411  RLKNTLTQTTENLRRVEEDI----QQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYK  1466

Query  229   QLQVAYHQLFQEYDNHIK--SSVVGSERKRGMQLEDLKQQLQQA----EEALVAKQEVID  282
             Q      +  Q+ +  I+    ++  E      LED   +LQ+     ++A  +  E I+
Sbjct  1467  QSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETIN  1526

Query  283   KLK---EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             KLK   +E  + +I  E V   +   D     FQ    + ++L  +K+ ++E+L +L+R 
Sbjct  1527  KLKVQEQELTRLRIDYERVSQERTVKDQDITRFQ---NSLKELQLQKQKVEEELNRLKRT  1583

Query  340   YSKLKASCQESARIEDMR  357
              S  + SC+     E++ 
Sbjct  1584  AS--EDSCKRKKLEEELE  1599


 Score = 39.8 bits (91),  Expect = 0.052, Method: Composition-based stats.
 Identities = 43/227 (19%), Positives = 87/227 (38%), Gaps = 18/227 (8%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R   QI   R  EL       + E+E L  + ++ +K          + K Q  Q ++E
Sbjct  1752  LRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQE  1811

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
              E L    + + +DKA ++     L  EL  ++S LEA T+  Q LE   +       Q 
Sbjct  1812  RESLLVKIKVLEQDKARLQ----RLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQW  1867

Query  185   ESEREALQQ----------QHSVQVDQLRMQGQSVEAALRME----RQAASEEKRKLAQL  230
             +++    ++          +   + + LR + + ++A ++      R+   +  R+    
Sbjct  1868  KTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQ  1927

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
                    +Q   + ++    GS R+   + E      +   + L  K
Sbjct  1928  LETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKK  1974


 Score = 37.1 bits (84),  Expect = 0.38, Method: Composition-based stats.
 Identities = 44/270 (16%), Positives = 102/270 (38%), Gaps = 25/270 (9%)

Query  93    LMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGE  152
             ++ +  +       L     D  R   + L+ +E LK    ++   +  ++        E
Sbjct  992   ILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRL-ARDANSE  1050

Query  153   LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
                    L+   ++ QA   + +A      +L+ + E   +     +D+   Q + +   
Sbjct  1051  NCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEK  1110

Query  213   LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
             +        +EKR+   ++  + Q   +YD   K+     E     +LE        +E+
Sbjct  1111  ITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLE--------SEK  1162

Query  273   ALVAKQEVIDKLK----EEAEQHKIVMETVPVLKAQA--------DIYKADFQAERQARE  320
             A+  K+  I++L+    EE  + +     +  ++           + Y+ +    +   +
Sbjct  1163  AIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIK  1222

Query  321   KLAEKKE----LLQEQLEQLQREYSKLKAS  346
             +++ +KE     L+ QL++L RE   LK  
Sbjct  1223  EISMQKEDDSKNLRNQLDRLSRENRDLKDE  1252


 Score = 35.6 bits (80),  Expect = 1.0, Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (38%), Gaps = 12/207 (6%)

Query  96    KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAE----DKASVKAQVTSLLG  151
             + +E  + + RL  E  D KR+++      +  K    Q+ +    +K ++  Q      
Sbjct  1103  QIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEK  1162

Query  152   ELQESQSRLEAATKECQALEGRARAASEQA----RQLESEREALQQQHSVQVDQLRMQGQ  207
              ++E +  +E      Q    R R    +          E   L+ ++  +++  +   +
Sbjct  1163  AIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIK  1222

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
                  + M+++  S+  R         ++  ++    +  S++ +  +R    E+  QQ 
Sbjct  1223  ----EISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQK  1278

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIV  294
                 E +  KQ +  +LK+  +Q    
Sbjct  1279  ACGSEIMQKKQHLEIELKQVMQQRSED  1305


 Score = 34.4 bits (77),  Expect = 2.6, Method: Composition-based stats.
 Identities = 50/270 (19%), Positives = 102/270 (38%), Gaps = 30/270 (11%)

Query  51    LQRCLEENQELRDAIRQS-NQILRERCEELLHFQASQRE------EKEFLMCK---FQEA  100
             LQ  + + Q  R+ +RQ   +  ++  E     Q S+ +      E+E L+ K    ++ 
Sbjct  1766  LQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQERESLLVKIKVLEQD  1825

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
             +  ++RL  E    K   E   R  + L+  +QQ+  D    K Q +     +++ +S  
Sbjct  1826  KARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESER  1885

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
             E + +E  +L         + +++E               +L    +  ++ L  ER   
Sbjct  1886  EKSEREKNSLRSEIERLQAEIKRIEERCRR----------KLEDSTRETQSQLETERSRY  1935

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ---LQQAEEALVAK  277
               E  KL Q     H+         ++    +     +  + L+++   +Q  E  L+ K
Sbjct  1936  QREIDKLRQRPYGSHR-------ETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDK  1988

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADI  307
               +   LK +    ++  E  P L+    I
Sbjct  1989  TTLDKLLKGKKSVEEVASEIQPFLRGAGSI  2018


>sp|Q61897|KT33B_MOUSE Keratin, type I cuticular Ha3-II OS=Mus 
musculus OX=10090 GN=Krt33b PE=1 SV=2
Length=404

 Score = 55.6 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 53/313 (17%), Positives = 110/313 (35%), Gaps = 44/313 (14%)

Query  76   CEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVE-HLKRCQQQ  134
            CE    F  ++RE  +FL  +     + V +L  E  +L+ + ++  ++ +  +    Q 
Sbjct  48   CEG--SFNGNERETMQFLNDRLASYMEKVRQLERENAELECKIQERNQQQDPLVCPAYQA  105

Query  135  MAEDKASVKAQV-------------------------TSLLGEL---QESQSRLEAATKE  166
                   ++ ++                         T    EL   Q  +S L    + 
Sbjct  106  YFRTIEELQQKILCGKSENGRLVVQIDNAKLAADDFRTKYESELSLRQLVESDLNGLRRI  165

Query  167  CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
               L         Q   L  E   L+Q H  +V+ LR Q       + ++     +  R 
Sbjct  166  LDELTLCKSDLEAQVESLRQELLCLKQNHEEEVNTLRCQLGD-RLNVEVDAAPTVDLNRV  224

Query  227  LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
            L + +  Y  L +       ++    E     Q E+L +Q+  + E L + Q  I +L+ 
Sbjct  225  LNETRCQYEALVE-------TNRREVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRR  277

Query  287  EAEQHKIVMETVPVLKAQADIYKADFQAERQAREK-----LAEKKELLQEQLEQLQREYS  341
                 +I ++    ++   +   A+ +A   ++       +   +  L E    L+R+  
Sbjct  278  TVNALEIELQAQHSMRNSLENTLAESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQ  337

Query  342  KLKASCQESARIE  354
            + +      AR+E
Sbjct  338  EYQVLLDVKARLE  350


 Score = 48.7 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 49/210 (23%), Positives = 78/210 (37%), Gaps = 19/210 (9%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
            L+R L+E    +  +    + LR+   ELL  + +  EE   L C+  + R  VE     
Sbjct  162  LRRILDELTLCKSDLEAQVESLRQ---ELLCLKQNHEEEVNTLRCQLGD-RLNVEVDAAP  217

Query  111  KLDLKRQKEQALREVEHLKRCQQQMAED-----KASVKAQVTSLLGELQESQSRLEAATK  165
             +DL R   +   + E L    ++  E+        +  QV S   +LQ  Q+ +    +
Sbjct  218  TVDLNRVLNETRCQYEALVETNRREVEEWFTTQTEELNKQVVSSSEQLQSCQAEIIELRR  277

Query  166  ECQALEGRARAASEQARQLES---EREALQQQHSVQVDQLRMQGQSVEAALR-------M  215
               ALE   +A       LE+   E EA       QV  L    +S    +R        
Sbjct  278  TVNALEIELQAQHSMRNSLENTLAESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQ  337

Query  216  ERQAASEEKRKLAQLQVAYHQLFQEYDNHI  245
            E Q   + K +L      Y  L +  D  +
Sbjct  338  EYQVLLDVKARLECEINTYRGLLESEDCKL  367


>sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus 
OX=10090 GN=Myo5b PE=1 SV=2
Length=1818

 Score = 56.4 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/274 (18%), Positives = 113/274 (41%), Gaps = 21/274 (8%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKF--QEARKLVERLG  108
             LQ+   E + L DA  + N  LR+R  +L H  A  ++EKE+L  +   Q   +  +   
Sbjct  993   LQKAHSERRVLEDAHNKENGELRKRVADLEHENALLKDEKEYLNNQILCQSKAESSQSSV  1052

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E L +K++ E+     ++L +   Q+ +   +++ + T    +   +QS LE+ +    
Sbjct  1053  EENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDEQTPGHRKNPSNQSSLESDSNYPS  1112

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS--EEKRK  226
                       +  +Q+E               +L+ + + +E   +  +      ++  K
Sbjct  1113  ISTSEIGDTEDALQQVEEIGIEKAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQDSK  1172

Query  227   LAQLQVAYHQLFQE------YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK---  277
               Q++   + L  +      Y++  +  +    +K    L +L++    A++A+      
Sbjct  1173  KGQVEQQNNGLDVDQDADIAYNSLKRQELESENKKLKNDLNELRK--AVADQAMQDNSTH  1230

Query  278   ------QEVIDKLKEEAEQHKIVMETVPVLKAQA  305
                     ++++LK   E+ ++  E V +L+ Q 
Sbjct  1231  SSPDSYSLLLNQLKLANEELEVRKEEVLILRTQI  1264


 Score = 36.7 bits (83),  Expect = 0.46, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 89/229 (39%), Gaps = 20/229 (9%)

Query  88    EEKEFLMCKFQEA-----RKLVERLGLEKLDLKRQKEQALREVEHLK---RCQQQMAEDK  139
             E K  ++ K+        R L ER     +    ++ +A +E++ LK   R  + +    
Sbjct  862   EHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLN  921

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQV  199
               ++ +V  L  ++       +   +     E  +   S  A ++E  ++ L      Q 
Sbjct  922   VGMENKVVQLQRKID------DQNKEFKTLSEQLSAVTSSHAVEVEKLKKELAHYQQNQE  975

Query  200   DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ  259
                 +Q Q    +LR E Q A  E+R    L+ A+++   E    + + +         +
Sbjct  976   ADTSLQLQEEVQSLRTELQKAHSERR---VLEDAHNKENGELRKRV-ADLEHENALLKDE  1031

Query  260   LEDLKQQLQQAEEALVAKQEVIDK--LKEEAEQHKIVMETVPVLKAQAD  306
              E L  Q+    +A  ++  V +   +K+E E+ +   + +    +Q +
Sbjct  1032  KEYLNNQILCQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLE  1080


>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 
PE=1 SV=4
Length=1979

 Score = 56.4 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 66/364 (18%), Positives = 144/364 (40%), Gaps = 29/364 (8%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E LQR  E  Q+    +++  Q   + CEE    Q   + E E     + EA ++ 
Sbjct  861   QAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETEL----YAEAEEMR  916

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              RL  +K +L+    +    +E  +   QQ+  +K  ++ Q+  L  +L+E ++  +   
Sbjct  917   VRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQ  976

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              E    +G+ +   +    +E +   L ++  +         +   + L        E+ 
Sbjct  977   LEKVTADGKIKKMEDDILIMEDQNNKLTKERKL--------LEERVSDLTTNLAEEEEKA  1028

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM-------------QLEDLKQQLQQAE  271
             + L +L+  +  +  E +  +K      +    +             Q+ +L+ Q+ + +
Sbjct  1029  KNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELK  1088

Query  272   EALVAKQEVIDK----LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
               L  K+E +      L++E  Q    ++ +  L++     + D ++E+ AR K  ++K 
Sbjct  1089  AQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKR  1148

Query  328   LLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
              L E+LE L+ E      +      +   R++ V V +  L        + +    Q+ +
Sbjct  1149  DLSEELEALKTELEDTLDTTATQQELRAKREQEVTVLKRALEEETRTHEAQVQEMRQKHT  1208

Query  388   PPEE  391
                E
Sbjct  1209  QAVE  1212


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 52/295 (18%), Positives = 120/295 (41%), Gaps = 4/295 (1%)

Query  58    NQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ  117
             N+   +AI+Q  + L+ + ++        R  +E +    +E  K  + L  E + L+  
Sbjct  1643  NKAREEAIKQLRK-LQAQMKDYQRDLDDARAAREEIFATARENEKKAKNLEAELIQLQED  1701

Query  118   KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA  177
                A R  +     +++MAE+ AS  +  TSL  E +  ++R+    +E           
Sbjct  1702  LAAAERARKQADLEKEEMAEELASANSGRTSLQDEKRRLEARIAQLEEELDEEHSNIETM  1761

Query  178   SEQARQLESEREALQQQHSV---QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
             S++ R+   + E L  + +       +     Q +E   +  R    E +  +     + 
Sbjct  1762  SDRMRKAVQQAEQLNNELATERATAQKNENARQQLERQNKELRSKLQEMEGAVKSKFKST  1821

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
                 +     ++  +    R++    + L+Q+ ++ ++AL+  ++   + ++  +Q +  
Sbjct  1822  IAALEAKIASLEEQLEQEAREKQAAAKTLRQKDKKLKDALLQVEDERKQAEQYKDQAEKG  1881

Query  295   METVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
                +  LK Q +  + + Q     R KL  + +   E  + L RE + LK+  + 
Sbjct  1882  NLRLKQLKRQLEEAEEESQRINANRRKLQRELDEATESNDALGREVAALKSKLRR  1936


 Score = 45.6 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 49/239 (21%), Positives = 104/239 (44%), Gaps = 11/239 (5%)

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                LK + E  +   + + +   ++ + K +++ QV  +  +L+E +  L+AA      L
Sbjct  1512  NKMLKAEMEDLVSSKDDVGKNVHELEKSKRTLEQQVEEMKTQLEELEDELQAAEDAKLRL  1571

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             E   +A      Q E + +A  +Q+  +  QL  Q    E  L  ER+  +       +L
Sbjct  1572  EVNMQAMKS---QFERDLQARDEQNEEKRRQLLKQLHEHETELEDERKQRALAAAAKKKL  1628

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
             +V    L  + D+  K+     ++ R +Q + +K   +  ++A  A++E+    +E  ++
Sbjct  1629  EVDVKDLESQVDSANKAREEAIKQLRKLQAQ-MKDYQRDLDDARAAREEIFATARENEKK  1687

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
              K        L+A+    + D  A  +AR++   +KE + E+L       + L+   + 
Sbjct  1688  AKN-------LEAELIQLQEDLAAAERARKQADLEKEEMAEELASANSGRTSLQDEKRR  1739


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 57/345 (17%), Positives = 132/345 (38%), Gaps = 13/345 (4%)

Query  39    LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ  98
             + L  E+ + + L++   + +     + +    L+ +  EL    A + EE +  + + +
Sbjct  1047  VRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLE  1106

Query  99    EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
             +          +  +L+        ++E  K  + +  + K  +  ++ +L  EL+++  
Sbjct  1107  DETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLD  1166

Query  159   RLEAATKECQALEGRA----RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
                   +     E       RA  E+ R  E++ + ++Q+H+  V++L  Q +  + A  
Sbjct  1167  TTATQQELRAKREQEVTVLKRALEEETRTHEAQVQEMRQKHTQAVEELTEQLEQFKRAKA  1226

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
                +     ++  A L      L Q      K  V   ++K  +QL+DL+ +    E   
Sbjct  1227  NLDKTKQTLEKDNADLANEIRSLSQ-----AKQDVEHKKKKLEVQLQDLQSKYSDGERVR  1281

Query  275   VAKQEVIDKLKEEAEQHKIVMETVPV----LKAQADIYKADFQAERQAREKLAEKKELLQ  330
                 E + KL+ E E    ++         L        +  Q  ++  ++   +K  + 
Sbjct  1282  TELNEKVHKLQIEVENVTSLLNEAESKNIKLTKDVATLGSQLQDTQELLQEETRQKLNVT  1341

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
              +L QL+ + + L+    E    +   +RH+      L  +   L
Sbjct  1342  TKLRQLEDDKNSLQEQLDEEVEAKQNLERHISTLTIQLSDSKKKL  1386


 Score = 42.9 bits (99),  Expect = 0.005, Method: Composition-based stats.
 Identities = 50/340 (15%), Positives = 129/340 (38%), Gaps = 22/340 (6%)

Query  74    ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE--QALREVEHLKRC  131
             +R ++L   +  QR    +L  +  +  +L  ++       ++++E      E++  K  
Sbjct  814   KRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKDEELQRTKER  873

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES-----  186
             QQ+   +   ++ + T L  E    Q +L+A T+     E      + + ++LE      
Sbjct  874   QQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEM  933

Query  187   -----EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL----  237
                  E E   QQ   +  +++ Q   +E  L  E  A  + + +         ++    
Sbjct  934   EARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDI  993

Query  238   --FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE---EALVAKQEVIDKLKEEAEQHK  292
                ++ +N +       E +      +L ++ ++A+   +     + +I +L+   ++ +
Sbjct  994   LIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEE  1053

Query  293   IVMETVPVLKAQADIYKADFQAERQA-REKLAEKKELLQEQLEQLQREYSKLKASCQESA  351
                + +  +K + +   +D   +    + ++AE K  L ++ E+LQ   ++L+    +  
Sbjct  1054  KSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKN  1113

Query  352   RIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   +              +  ++      Q+R   EE
Sbjct  1114  NALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEE  1153


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 45/305 (15%), Positives = 109/305 (36%), Gaps = 9/305 (3%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E  +R      + +  + + N  L      L   +     +K+ L  + Q+ +       
Sbjct  1219  EQFKRAKANLDKTKQTLEKDNADLANEIRSLSQAKQDVEHKKKKLEVQLQDLQSKYSDGE  1278

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
               + +L  +  +   EVE++     +       +   V +L  +LQ++Q  L+  T++  
Sbjct  1279  RVRTELNEKVHKLQIEVENVTSLLNEAESKNIKLTKDVATLGSQLQDTQELLQEETRQKL  1338

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              +  + R   +    L+ +      +       L     ++   L   ++   E    + 
Sbjct  1339  NVTTKLRQLEDDKNSLQEQL----DEEVEAKQNLERHISTLTIQLSDSKKKLQEFTATVE  1394

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
              ++    +L +E ++  +      +     +LE  K +LQQ  + LV     +D  ++  
Sbjct  1395  TMEEGKKKLQREIESLTQQ--FEEKAASYDKLEKTKNRLQQELDDLV---VDLDNQRQLV  1449

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                +   +    + A+     + +  ER   E  A +KE     L +   E  + K   +
Sbjct  1450  SNLEKKQKKFDQMLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELE  1509

Query  349   ESARI  353
              + ++
Sbjct  1510  RTNKM  1514


 Score = 38.3 bits (87),  Expect = 0.16, Method: Composition-based stats.
 Identities = 50/293 (17%), Positives = 120/293 (41%), Gaps = 26/293 (9%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL----GLE  110
             + E ++ +  + Q  + ++ + EEL     +  + K  L    Q  +   ER       +
Sbjct  1533  VHELEKSKRTLEQQVEEMKTQLEELEDELQAAEDAKLRLEVNMQAMKSQFERDLQARDEQ  1592

Query  111   KLDLKR----QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
               + +R    Q  +   E+E  ++ +   A  K  ++  V  L  ++  +    E A K+
Sbjct  1593  NEEKRRQLLKQLHEHETELEDERKQRALAAAAKKKLEVDVKDLESQVDSANKAREEAIKQ  1652

Query  167   CQALEGRARAAS---EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
              + L+ + +      + AR    E  A  +++  +   L  +   ++     E  AA+E 
Sbjct  1653  LRKLQAQMKDYQRDLDDARAAREEIFATARENEKKAKNLEAELIQLQ-----EDLAAAER  1707

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
              RK A L+           N  ++S+   +R+   ++  L+++L +    +       D+
Sbjct  1708  ARKQADLEKEEMAEELASANSGRTSLQDEKRRLEARIAQLEEELDEEHSNIETMS---DR  1764

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
             +++  +Q + +   +   +A A       Q    AR++L  + + L+ +L+++
Sbjct  1765  MRKAVQQAEQLNNELATERATA-------QKNENARQQLERQNKELRSKLQEM  1810


 Score = 35.6 bits (80),  Expect = 1.1, Method: Composition-based stats.
 Identities = 53/347 (15%), Positives = 136/347 (39%), Gaps = 46/347 (13%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCE-ELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E L+  L+  ++ +  +  + Q ++ + E +L        E++  L+ +  E    +E  
Sbjct  1555  EELEDELQAAEDAKLRLEVNMQAMKSQFERDLQARDEQNEEKRRQLLKQLHEHETELEDE  1614

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
               ++      K++   +V+ L+       + +     Q+  L  ++++ Q  L+ A    
Sbjct  1615  RKQRALAAAAKKKLEVDVKDLESQVDSANKAREEAIKQLRKLQAQMKDYQRDLDDARAAR  1674

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVD------------------------QLR  203
             + +   AR   ++A+ LE+E   LQ+  +                             L+
Sbjct  1675  EEIFATARENEKKAKNLEAELIQLQEDLAAAERARKQADLEKEEMAEELASANSGRTSLQ  1734

Query  204   MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ---EYDNHIKSSVVGSERKRGM--  258
              + + +EA +    +   EE   +  +     +  Q   + +N + +    +++      
Sbjct  1735  DEKRRLEARIAQLEEELDEEHSNIETMSDRMRKAVQQAEQLNNELATERATAQKNENARQ  1794

Query  259   ----QLEDLKQQLQQAEEALVAKQEVI------------DKLKEEAEQHKIVMETVPVLK  302
                 Q ++L+ +LQ+ E A+ +K +              ++L++EA + +   +T+    
Sbjct  1795  QLERQNKELRSKLQEMEGAVKSKFKSTIAALEAKIASLEEQLEQEAREKQAAAKTLRQKD  1854

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
              +        + ER+  E+  ++ E    +L+QL+R+  + +   Q 
Sbjct  1855  KKLKDALLQVEDERKQAEQYKDQAEKGNLRLKQLKRQLEEAEEESQR  1901


>sp|P13538|MYSS_CHICK Myosin heavy chain, skeletal muscle, adult 
OS=Gallus gallus OX=9031 PE=1 SV=4
Length=1939

 Score = 56.0 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 61/363 (17%), Positives = 156/363 (43%), Gaps = 22/363 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  877   EEKMVVLLQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDETIAKLT  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE-  223
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   +  
Sbjct  997   KEKKALQEAHQQTLDDLQVEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1052

Query  224   --KRKL-AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
               KRKL   L++A+  +    ++  K  +    +K+  ++  ++ +++  +   +  Q+ 
Sbjct  1053  RAKRKLEGDLKLAHDSIMDLEND--KQQLDEKLKKKDFEISQIQSKIEDEQALGMQLQKK  1110

Query  281   IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQRE  339
             I +L+   E+ +  +E     +A+A+ ++AD   E  +  E+L E       Q+E  ++ 
Sbjct  1111  IKELQARIEELEEEIEAERTSRAKAEKHRADLSRELEEISERLEEAGGATAAQIEMNKKR  1170

Query  340   YSKL--------KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
              ++         +A+ Q  A    +RK+H + +                L  ++     E
Sbjct  1171  EAEFQKMRRDLEEATLQHEATAAALRKKHADSTAELGEQIDNLQRVKQKLEKEKSELKME  1230

Query  392   PPD  394
               D
Sbjct  1231  IDD  1233


 Score = 47.5 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 58/331 (18%), Positives = 119/331 (36%), Gaps = 4/331 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E  E      + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1282  RLQTETGEYSRQAEEKDALISQLSRGKQGFTQQIEELKRHLEEEIKAKNALAHALQSARH  1341

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D +  +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1342  DCELLREQYEEEQEAKGELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1401

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1402  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKILAEWKQ  1461

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     M+   E+    L+  +      Q+ I  L E+  +
Sbjct  1462  KYEETQTELEASQKESRSLSTELFKMKNAYEESLDHLETLKRENKNLQQEIADLTEQIAE  1521

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K   +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1522  GGKAVHELEKVKKHVEQEKSELQASLEEAEASLEHEEGKILRLQLELNQIKSEIDRKIAE  1581

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
             +   I+ +++ H+ + ++      A + S  
Sbjct  1582  KDEEIDQLKRNHLRIVESMQSTLDAEIRSRN  1612


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 115/282 (41%), Gaps = 37/282 (13%)

Query  48    PETLQRCLEENQELRDAIRQSNQI---LRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              +T QR   E ++L   + +SN     L ++ +      A  +++ E    + + ++K  
Sbjct  1418  EKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKILAEWKQKYEETQTELEASQKES  1477

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS--------------LL  150
               L  E   +K   E++L  +E LKR  + + ++ A +  Q+                + 
Sbjct  1478  RSLSTELFKMKNAYEESLDHLETLKRENKNLQQEIADLTEQIAEGGKAVHELEKVKKHVE  1537

Query  151   GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ----G  206
              E  E Q+ LE A    +  EG+      +  Q++SE +    +   ++DQL+       
Sbjct  1538  QEKSELQASLEEAEASLEHEEGKILRLQLELNQIKSEIDRKIAEKDEEIDQLKRNHLRIV  1597

Query  207   QSVEAALRME----------RQAASEEKRKLAQLQVAYHQLFQEYDNHIKS---SVVGSE  253
             +S+++ L  E          ++    +  ++       +++  E   ++++   ++  ++
Sbjct  1598  ESMQSTLDAEIRSRNEALRLKKKMEGDLNEMEIQLSHANRMAAEAQKNLRNTQGTLKDTQ  1657

Query  254   RKRGMQL---EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK  292
                   L   EDLK+Q+   E      Q  +++L+   EQ +
Sbjct  1658  IHLDDALRTQEDLKEQVAMVERRANLLQAEVEELRGALEQTE  1699


 Score = 41.7 bits (96),  Expect = 0.013, Method: Composition-based stats.
 Identities = 37/279 (13%), Positives = 105/279 (38%), Gaps = 14/279 (5%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R  E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +  
Sbjct  1665  RTQEDLKEQVAMVERRANLLQAEVEELRGALEQTERSRKVAEQELLDATERVQLLHTQNT  1724

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
              L   K++   ++  ++   +   ++  + + +    + +       L+        LE 
Sbjct  1725  SLINTKKKLETDIVQIQSEMEDTIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLER  1784

Query  173   RARAASEQAR----QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
               +   +  +    +L+   +   +    Q+ +L  + + +E  +  E++ ++E  + + 
Sbjct  1785  MKKNMDQTVKDLHVRLDEAEQLALKGGKKQLQKLEARVRELEGEVDSEQKRSAEAVKGVR  1844

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE-E  287
             +    Y +  +E     +       R     L+DL  +LQ   ++   + E  ++L    
Sbjct  1845  K----YERRVKELTYQCEEDRKNILR-----LQDLVDKLQMKVKSYKRQAEEAEELSNVN  1895

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
               + + +   +   + +ADI ++     R    ++  KK
Sbjct  1896  LSKFRKIQHELEEAEERADIAESQVNKLRVKSREIHGKK  1934


 Score = 41.4 bits (95),  Expect = 0.018, Method: Composition-based stats.
 Identities = 49/317 (15%), Positives = 119/317 (38%), Gaps = 33/317 (10%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
              +   + +    E+  E   A+ +  ++ +   +E    QAS  E +  L  +  +  +L
Sbjct  1505  NKNLQQEIADLTEQIAEGGKAVHELEKVKKHVEQEKSELQASLEEAEASLEHEEGKILRL  1564

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQ-MAEDKASVKAQV----------TSLLGE  152
                L   K ++ R+  +   E++ LKR   + +   ++++ A++            + G+
Sbjct  1565  QLELNQIKSEIDRKIAEKDEEIDQLKRNHLRIVESMQSTLDAEIRSRNEALRLKKKMEGD  1624

Query  153   LQESQSRLE-------AATKECQALEGRARAASEQARQLESEREALQQQ----------H  195
             L E + +L         A K  +  +G  +            +E L++Q           
Sbjct  1625  LNEMEIQLSHANRMAAEAQKNLRNTQGTLKDTQIHLDDALRTQEDLKEQVAMVERRANLL  1684

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERK  255
               +V++LR   +  E + ++  Q   +   ++  L      L       +++ +V  + +
Sbjct  1685  QAEVEELRGALEQTERSRKVAEQELLDATERVQLLHTQNTSLINTK-KKLETDIVQIQSE  1743

Query  256   RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                 +++ +   ++A++A+         + EE ++ +     +  +K   D    D    
Sbjct  1744  MEDTIQEARNAEEKAKKAITDAAM----MAEELKKEQDTSAHLERMKKNMDQTVKDLHVR  1799

Query  316   RQAREKLAEKKELLQEQ  332
                 E+LA K    Q Q
Sbjct  1800  LDEAEQLALKGGKKQLQ  1816


 Score = 38.3 bits (87),  Expect = 0.16, Method: Composition-based stats.
 Identities = 63/360 (18%), Positives = 124/360 (34%), Gaps = 32/360 (9%)

Query  44    EQGAPETLQRCL-EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             EQ A   LQR L + N E+     +      +R EEL   +    +  +      +    
Sbjct  1353  EQEAKGELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNA  1412

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                 L   K  L+ + E  + +VE        + + + +    +     + +E+Q+ LEA
Sbjct  1413  KCASLEKTKQRLQNEVEDLMVDVERSNAACAALDKKQKNFDKILAEWKQKYEETQTELEA  1472

Query  163   ATKECQALEGRARAAS-------EQARQLESEREALQQ----------------------  193
             + KE ++L               +    L+ E + LQQ                      
Sbjct  1473  SQKESRSLSTELFKMKNAYEESLDHLETLKRENKNLQQEIADLTEQIAEGGKAVHELEKV  1532

Query  194   --QHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG  251
                   +  +L+   +  EA+L  E       + +L Q++    +   E D  I      
Sbjct  1533  KKHVEQEKSELQASLEEAEASLEHEEGKILRLQLELNQIKSEIDRKIAEKDEEIDQLKRN  1592

Query  252   SERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
               R        L  +++   EAL  K+++   L E   Q           +      +  
Sbjct  1593  HLRIVESMQSTLDAEIRSRNEALRLKKKMEGDLNEMEIQLSHANRMAAEAQKNLRNTQGT  1652

Query  312   FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPA  371
              +  +   +     +E L+EQ+  ++R  + L+A  +E     +  +R  +V++  L  A
Sbjct  1653  LKDTQIHLDDALRTQEDLKEQVAMVERRANLLQAEVEELRGALEQTERSRKVAEQELLDA  1712


 Score = 37.9 bits (86),  Expect = 0.19, Method: Composition-based stats.
 Identities = 57/328 (17%), Positives = 126/328 (38%), Gaps = 15/328 (5%)

Query  41    LPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
             +  EQ     LQ+ ++E Q   + + +  +  R    +    +A    E E +  + +EA
Sbjct  1097  IEDEQALGMQLQKKIKELQARIEELEEEIEAERTSRAKAEKHRADLSRELEEISERLEEA  1156

Query  101   -------RKLVERLGLEKLDLKRQKEQALREVEHLKRC-QQQMAEDKASVKAQVTSLLGE  152
                     ++ ++   E   ++R  E+A  + E      +++ A+  A +  Q+ +L   
Sbjct  1157  GGATAAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSTAELGEQIDNLQRV  1216

Query  153   LQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAA  212
              Q+ +        E   L     + S+    LE     L+ Q S ++     Q Q +   
Sbjct  1217  KQKLEKEKSELKMEIDDLASNMESVSKAKANLEKMCRTLEDQLS-EIKTKEEQNQRMIND  1275

Query  213   LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
             L  +R     E  + ++       L  +     +      E  +    E++K +   A  
Sbjct  1276  LNTQRARLQTETGEYSRQAEEKDALISQLSRGKQGFTQQIEELKRHLEEEIKAKNALA-H  1334

Query  273   ALVAKQEVIDKLKEEAEQHKIVMETV--PVLKAQADIYKADFQAERQA---REKLAEKKE  327
             AL + +   + L+E+ E+ +     +   + KA +++ +   + E  A    E+L E K+
Sbjct  1335  ALQSARHDCELLREQYEEEQEAKGELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKK  1394

Query  328   LLQEQLEQLQREYSKLKASCQESARIED  355
              L ++L+  +     + A C    + + 
Sbjct  1395  KLAQRLQDAEEHVEAVNAKCASLEKTKQ  1422


 Score = 35.2 bits (79),  Expect = 1.5, Method: Composition-based stats.
 Identities = 50/315 (16%), Positives = 120/315 (38%), Gaps = 22/315 (7%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
              + +++ +  + K       ++    ++  L  Q ++ ++E++      ++  E + + +
Sbjct  1073  ENDKQQLDEKLKKKDFEISQIQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERTSR  1132

Query  144   AQVTS----LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQV  199
             A+       L  EL+E   RLE A     A     +    + +++  + E    QH    
Sbjct  1133  AKAEKHRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKMRRDLEEATLQHEATA  1192

Query  200   DQLRMQGQSVEAALRME-------RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
               LR +     A L  +       +Q   +EK +L ++++       E  +  K+++   
Sbjct  1193  AALRKKHADSTAELGEQIDNLQRVKQKLEKEKSEL-KMEIDDLASNMESVSKAKANLEKM  1251

Query  253   ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              R    QL ++K + +Q +  +        +L+ E  ++    E    L +Q        
Sbjct  1252  CRTLEDQLSEIKTKEEQNQRMINDLNTQRARLQTETGEYSRQAEEKDALISQLS------  1305

Query  313   QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAP  372
                 + ++   ++ E L+  LE+  +  + L  + Q +    ++ +   E  Q       
Sbjct  1306  ----RGKQGFTQQIEELKRHLEEEIKAKNALAHALQSARHDCELLREQYEEEQEAKGELQ  1361

Query  373   AYLSSPLALPSQRRS  387
               LS   +  +Q R+
Sbjct  1362  RALSKANSEVAQWRT  1376


>sp|Q00174|LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster 
OX=7227 GN=LanA PE=1 SV=2
Length=3712

 Score = 56.0 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 58/308 (19%), Positives = 109/308 (35%), Gaps = 18/308 (6%)

Query  50    TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
             TL +  ++   LRDA+ + N   +   EEL   +   +E         Q+A +L     +
Sbjct  2378  TLNQINQKLDNLRDALNELNSFNKNVDEELPVREDQHKEADALTDQAEQKAAEL----AI  2433

Query  110   EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
             +  DL  Q        E   +     +    +V+A         Q++ S    AT +   
Sbjct  2434  KAQDLAAQYTDMTASAEPAIKAATAYSGIVEAVEAA----QKLSQDAISAAGNATDKTDG  2489

Query  170   LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQ  229
             +E RA  A   +  L    +  +Q      D L  +  +    ++      +  + +L  
Sbjct  2490  IEERAHLADTGSTDL---LQRARQSLQKVQDDLEPRLNASAGKVQKISAVNNATEHQLKD  2546

Query  230   LQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
             +     QL  E    +      S       LE LK  L+  E   V   + ++  K    
Sbjct  2547  INKLIDQLPAESQRDM---WKNSNANASDALEILKNVLEILEPVSVQTPKELE--KAHGI  2601

Query  290   QHKIVMETVPVLKA--QADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
                + +    V +A  Q D  +       +  E + E++  +  Q  QL +E   LKA  
Sbjct  2602  NRDLDLTNKDVSQANKQLDDVEGSVSKLNELAEDIEEQQHRVGSQSRQLGQEIENLKAQV  2661

Query  348   QESARIED  355
             + + ++ +
Sbjct  2662  EAARQLAN  2669


>sp|P25391|LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens 
OX=9606 GN=LAMA1 PE=1 SV=2
Length=3075

 Score = 55.6 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 66/402 (16%), Positives = 150/402 (37%), Gaps = 62/402 (15%)

Query  2     NRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQEL  61
              ++L +S L E +Q   G    + V  E   L K     L S Q      +R  +E+Q+L
Sbjct  1598  TKYLQESLLKENMQKDLGKIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDL  1657

Query  62    RDAIRQSNQILRERCEELLHFQASQREEKEFLM-----CKFQE-ARKLVERLGLEKLDLK  115
               AI +    + E  E+      +Q  +++FL+        Q+    L+E + +   D  
Sbjct  1658  AIAIERLQMSITEIMEKTT---LNQTLDEDFLLPNSTLQNMQQNGTSLLEIMQI--RDFT  1712

Query  116   RQKEQALREV----EHLKRCQQQMAE-------DKASVKAQVTSLLGELQESQSRLEAAT  164
             +  + A  E+    + L + Q+   +        K +    ++    EL+ +++ +  A 
Sbjct  1713  QLHQNATLELKAAEDLLSQIQENYQKPLEELEVLKEAASHVLSKHNNELKAAEALVREAE  1772

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
              + Q         +   R+   ++  +Q++ ++   +L +QG      +          +
Sbjct  1773  AKMQESNHLLLMVNANLREFSDKKLHVQEEQNLT-SELIVQG---RGLIDAAAAQTDAVQ  1828

Query  225   RKLAQLQVAYHQLF------QEYDNHIKSSVVGSERKRGM-QLEDLKQQLQQAEEALVAK  277
               L  L+    +L       + + + +   +        + + ED   + Q+  + L + 
Sbjct  1829  DALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSG  1888

Query  278   ---------------------QEVIDKLKEEAEQ-HKIVMETVPVLKAQADIYKADFQAE  315
                                  Q +I++ +E A   H+ V ET   L +++ +       +
Sbjct  1889  LENIRNVSLNATSAAYVHYNIQSLIEESEELARDAHRTVTET--SLLSESLVSNGKAAVQ  1946

Query  316   RQAR-----EKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
             R +R       L+ K   +  +L +L+ + ++ + +  E  R
Sbjct  1947  RSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQENAVEITR  1988


>sp|P02565|MYH1B_CHICK Myosin-1B OS=Gallus gallus OX=9031 GN=MYH1B 
PE=2 SV=3
Length=1940

 Score = 55.6 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 155/362 (43%), Gaps = 20/362 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + L  + ++  ++ 
Sbjct  879   EEKMVSLLQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEMN  938

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  939   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDETIAKLT  998

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  999   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1054

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    ++ QE    +++     +   +K+  ++  ++ +++  +   +  Q+ I
Sbjct  1055  RAKRKLEGDL-KMTQESTMDLENDKQQLDEKLKKKDFEISQIQSKIEDEQALGMQLQKKI  1113

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQREY  340
              +L+   E+ +  +E     +A+A+ ++AD   E  +  E+L E       Q++  ++  
Sbjct  1114  KELQARIEELEEEIEAERTSRAKAEKHRADLSRELEEISERLEEAGGATAAQIDMNKKRE  1173

Query  341   SKL--------KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             ++         +A+ Q  A    +RK+H + +                L  ++     E 
Sbjct  1174  AEFQKMRRDLEEATLQHEATAAALRKKHADSTADVGEQIDNLQRVKQKLEKEKSELKMEI  1233

Query  393   PD  394
              D
Sbjct  1234  DD  1235


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 60/333 (18%), Positives = 125/333 (38%), Gaps = 14/333 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
               R +EE   L   + +  Q   ++ EEL      + + K+      Q AR       L 
Sbjct  1292  YSRQVEEKDALISQLSRGKQAFTQQIEELKRHLEEEIKAKKCPAHALQSAR---HDCDLL  1348

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
             +   + ++E        L +   ++A+ +   +        EL+E++ +L       Q  
Sbjct  1349  REQYEEEQEAKGELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQ---RLQDA  1405

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             E    A + +   LE  ++ LQ +    V+ L +  +   AA     +      + L++ 
Sbjct  1406  EEHVEAVNSKCASLEKTKQRLQNE----VEDLMIDVERSNAACAALDKKQKNFDKILSEW  1461

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E +   K S   S     M+   E+    L+  +      Q+ I  L E+ 
Sbjct  1462  KQKYEETQAELEASQKESRSLSTELFKMKNAYEESLDHLETLKRENKNLQQEISDLTEQI  1521

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  +K Q +  K++ Q   E        E+ ++L+ QLE  Q +    +  
Sbjct  1522  AEGGKAIHELEKVKKQIEQEKSELQTALEEAEASLEHEEGKILRVQLELNQVKSDIDRKI  1581

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
              ++   I+ +++ H+ V  +      A + S  
Sbjct  1582  AEKDEEIDQLKRNHLRVVDSMQSTLDAEIRSRN  1614


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 102/258 (40%), Gaps = 5/258 (2%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R  E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +  
Sbjct  1667  RSQEDLKEQVAMVERRANLLQAEIEELRAALEQTERSRKVAEQELLDASERVQLLHTQNT  1726

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
              L   K++   ++  ++   +   ++  + + +    + +       L+        LE 
Sbjct  1727  SLINTKKKLESDISQIQSEMEDTIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLER  1786

Query  173   RARAASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
               +   +  + L+   +  +Q        Q+ +L  + + +E  +  E++ ++E  + + 
Sbjct  1787  MKKNLDQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVDAEQKRSAEAVKGVR  1846

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             + +    +L  + +   K+ +   +    +Q++ +K   +QAEEA       + K ++  
Sbjct  1847  KYERRVKELTYQSEEDRKNVLRLQDLVDKLQMK-VKSYKRQAEEAEELSNVNLSKFRKIQ  1905

Query  289   EQHKIVMETVPVLKAQAD  306
              + +   E   + ++Q +
Sbjct  1906  HELEEAEERADIAESQVN  1923


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 54/333 (16%), Positives = 135/333 (41%), Gaps = 30/333 (9%)

Query  48    PETLQRCLEENQELRDAIRQSN-------QILRERCEELLHFQASQREEKEFLMCKFQEA  100
              +T QR   E ++L   + +SN       +  +   + L  ++    E +  L    +E+
Sbjct  1420  EKTKQRLQNEVEDLMIDVERSNAACAALDKKQKNFDKILSEWKQKYEETQAELEASQKES  1479

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV--------------  146
             R L      E   +K   E++L  +E LKR  + + ++ + +  Q+              
Sbjct  1480  RSL----STELFKMKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKAIHELEKVK  1535

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ-  205
               +  E  E Q+ LE A    +  EG+      +  Q++S+ +    +   ++DQL+   
Sbjct  1536  KQIEQEKSELQTALEEAEASLEHEEGKILRVQLELNQVKSDIDRKIAEKDEEIDQLKRNH  1595

Query  206   ---GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
                  S+++ L  E ++ +E  R   +++   +++  +  +  + +   +++        
Sbjct  1596  LRVVDSMQSTLDAEIRSRNEALRLKKKMEGDLNEIEIQLSHANRQA-AEAQKNLRNTQGV  1654

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
             LK      ++AL +++++ +++     +  ++   +  L+A  +  +   +   Q     
Sbjct  1655  LKDTQIHLDDALRSQEDLKEQVAMVERRANLLQAEIEELRAALEQTERSRKVAEQELLDA  1714

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESARIED  355
             +E+ +LL  Q   L     KL++   +     +
Sbjct  1715  SERVQLLHTQNTSLINTKKKLESDISQIQSEME  1747


 Score = 37.5 bits (85),  Expect = 0.26, Method: Composition-based stats.
 Identities = 52/357 (15%), Positives = 126/357 (35%), Gaps = 10/357 (3%)

Query  44    EQGAPETLQRCL-EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             EQ A   LQR L + N E+     +      +R EEL   +    +  +      +    
Sbjct  1355  EQEAKGELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNS  1414

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                 L   K  L+ + E  + +VE        + + + +    ++    + +E+Q+ LEA
Sbjct  1415  KCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQKNFDKILSEWKQKYEETQAELEA  1474

Query  163   ATKECQALEGRARAAS-------EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM  215
             + KE ++L               +    L+ E + LQQ+ S   +Q+   G+++   L  
Sbjct  1475  SQKESRSLSTELFKMKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKAIH-ELEK  1533

Query  216   ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
              ++   +EK +L           +  +  I    +   + +      + ++ ++ ++   
Sbjct  1534  VKKQIEQEKSELQTALEEAEASLEHEEGKILRVQLELNQVKSDIDRKIAEKDEEIDQLKR  1593

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLE  334
                 V+D ++   +           LK + +    + + +   A  + AE ++ L+    
Sbjct  1594  NHLRVVDSMQSTLDAEIRSRNEALRLKKKMEGDLNEIEIQLSHANRQAAEAQKNLRNTQG  1653

Query  335   QLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
              L+     L  + +    +++        +           ++       R+   +E
Sbjct  1654  VLKDTQIHLDDALRSQEDLKEQVAMVERRANLLQAEIEELRAALEQTERSRKVAEQE  1710


 Score = 36.7 bits (83),  Expect = 0.47, Method: Composition-based stats.
 Identities = 62/355 (17%), Positives = 137/355 (39%), Gaps = 46/355 (13%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA---RKLVE  105
             + L+  LE+ ++LR  + ++ + L    +           +K+ L  K ++       ++
Sbjct  1037  DDLEGSLEQEKKLRMDLERAKRKLEGDLKMTQESTMDLENDKQQLDEKLKKKDFEISQIQ  1096

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS----LLGELQESQSRLE  161
                 ++  L  Q ++ ++E++      ++  E + + +A+       L  EL+E   RLE
Sbjct  1097  SKIEDEQALGMQLQKKIKELQARIEELEEEIEAERTSRAKAEKHRADLSRELEEISERLE  1156

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
              A     A     +    + +++  + E    QH      LR          +    + +
Sbjct  1157  EAGGATAAQIDMNKKREAEFQKMRRDLEEATLQHEATAAALR----------KKHADSTA  1206

Query  222   EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             +   ++  LQ    +L +E                 M+++DL   ++   +A    +++ 
Sbjct  1207  DVGEQIDNLQRVKQKLEKEKSEL------------KMEIDDLASNMESVSKAKANLEKMC  1254

Query  282   ----DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
                 D+L E   + +    T+  + AQ    KA  Q E     +  E+K+ L  QL + +
Sbjct  1255  RSLEDQLSEIKTKEEEQQRTINDISAQ----KARLQTESGEYSRQVEEKDALISQLSRGK  1310

Query  338   REYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             + +++         +IE++++   E  +A   PA A  S+       R    EE 
Sbjct  1311  QAFTQ---------QIEELKRHLEEEIKAKKCPAHALQSARHDCDLLREQYEEEQ  1356


 Score = 36.0 bits (81),  Expect = 0.92, Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 106/250 (42%), Gaps = 9/250 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  +
Sbjct  1687  QAEIEELRAALEQTERSRKVAEQELLDASERVQLLHTQNTSLINTKKKLESDISQIQSEM  1746

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    E  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1747  EDTIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLDQTVKDLQHRLDEAE  1806

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E +A Q++ +  V  +R      E  ++     + E+
Sbjct  1807  QLALKGGKKQIQKLEARVRELEGEVDAEQKRSAEAVKGVR----KYERRVKELTYQSEED  1862

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     +E    + L   ++   +L++AEE     +  
Sbjct  1863  RKNVLRLQDLVDKL-QMKVKSYKRQAEEAEELSNVNLSKFRKIQHELEEAEERADIAESQ  1921

Query  281   IDKLKEEAEQ  290
             ++KL+ ++ +
Sbjct  1922  VNKLRAKSRE  1931


>sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus 
reevesi OX=9886 GN=CTTNBP2 PE=3 SV=1
Length=1642

 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 54/316 (17%), Positives = 117/316 (37%), Gaps = 43/316 (14%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            +K  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +   S  E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGASDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEE--KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
            ++E   +       EE  K K   L +                V   ++  G  LE+  Q
Sbjct  148  ALEQEHKKLAARLEEERGKNKHVVLML----------------VKECKQLSGKVLEE-AQ  190

Query  266  QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAE  324
            +L++    L  +++    L+EE    K     +    AQ +   ++F  ER Q R KL  
Sbjct  191  KLEEVMAKLEEEKKKTSALEEELATEKRRSTEME---AQMEKQLSEFDTEREQLRAKLHR  247

Query  325  KKEL---LQEQLEQLQREYSKLKASCQESARIEDMR----KRHVEVSQAPLPPAPAYLSS  377
            ++     L+E+++++++   +LK        +   R    +R + +S A   P    ++ 
Sbjct  248  EEAHTADLKEEIDKMKKMIEQLKRGTDSKPGLSLPRKTKDRRSISISVATEGPMTRSVAC  307

Query  378  PLALPSQRRSPPEEPP  393
               L  +   P ++ P
Sbjct  308  QTDLVMESAEPVKKLP  323


 Score = 51.8 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 65/347 (19%), Positives = 125/347 (36%), Gaps = 42/347 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E  ++LE   K+  ALE       
Sbjct  172  ------LMLVKECKQ--------LSGKVLEEAQKLEEVMAKLEEEKKKTSALEEELATEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLHREEAHTADLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
            +  D+    S+    + R      +   +        +     D + E AE  K +  TV
Sbjct  271  RGTDSKPGLSLPRKTKDRR----SISISVATEGPMTRSVACQTDLVMESAEPVKKLPLTV  326

Query  299  PVLKAQADI---------YKADFQAERQAREKLAEKKELLQEQL-EQLQREYSKLKASCQ  348
            PV  A               A   A R   E+     +L+   L        ++++ +  
Sbjct  327  PVKPAAGSPPVAAGAKGNACASAAAVRPGVERQVSHGDLIGASLPAAPPPSANRIEENGP  386

Query  349  ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
             +    D+      V       +PA   +P   P    SP    P  
Sbjct  387  STGSTADLTSSPTPVPSTV---SPASGHTPAPPPHSLHSPCANAPLH  430


>sp|Q9JIR0|RIMB1_RAT Peripheral-type benzodiazepine receptor-associated 
protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 
PE=1 SV=2
Length=1847

 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 76/197 (39%), Gaps = 23/197 (12%)

Query  75   RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQ  134
            R ++L      +R++ E L  + ++ ++  E L L+    + +  + + E   L      
Sbjct  333  RVQQLESELCKKRKKCESLEQEARKKQRRCEELELQLRAAQNENARLVEENSRLS----G  388

Query  135  MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
             A +K  V+ +   L G+L       ++A ++ Q L+ +  +  +              +
Sbjct  389  KATEKEQVEWENAELKGQLLGVTQERDSALRKSQGLQSKLESLEQVL------------E  436

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH-------QLFQEYDNHIKS  247
            H  +V Q R Q +      R+  Q   EE R+L Q Q           QL +   + +++
Sbjct  437  HMRKVAQRRQQLEEEHEQARLSLQEKQEEVRRLQQAQAEAKREHEGAVQLLESTLDSMQA  496

Query  248  SVVGSERKRGMQLEDLK  264
             V   E +   Q E   
Sbjct  497  RVRELEGQCRSQTERFS  513


 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 92/231 (40%), Gaps = 9/231 (4%)

Query  5    LWKSQLCEMVQPSGGPA--ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELR  62
              +SQ        G PA  A  + + E+       +L  P +Q   + L+  L + ++  
Sbjct  289  PARSQGSTAPSSVGAPAPGAPGETVLEDDVESPQVVLGEPEKQLRVQQLESELCKKRKKC  348

Query  63   DAIRQSNQILRERCEEL-LHFQASQREEKEFLMC--KFQEARKLVERLGLEKLDLKRQKE  119
            +++ Q  +  + RCEEL L  +A+Q E    +    +        E++  E  +LK Q  
Sbjct  349  ESLEQEARKKQRRCEELELQLRAAQNENARLVEENSRLSGKATEKEQVEWENAELKGQLL  408

Query  120  QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
               +E +   R  Q +     S++  +  +    Q  Q   E   +   +L+ +     E
Sbjct  409  GVTQERDSALRKSQGLQSKLESLEQVLEHMRKVAQRRQQLEEEHEQARLSLQEK----QE  464

Query  180  QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
            + R+L+  +   +++H   V  L     S++A +R        +  + + L
Sbjct  465  EVRRLQQAQAEAKREHEGAVQLLESTLDSMQARVRELEGQCRSQTERFSLL  515


>sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus 
muntjak OX=9888 GN=CTTNBP2 PE=3 SV=1
Length=1642

 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 54/316 (17%), Positives = 117/316 (37%), Gaps = 43/316 (14%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            +K  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +   S  E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGASDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEE--KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
            ++E   +       EE  K K   L +                V   ++  G  LE+  Q
Sbjct  148  ALEQEHKKLAARLEEERGKNKHVVLML----------------VKECKQLSGKVLEE-AQ  190

Query  266  QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAE  324
            +L++    L  +++    L+EE    K     +    AQ +   ++F  ER Q R KL  
Sbjct  191  KLEEVMAKLEEEKKKTSALEEELATEKRRSTEME---AQMEKQLSEFDTEREQLRAKLHR  247

Query  325  KKEL---LQEQLEQLQREYSKLKASCQESARIEDMR----KRHVEVSQAPLPPAPAYLSS  377
            ++     L+E+++++++   +LK        +   R    +R + +S A   P    ++ 
Sbjct  248  EEAHTADLKEEIDKMKKMIEQLKRGTDSKPGLSLPRKTKDRRSISISVATEGPMTRSVAC  307

Query  378  PLALPSQRRSPPEEPP  393
               L  +   P ++ P
Sbjct  308  QTDLVMESAEPVKKLP  323


 Score = 51.8 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 65/347 (19%), Positives = 125/347 (36%), Gaps = 42/347 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E  ++LE   K+  ALE       
Sbjct  172  ------LMLVKECKQ--------LSGKVLEEAQKLEEVMAKLEEEKKKTSALEEELATEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLHREEAHTADLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
            +  D+    S+    + R      +   +        +     D + E AE  K +  TV
Sbjct  271  RGTDSKPGLSLPRKTKDRR----SISISVATEGPMTRSVACQTDLVMESAEPVKKLPLTV  326

Query  299  PVLKAQADI---------YKADFQAERQAREKLAEKKELLQEQL-EQLQREYSKLKASCQ  348
            PV  A               A   A R   E+     +L+   L        ++++ +  
Sbjct  327  PVKPAAGSPPVAAGAKGNACASAAAVRPGVERQVSHGDLIGASLPAAPPPSANRIEENGP  386

Query  349  ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
             +    D+      V       +PA   +P   P    SP    P  
Sbjct  387  STGSTADLTSSPTPVPSTV---SPASGHTPAPPPHSLHSPCANAPLH  430


>sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus OX=10090 GN=Myh8 
PE=2 SV=2
Length=1937

 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 144/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERCE+L+  +     + + +  + ++  ++ 
Sbjct  877   EEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEDEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLT  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  997   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1052

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L  +++  +   +  Q+ I
Sbjct  1053  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEISNLISKIEDEQAVEIQLQKKI  1111

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1112  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQVEMNK  1168

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +   Q+  R +E+   +H   + A
Sbjct  1169  KRETEFQKLRRDLEEATLQHEATAAA  1194


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 63/334 (19%), Positives = 121/334 (36%), Gaps = 14/334 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
               R L+E   L   + +S Q   ++ EEL      + + K  L    Q +R         
Sbjct  1290  YSRQLDEKDALVSQLSRSKQASTQQIEELKRQLEEETKAKNALAHALQSSRH--------  1341

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+    
Sbjct  1342  --DCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR  1399

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                A    E      +  E  +Q+   +V+ L +  +   AA     +      + L++ 
Sbjct  1400  LQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKVLSEW  1459

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E ++  K S   S     ++   E+    L+         Q+ I  L E+ 
Sbjct  1460  RQKYEETQAELESCQKESRTLSTELFKVKNAYEESLDHLETLRRENKNLQQEISDLTEQI  1519

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  +K Q +  K + QA  E        E+ ++L+ QLE  Q +    +  
Sbjct  1520  AEGGKHIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKI  1579

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              ++   I+ +++ HV V +       A + S   
Sbjct  1580  AEKDEEIDQLKRNHVRVVETMQSTLDAEIRSRND  1613


 Score = 41.7 bits (96),  Expect = 0.012, Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 138/363 (38%), Gaps = 41/363 (11%)

Query  48    PETLQRCLEENQELRDAIRQSNQI---LRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              +T QR   E ++L   + ++N     L ++        +  R++ E    + +  +K  
Sbjct  1418  EKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKVLSEWRQKYEETQAELESCQKES  1477

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV--------------TSLL  150
               L  E   +K   E++L  +E L+R  + + ++ + +  Q+                + 
Sbjct  1478  RTLSTELFKVKNAYEESLDHLETLRRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQVE  1537

Query  151   GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ----G  206
              E  E Q+ LE A    +  EG+      +  Q++SE +    +   ++DQL+       
Sbjct  1538  QEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVV  1597

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ-------  259
             +++++ L  E ++ ++  R   +++   +++  + ++  + +       R  Q       
Sbjct  1598  ETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKDTQ  1657

Query  260   ---------LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKA  310
                       EDLK+QL   E      Q  I++L+   EQ +   +        A     
Sbjct  1658  LHLDDALRGQEDLKEQLAIVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQ  1717

Query  311   DFQAERQA----REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQA  366
                 +  +    ++KL      LQ ++E++ +E    +   +++     M    ++  Q 
Sbjct  1718  LLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQD  1777

Query  367   PLP  369
                
Sbjct  1778  TSA  1780


 Score = 41.4 bits (95),  Expect = 0.021, Method: Composition-based stats.
 Identities = 44/249 (18%), Positives = 107/249 (43%), Gaps = 7/249 (3%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  V
Sbjct  1685  QAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEV  1744

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E +  E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1745  EEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAE  1804

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E  Q++++  V  LR      E  ++       E+
Sbjct  1805  QLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLR----KHERRVKELTYQTEED  1860

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVI  281
             ++ + +LQ    +L  +  ++ + +    E+          L+ +L++AEE     +  +
Sbjct  1861  RKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLAKFRKLQHELEEAEERADIAESQV  1920

Query  282   DKLKEEAEQ  290
             +KL+ ++ +
Sbjct  1921  NKLRVKSRE  1929


 Score = 40.6 bits (93),  Expect = 0.029, Method: Composition-based stats.
 Identities = 73/354 (21%), Positives = 141/354 (40%), Gaps = 11/354 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1003  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1062

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E          ED+ +V+ Q+   + ELQ     LE
Sbjct  1063  KLAQESTMDIENDKQQLDEKLKKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELE  1122

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                +  +A   +A        R+LE   E L++       Q+ M  +  E   +  R+  
Sbjct  1123  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVEM-NKKRETEFQKLRRDL  1181

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
              E   +      A  +   +    +   +   +R +  +LE  K +L+   + L +  E 
Sbjct  1182  EEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQ-KLEKEKSELKMEIDDLSSNAEA  1240

Query  281   IDKLKEEAEQHKIVME-TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             I K K   E+    +E  V  LK++ +  +         R +L  +      QL++    
Sbjct  1241  IAKAKGNLEKMCRTLEDQVSELKSKEEEQQRLINELTAQRARLQTEAGEYSRQLDEKDAL  1300

Query  340   YSKLKASCQES-ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
              S+L  S Q S  +IE+++++  E ++A    A A  SS       R    EE 
Sbjct  1301  VSQLSRSKQASTQQIEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQ  1354


 Score = 37.1 bits (84),  Expect = 0.42, Method: Composition-based stats.
 Identities = 61/364 (17%), Positives = 131/364 (36%), Gaps = 41/364 (11%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             ++G  E  +   + N E+     +      +R EEL   +    +  +      +     
Sbjct  1354  QEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAK  1413

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
                L   K  L+ + E  + +VE        + + + +    ++    + +E+Q+ LE+ 
Sbjct  1414  CASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKVLSEWRQKYEETQAELESC  1473

Query  164   TKECQALEGRARAAS-------EQARQLESEREALQQ-------------QHSVQVDQLR  203
              KE + L               +    L  E + LQQ             +H  ++++++
Sbjct  1474  QKESRTLSTELFKVKNAYEESLDHLETLRRENKNLQQEISDLTEQIAEGGKHIHELEKIK  1533

Query  204   MQGQS-----------VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
              Q +             EA+L  E       + +L Q++    +   E D  I       
Sbjct  1534  KQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNH  1593

Query  253   ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ----HKIVMETVPVLKAQADIY  308
              R        L  +++   +AL  K+++   L E   Q    +++  E++   +    I 
Sbjct  1594  VRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGIL  1653

Query  309   K-ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAP  367
             K      +   R +     E L+EQL  ++R  + L+A  +E     +  +R  ++++  
Sbjct  1654  KDTQLHLDDALRGQ-----EDLKEQLAIVERRANLLQAEIEELRATLEQTERSRKIAEQE  1708

Query  368   LPPA  371
             L  A
Sbjct  1709  LLDA  1712


>sp|Q7SZL5|MTUS1_XENLA Microtubule-associated tumor suppressor 
1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
Length=1338

 Score = 55.6 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 58/340 (17%), Positives = 127/340 (37%), Gaps = 28/340 (8%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHL---------------  128
               QR   E L      + +  E L +    L  Q+E+ L++ + L               
Sbjct  975   EQQRGVIENLKNLLSSSNQRFEALTVVVQQLINQREETLKKRKALSQELLNLRGDLVCAS  1034

Query  129   KRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL-----EGRARAASEQARQ  183
               C++   E    +KA    L    +E  + L    ++ +       E       E+A +
Sbjct  1035  STCERLEKEKNELLKAYEGILQKVKEEHHAELSDLEEKLKQFYTGECEKLQSIFIEEAEK  1094

Query  184   LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
              ++E +      +   +  R+Q ++  + +        + ++ L +L+ A  +  +  ++
Sbjct  1095  YKNELQEKVDDLNTTHEAYRLQAET--SQIETIHTLKEDYEKSLTELKDAKDKENKILED  1152

Query  244   HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMET-VPVLK  302
               K      E+ + ++L+D+ + L++  +    ++++  +   +     + +E  +  LK
Sbjct  1153  SFKEKQAEVEK-KILELKDVNESLKEKLKYEEEQRKLTKEKSVQKNPQVMYLEQELESLK  1211

Query  303   AQADIYKADFQAERQAR---EKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
             A  +I       + +     EKL E    L E+L + Q+E   LKA       +      
Sbjct  1212  AVLEIKNEKLHQQDKKLMQVEKLVETNTTLVERLNKCQQENEDLKARMVNHVALSRQLST  1271

Query  360   HVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPK  399
               EV Q  L    +  +  L++ ++         D C PK
Sbjct  1272  EQEVLQRSL-EKESKANKRLSMENEELLWKLHNGDLCSPK  1310


>sp|Q6A028|SWP70_MOUSE Switch-associated protein 70 OS=Mus musculus 
OX=10090 GN=Swap70 PE=1 SV=2
Length=585

 Score = 54.8 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 47/227 (21%), Positives = 97/227 (43%), Gaps = 8/227 (4%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            + G+P   +   +  +ELR  +    + L  + +EL     ++++E E +  K +EA   
Sbjct  309  KLGSPPPHKEARQRRKELRRKLLAEQEELERQMKELQAANENKQQELESVRKKLEEAASR  368

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
                  EK  L+ Q E   R    L+R +    + +  V  + + L   LQ  +   +  
Sbjct  369  AA--DEEKKRLQTQVELQTRFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMY  426

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             K  +ALE   +A  ++    + +   L+++ S + +  +   +  +A      Q    E
Sbjct  427  LKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAI-----QTTEAE  481

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
            K++L Q +V   Q  QE    ++   +   ++   Q E +K++L+ A
Sbjct  482  KQELEQQRVMKEQALQEAMAQLEQLELE-RKQALEQYEGVKKKLEMA  527


 Score = 37.9 bits (86),  Expect = 0.20, Method: Composition-based stats.
 Identities = 44/225 (20%), Positives = 98/225 (44%), Gaps = 18/225 (8%)

Query  115  KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
            K  +++       L   Q+++      ++A   +   EL+  + +LE A           
Sbjct  317  KEARQRRKELRRKLLAEQEELERQMKELQAANENKQQELESVRKKLEEAAS---------  367

Query  175  RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
            RAA E+ ++L+++ E LQ + S ++++ ++  Q +E  +  +     +  +++ +L+  Y
Sbjct  368  RAADEEKKRLQTQVE-LQTRFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMY  426

Query  235  HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
             +L QE     + +    E  R +Q   L+++  +  E L        +  +  E  K  
Sbjct  427  LKL-QEALEDERQARQDEETVRKLQARLLEEESSKRAE-LEKWHLEQQQAIQTTEAEKQE  484

Query  295  METVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
            +E   V+K QA       Q      E+L  +++   EQ E ++++
Sbjct  485  LEQQRVMKEQA------LQEAMAQLEQLELERKQALEQYEGVKKK  523


 Score = 36.7 bits (83),  Expect = 0.40, Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 73/186 (39%), Gaps = 5/186 (3%)

Query  171  EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
              R +    +    + E E   ++     +  + + +SV   L      A++E++K  Q 
Sbjct  320  RQRRKELRRKLLAEQEELERQMKELQAANENKQQELESVRKKLEEAASRAADEEKKRLQT  379

Query  231  QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
            QV     F       K      E +   +  +L+Q LQ+  E L      + +  E+  Q
Sbjct  380  QVELQTRFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRE-LEDMYLKLQEALEDERQ  438

Query  291  HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
             +   ETV  L+A+      +  ++R   EK   +++    Q  + +++  + +   +E 
Sbjct  439  ARQDEETVRKLQARL---LEEESSKRAELEKWHLEQQQ-AIQTTEAEKQELEQQRVMKEQ  494

Query  351  ARIEDM  356
            A  E M
Sbjct  495  ALQEAM  500


>sp|Q9JI55|PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus 
OX=10029 GN=PLEC PE=1 SV=1
Length=4473

 Score = 55.6 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 49/276 (18%), Positives = 112/276 (41%), Gaps = 13/276 (5%)

Query  63    DAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL  122
             +++ Q    LR R  EL    +   +     + + +E  +L E+   ++ + + +  +  
Sbjct  1236  ESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQ---QRAEERERLAEGE  1292

Query  123   REVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
               +E  ++  +  A+ KA  + +   L   +QE  +R E A    Q  +   +   +  R
Sbjct  1293  AALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVNAQQQKRSIQEELQHLR  1352

Query  183   QLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD  242
             Q        + Q     ++ RM+ +     +R++ +    ++        A     +E +
Sbjct  1353  QSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAE  1412

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
                + +   +ER R      ++ + Q+  +A       +    E A++ +  ++ +  L+
Sbjct  1413  AQKRQAQEEAERLRR----QVQDESQRKRQAEAELALRVKAQAEAAQEKQRALQALEELR  1468

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
              QA+      +AER+ R+  AE+   +Q  LE  QR
Sbjct  1469  LQAE------EAERRLRQAQAERARQVQVALETAQR  1498


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 56/298 (19%), Positives = 119/298 (40%), Gaps = 18/298 (6%)

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             +QK+ A  E+E  K+  +Q    KA V+ ++T+L  +L+E+  +     +E Q L+    
Sbjct  2084  KQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVT  2143

Query  176   AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
              A+ Q  Q+E E  +++    VQ+++L      +EA  R       +  ++  + +    
Sbjct  2144  EAARQRSQVEEELFSVR----VQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKM  2199

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
             +   E    +  +   + R R +  EDL QQ   AE+ L  K + + +      + +++ 
Sbjct  2200  KQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQ  2259

Query  296   ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
             +   + + QA               +L E KE + +QL +  + + +     ++      
Sbjct  2260  QQKELAQEQA--------------RRLQEDKEQMAQQLVEETQGFQRTLEVERQRQLEMS  2305

Query  356   MRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIH  413
                  +++  A +  A A          ++     E         Q +   + TL+I 
Sbjct  2306  AEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQ  2363


 Score = 51.8 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 63/311 (20%), Positives = 134/311 (43%), Gaps = 26/311 (8%)

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL-  160
             + ++RL  E  +  RQ+ Q   E+  ++   +++ + KA ++A+  +L+   +++  R  
Sbjct  2133  EELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFL  2192

Query  161   -EAATKECQALEGRAR---AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
              E A K  Q  E  AR   AA E AR  +   E L QQ ++    L+ + Q+V+ A R+ 
Sbjct  2193  EEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRL-  2251

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             +  A   +++    Q    +L ++ +   +  V  ++  +     + ++QL+ + EA   
Sbjct  2252  KAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEVERQRQLEMSAEAERL  2311

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA--------------REKL  322
             K   + ++     + +   +     + QA+           A              R++ 
Sbjct  2312  K-LRMAEMSRAQARAEEDAQR---FRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQS  2367

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESA-RIEDMRK-RHVEVSQAPLPPAPAYLSSPLA  380
                 E L+E + +L+RE  KLK   +    + E+M+  +  ++ Q       ++LS   +
Sbjct  2368  DHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDS  2427

Query  381   LPSQRRSPPEE  391
             L  + R   +E
Sbjct  2428  LLQRERFIEQE  2438


 Score = 49.1 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 53/297 (18%), Positives = 122/297 (41%), Gaps = 10/297 (3%)

Query  67    QSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVE  126
             ++N+ LR R +     Q     + +    K +  R+   R   E+  ++ Q+E A +E+E
Sbjct  1563  KANEALRLRLQAEEVAQQRSLAQADAEKQKEEAEREARRRGKAEEQAVR-QRELAEQELE  1621

Query  127   HLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES  186
               ++  +  A+ + + + ++  L  E ++ + + +   +E   L+  A AA+ + ++LE+
Sbjct  1622  KQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREATAATHKRQELEA  1681

Query  187   EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK  246
             E   ++ +  V +       +   +     +Q    E  +  +L         E    ++
Sbjct  1682  ELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEADRFREL--------AEEAARLR  1733

Query  247   SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             +    ++R+R +  ED  +Q  +AE  L  K   I +      + +I ++       +  
Sbjct  1734  ALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLR  1793

Query  307   IYKAD-FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVE  362
                 D     R+  E+ A  K  ++E+L QL++         +        ++R VE
Sbjct  1794  RLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVE  1850


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 54/364 (15%), Positives = 138/364 (38%), Gaps = 37/364 (10%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
               +G  + L+   EE +  +   ++  + LR + ++    +     E    +    EA +
Sbjct  1396  GAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAQAEAAQ  1455

Query  103   LVERLGLEKLDLKRQKEQALREVEHL----------------KRCQQQMAEDKASVKAQV  146
               +R      +L+ Q E+A R +                   +  + ++   +AS   + 
Sbjct  1456  EKQRALQALEELRLQAEEAERRLRQAQAERARQVQVALETAQRSAEVELQSKRASFAEKT  1515

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG  206
               L   LQE    +    +E      + +A +E+AR+         Q  + +  +LR+Q 
Sbjct  1516  AQLERTLQEEHVTVTQ-LREKAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQA  1574

Query  207   QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM--------  258
             + V     + +  A ++K +  +      +  ++     + +    E++R +        
Sbjct  1575  EEVAQQRSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQR  1634

Query  259   -----QLEDLKQQLQQAEEALVAKQEVIDKLKEEAE----QHKIVMETVPVLKAQADIYK  309
                  +L  L+ + +Q E+     +E + +L+ EA     + + +   +  ++A+ ++  
Sbjct  1635  LAAEQELIRLRAETEQGEQQRQLLEEELARLQREATAATHKRQELEAELAKVRAEMEVLL  1694

Query  310   ADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLP  369
             A   ++ +A E+     E  +++LE     + +L         + +  KR  ++++    
Sbjct  1695  A---SKARAEEESRSTSEKSKQRLEAEADRFRELAEEAARLRALAEEAKRQRQLAEEDAA  1751

Query  370   PAPA  373
                A
Sbjct  1752  RQRA  1755


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 58/340 (17%), Positives = 143/340 (42%), Gaps = 19/340 (6%)

Query  49    ETLQRCLEENQELRDAIRQ-SNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E LQ+  E  QE    +++   Q+ ++  EE   FQ +   E++  +    EA +L  R+
Sbjct  2256  ELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEVERQRQLEMSAEAERLKLRM  2315

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
                     R +E A R  +  +   +++   + + + +VT +     + Q     A +  
Sbjct  2316  AEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLR  2375

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             +A+    R   +  ++ +  +   ++  +VQ +Q+  + Q+++ +   E+ +  + +R +
Sbjct  2376  EAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQRERFI  2435

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
              Q +    QLFQ+     +      +R++    ++ ++ +   EEA   +     + +E 
Sbjct  2436  EQEKAKLEQLFQDEVAKAQQLREEQQRQQRQMEQEKQELVASMEEARRRQC----EAEEA  2491

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
               + +  ++ + + + Q +             + LAE+ + L+E+L++L+ E+    A  
Sbjct  2492  VRRKQEELQHLELQRQQQE-------------KLLAEENQRLRERLQRLEEEHRAALAHS  2538

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +E A  +    + +   +  L   P+    P       R 
Sbjct  2539  EEIAATQAAAAKALPNGRDAL-DGPSMEVEPEHAFEGLRQ  2577


 Score = 43.7 bits (101),  Expect = 0.004, Method: Composition-based stats.
 Identities = 61/324 (19%), Positives = 136/324 (42%), Gaps = 22/324 (7%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
               QR+  E    +   A + + RL  E    ++Q++    E+  L+R        +  ++
Sbjct  1621  EKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREATAATHKRQELE  1680

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRAR----AASEQARQLESEREALQQQHSVQV  199
             A++  +  E++   +    A +E ++   +++    A +++ R+L  E   L+   + + 
Sbjct  1681  AELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEADRFRELAEEAARLRA-LAEEA  1739

Query  200   DQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ  259
              + R   +   A  R E +    EK  LA +  A  +L  E +  +K     +ER R + 
Sbjct  1740  KRQRQLAEEDAARQRAEAERVLTEK--LAAISEA-TRLKTEAEIALKEKEAENERLRRLA  1796

Query  260   LEDLKQQLQQAEEALVAKQEVIDKLKE-------EAEQHKIVMETVPVLKAQADIYKADF  312
              ++  Q+ +  E+A + K ++ ++L +       E E+ K ++E     + Q +    + 
Sbjct  1797  EDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVE---EEI  1853

Query  313   QAERQAREKLAEKKELLQEQLEQLQREYSKL----KASCQESARIEDMRKRHVEVSQAPL  368
              A + + EK A  K  L+ +L +++          + + QE+AR   +     +  +   
Sbjct  1854  LALKVSFEKAAAGKAELELELGRIRSSAEDTMRSKEQAEQEAARQRQLAAEEEQRRREAE  1913

Query  369   PPAPAYLSSPLALPSQRRSPPEEP  392
                   L++      QR++  EE 
Sbjct  1914  ERVQKSLAAEEEAARQRKAALEEV  1937


 Score = 42.9 bits (99),  Expect = 0.007, Method: Composition-based stats.
 Identities = 64/365 (18%), Positives = 150/365 (41%), Gaps = 33/365 (9%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E +++  EE   L  A +++ ++ +   E+L    A QR   E ++ +  +A +   RL 
Sbjct  2197  EKMKQVAEEAARLSVAAQEAARLRQLAEEDL----AQQRALAEKMLKEKMQAVQEATRLK  2252

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAED--------------KASVKAQVTSLLGELQ  154
              E   L++QKE A  +   L+  ++QMA+               +   + ++++    L+
Sbjct  2253  AEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEVERQRQLEMSAEAERLK  2312

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
                + +  A    +    R R  +E+  +     E   Q+    V  L +Q Q  +    
Sbjct  2313  LRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAE  2372

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED----------LK  264
               R+A +E +R+  +L+    +L Q     +++       +    L+            +
Sbjct  2373  RLREAIAELEREKEKLKQE-AKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQR  2431

Query  265   QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER---QAREK  321
             ++  + E+A + +    +  K +  + +   +   + + + ++  +  +A R   +A E 
Sbjct  2432  ERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQRQMEQEKQELVASMEEARRRQCEAEEA  2491

Query  322   LAEKKELLQ-EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +  K+E LQ  +L++ Q+E    + + +   R++ + + H          A    ++  A
Sbjct  2492  VRRKQEELQHLELQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEEIAATQAAAAKA  2551

Query  381   LPSQR  385
             LP+ R
Sbjct  2552  LPNGR  2556


 Score = 42.1 bits (97),  Expect = 0.010, Method: Composition-based stats.
 Identities = 70/355 (20%), Positives = 139/355 (39%), Gaps = 21/355 (6%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             + A  +  R  EE + +R  +  + +       EL   +A   E +       +EA    
Sbjct  1367  EAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEA----  1422

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             ERL  +  D  ++K QA  E+    + Q + A++K      +  L  + +E++ RL  A 
Sbjct  1423  ERLRRQVQDESQRKRQAEAELALRVKAQAEAAQEKQRALQALEELRLQAEEAERRLRQAQ  1482

Query  165   KECQ-----ALEGRARAASEQAR-------QLESEREALQQQHSVQVDQLRMQGQSVEAA  212
              E       ALE   R+A  + +       +  ++ E   Q+  V V QLR + +     
Sbjct  1483  AERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVTQLREKAERRAQQ  1542

Query  213   LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
                  +A  E +R+L + Q+  ++  +      + +   S  +   + +  + + +    
Sbjct  1543  QAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQRSLAQADAEKQKEEAEREARRR  1602

Query  273   ALVAKQ--EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQ  330
                 +Q     +  ++E E+ + + E     +  A+    +    R   E+  ++++LL+
Sbjct  1603  GKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAE---QELIRLRAETEQGEQQRQLLE  1659

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
             E+L +LQRE +      QE        +  +EV  A    A     S      QR
Sbjct  1660  EELARLQREATAATHKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQR  1714


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 56/289 (19%), Positives = 119/289 (41%), Gaps = 30/289 (10%)

Query  12    EMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ-  70
             + VQ +    A+ ++L ++  L +     L  ++   +  Q+ +EE Q  +  +    Q 
Sbjct  2243  QAVQEATRLKAEAELLQQQKELAQEQARRL--QEDKEQMAQQLVEETQGFQRTLEVERQR  2300

Query  71    ---------ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLD-------L  114
                       L+ R  E+   QA   E+ +    + +E  + + R  L   +       L
Sbjct  2301  QLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTL  2360

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS-RLEAATKECQALEGR  173
             + Q++Q+  + E L+    ++  +K  +K +   L  + +E Q+ + E   +E QAL+  
Sbjct  2361  EIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKS  2420

Query  174   ARAASEQA----RQLESEREALQQQHSVQVDQ------LRMQGQSVEAALRMERQAASEE  223
               +  +      R +E E+  L+Q    +V +       + + Q      + E  A+ EE
Sbjct  2421  FLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQRQMEQEKQELVASMEE  2480

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
              R+         +  QE   H++      E+    + + L+++LQ+ EE
Sbjct  2481  ARRRQCEAEEAVRRKQEELQHLELQRQQQEKLLAEENQRLRERLQRLEE  2529


 Score = 37.5 bits (85),  Expect = 0.33, Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 99/241 (41%), Gaps = 10/241 (4%)

Query  55    LEENQELRDAIRQSNQILRERCEELLH-FQASQREEKEFLMCKFQEARKLVERLGLEKLD  113
             LE+ ++L +A  Q+        +EL    Q      +E  +   Q+ R + E L   +  
Sbjct  1295  LEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVNAQQQKRSIQEELQHLRQS  1354

Query  114   LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL-------GELQESQSRLEAATKE  166
              + + +   ++VE  +R + ++ E+   V+ Q+ +         GELQ  ++R E A  +
Sbjct  1355  SEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQ  1414

Query  167   CQALEGRARAASEQARQLESEREALQQQHSVQVD-QLRMQGQSVEAALRMERQAASEEKR  225
              +  +  A     Q +     +   + + +++V  Q     +   A   +E      E+ 
Sbjct  1415  KRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAQAEAAQEKQRALQALEELRLQAEEA  1474

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             +  +L+ A  +  ++    ++++   +E +   +     ++  Q E  L  +   + +L+
Sbjct  1475  E-RRLRQAQAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVTQLR  1533

Query  286   E  286
             E
Sbjct  1534  E  1534


 Score = 34.4 bits (77),  Expect = 2.5, Method: Composition-based stats.
 Identities = 69/370 (19%), Positives = 134/370 (36%), Gaps = 28/370 (8%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   L + S QGA E L+      ++L++A  Q+     +  E         R + E   
Sbjct  1015  KTISLVIRSTQGAEEVLK---AHEEQLKEA--QAVPATLQELEATKASLKKLRAQAEAQQ  1069

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
               F   R  +         L+++  +   EVE  +    Q+ E   +V AQ+     EL+
Sbjct  1070  PVFDTLRDELRGAQEVGERLQQRHGERDVEVERWRERVNQLLERWQAVLAQIDVRQRELE  1129

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQ-------QHSVQVDQLRMQGQ  207
             +   +L    +    L    + A  +  Q+++      Q       Q    ++++   G+
Sbjct  1130  QLGRQLRYYRESADPLSSWLQDAKRRQEQIQAVPIPNSQAAREQLRQEKALLEEIERHGE  1189

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              VE   +  +Q  +  K    QL     QL        K  V         +  DL+ + 
Sbjct  1190  KVEECQKFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRY  1249

Query  268   Q------------QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                           +E     ++E     ++ AE+ + + E    L+ Q  +  A+  A+
Sbjct  1250  SELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEGEAALEKQRQL--AEAHAQ  1307

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYL  375
              +A+ +L  ++   + Q E  +RE + + A  Q+ +  E+++  H+  S      A A  
Sbjct  1308  AKAQAELEAQELQRRMQEEVARREEAAVNAQQQKRSIQEELQ--HLRQSSEAEIQAKAQQ  1365

Query  376   SSPLALPSQR  385
                      R
Sbjct  1366  VEAAERSRMR  1375


 Score = 34.0 bits (76),  Expect = 3.6, Method: Composition-based stats.
 Identities = 40/195 (21%), Positives = 79/195 (41%), Gaps = 10/195 (5%)

Query  57    ENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKR  116
             EN+ LR  + +     R R EE      +  EE+   + K  E+   +ER      D  R
Sbjct  1788  ENERLRR-LAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESE--LERQKGLVEDTLR  1844

Query  117   QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE---CQALEGR  173
             Q+ Q   E+  LK   ++ A  KA ++ ++  +    +++    E A +E    + L   
Sbjct  1845  QRRQVEEEILALKVSFEKAAAGKAELELELGRIRSSAEDTMRSKEQAEQEAARQRQLAAE  1904

Query  174   ARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAAL----RMERQAASEEKRKLAQ  229
                   +A +   +  A +++ + Q      + + ++A +    R+  +A  E  R+L  
Sbjct  1905  EEQRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQL  1964

Query  230   LQVAYHQLFQEYDNH  244
              Q A  +  Q  +  
Sbjct  1965  AQEAAQKRLQAEEKA  1979


 Score = 33.3 bits (74),  Expect = 6.7, Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 112/249 (45%), Gaps = 3/249 (1%)

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
             A + VERL  +  + +R +E+A +E     +  Q+ A+ +   + +  + +  +Q+ +  
Sbjct  1933  ALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFV--VQQREEE  1990

Query  160   LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
             L+   ++ Q++  R R  +E AR+   E E  ++Q   +  Q R Q +  E  L+   + 
Sbjct  1991  LQQTLQQEQSMLERLRGEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAE-RLKQSAEE  2049

Query  220   ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
              ++ + +         +  ++       +   + +++     ++++  + AE+ L  K +
Sbjct  2050  QAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQ  2109

Query  280   VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             V  +L     Q +       +L  +    KA+     + R ++ E+   ++ Q+E+L + 
Sbjct  2110  VEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKL  2169

Query  340   YSKLKASCQ  348
              ++++A  +
Sbjct  2170  KARIEAENR  2178


>sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 
2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2
Length=1197

 Score = 55.2 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 43/281 (15%), Positives = 115/281 (41%), Gaps = 22/281 (8%)

Query  84   ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
               R +   ++ KFQE + + + L +++ +L+        E+  LK   ++  + K   +
Sbjct  665  GGARSQAASILTKFQELKDVQDELRIKENELR----ALEEELAGLKNTAEKYRQLKQQWE  720

Query  144  AQVTS---LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD  200
             +      L  +LQ+S    +   +E  AL+     + E  +  +  +   ++++ V  +
Sbjct  721  MKTEEADLLQTKLQQSSYHKQQ--EELDALKKTIEESEETLKNTKEIQRKAEEKYEVLEN  778

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL  260
            +++      E  L+  ++     K K      A  +  +E    +++  +  E  +  + 
Sbjct  779  KMKNAEAERERELKDAQKKLDCAKTK----ADASSKKMKEKQQEVEAITLELEELKR-EH  833

Query  261  EDLKQQLQQAEEALVAKQEVIDKLKEEAEQ--------HKIVMETVPVLKAQADIYKADF  312
               KQQL+   EA+ + +  I+ +  E  +         + V +   V+ AQ  + KA +
Sbjct  834  TSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKY  893

Query  313  QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
                + +E+  + +  ++E    + +   + +    + +++
Sbjct  894  AEVAKHKEQNNDSQLKIKELDHNISKHKREAEDGAAKVSKM  934


 Score = 55.2 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 41/228 (18%), Positives = 95/228 (42%), Gaps = 17/228 (7%)

Query  74   ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ  133
            E+  +L      + EE + L  K Q++     +   E   LK+  E++   +++ K  Q+
Sbjct  710  EKYRQLKQQWEMKTEEADLLQTKLQQSS--YHKQQEELDALKKTIEESEETLKNTKEIQR  767

Query  134  QMAEDKASVKAQVT----SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESERE  189
            +  E    ++ ++         EL+++Q +L+ A  +  A   + +   ++   +  E E
Sbjct  768  KAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELE  827

Query  190  ALQQQHSVQVDQLRMQGQSVEA-ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSS  248
             L+++H+    QL    +++++   ++E  AA   K K +  +       QE     K  
Sbjct  828  ELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKA------QEEVTKQKEV  881

Query  249  VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
            +   +     +  ++ +  +Q  ++    Q  I +L     +HK   E
Sbjct  882  ITAQDTVIKAKYAEVAKHKEQNNDS----QLKIKELDHNISKHKREAE  925


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/217 (17%), Positives = 92/217 (42%), Gaps = 6/217 (3%)

Query  144  AQVTSLLGELQESQSRLEAATKECQALEGR---ARAASEQARQLESEREALQQQHSVQVD  200
            A + +   EL++ Q  L     E +ALE      +  +E+ RQL+ + E   ++  +   
Sbjct  672  ASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWEMKTEEADLLQT  731

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL  260
            +L+      +       +   EE  +  +      +  +E    +++ +  +E +R  +L
Sbjct  732  KLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAEREREL  791

Query  261  EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE  320
            +D +++L  A+    A  + + + ++E E   + +E    LK +   YK   +A  +A +
Sbjct  792  KDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEE---LKREHTSYKQQLEAVNEAIK  848

Query  321  KLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
                + E++  ++ + +   +K +    +   +   +
Sbjct  849  SYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQ  885


 Score = 41.4 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 32/234 (14%), Positives = 92/234 (39%), Gaps = 15/234 (6%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF----LMCKFQEARKLV  104
            + L++ +EE++E     ++  +   E+ E L +   +   E+E        K   A+   
Sbjct  746  DALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKA  805

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
            +    +  + +++ E    E+E LKR      +   +V   + S   +++   + +    
Sbjct  806  DASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNK  865

Query  165  KECQALEGRARAASEQARQLES---EREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
            +     +       E     ++    + A   +H  Q +  +++ + ++  +   ++ A 
Sbjct  866  ESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNNDSQLKIKELDHNISKHKREAE  925

Query  222  EEKRKLAQLQVAYHQLFQEYD--------NHIKSSVVGSERKRGMQLEDLKQQL  267
            +   K++++   Y  +  E             K++      +R  +L+++K++L
Sbjct  926  DGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKL  979


 Score = 37.5 bits (85),  Expect = 0.30, Method: Composition-based stats.
 Identities = 38/263 (14%), Positives = 109/263 (41%), Gaps = 11/263 (4%)

Query  47   APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEAR---KL  103
            + E L+   ++  +L++ + ++++ ++    E+   +  + +E   ++   ++A    + 
Sbjct  249  SAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLEDALAEAQR  308

Query  104  VERLGLEKLDLKRQ----KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
            V        DLK++    +E   +E+E       +    K     ++T  L  LQE+ ++
Sbjct  309  VNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNK  368

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
               A    Q       A      +  +E     Q  + + D  + Q ++ +A ++++   
Sbjct  369  DAEALAAAQQHFNAVSAGLSS-NEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ  427

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
              E K K A+++      +++    +++     E+    +++ L  +  + E  L  +++
Sbjct  428  -QELKNKQAEVK-KMDSGYRKDQEALEAVKRLKEKLE-AEMKKLNYEENKEESLLEKRRQ  484

Query  280  VIDKLKEEAEQHKIVMETVPVLK  302
            +   +    E ++ ++   P L+
Sbjct  485  LSRDIGRLKETYEALLARFPNLR  507


>sp|F1LMV6|DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 
GN=Dsp PE=1 SV=1
Length=2877

 Score = 55.2 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 55/323 (17%), Positives = 137/323 (42%), Gaps = 16/323 (5%)

Query  39    LHLPSEQGAPETLQRCLEENQELRDAIR--QSNQILRERCEELLHFQASQREEKEFLMCK  96
             L +   Q +    +  +   Q L DA +  Q      ER ++L+  + ++R+  E    K
Sbjct  1454  LEIELRQVSQMRTEESMRYKQSLDDAAKTIQDKNKEIERLKQLVDKETNERKCLEDENSK  1513

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              Q  +  +++      +   + +   +E+  L+   +++++++      +T +   L++ 
Sbjct  1514  LQRVQYDLQKANNSATEAMSKLKVQEQELTRLRIDYERVSQERTVKDQDITRIQSSLKDL  1573

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
             Q + + A +E   L+  A   S + + LE E EA+++    Q  ++    Q +E A  + 
Sbjct  1574  QLQKQKAEEELSRLKRTASDESSKRKMLEEELEAMRRSLKEQAVKITNLTQQLEQA-SIV  1632

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
             ++ + ++ R+   +   + +  Q     ++   +  E  R   +++ ++ ++QA      
Sbjct  1633  KKRSEDDLRQQRDVLDGHVREKQRTQEELRRLSLDVEALRRQLVQE-QENVKQAHLRNEH  1691

Query  277   KQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQL  336
              Q+ I+       + KI +E +  L             E   +E L  ++EL   +LE  
Sbjct  1692  FQKAIEDKSRSLNESKIEIERLQSL------------TENLTKEHLMLEEELRNLRLEYD  1739

Query  337   QREYSKLKASCQESARIEDMRKR  359
                  + +A   +++ I ++R +
Sbjct  1740  DLRRGRSEADNDKNSTISELRSQ  1762


 Score = 55.2 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 53/335 (16%), Positives = 126/335 (38%), Gaps = 34/335 (10%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ--EARKLVERLG  108
             L R   EN++L+D I + N  +      L   +  +R E+  L  K    E  +  + L 
Sbjct  1246  LDRLSRENRDLKDEIVRLNDSI------LQATEQRRRAEENALQQKACGSEIMQKKQHLE  1299

Query  109   LEKLDLKRQKEQ----ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL----  160
             +E   + +Q+ +      + +E   +  Q   ++   +KA+         E ++ L    
Sbjct  1300  VELKQVIQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEYQEEAKRRWEYENELSKVR  1359

Query  161   ----EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                 E         E           QL  ++E     +  Q+D L  + +S+   ++  
Sbjct  1360  NSYDEEIISLRNKFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEVKRL  1419

Query  217   RQAASEEKRKL------AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
             +   ++    L       Q Q A      +    ++  +    + R  +    KQ L  A
Sbjct  1420  KNTLAQTTENLRRVEENVQQQKASGSEMSQRKQQLEIELRQVSQMRTEESMRYKQSLDDA  1479

Query  271   EEALVAKQEVIDKLKEEAEQHKIVMETVP-----VLKAQADIYKADFQAERQAREKLAEK  325
              + +  K + I++LK+  ++     + +      + + Q D+ KA+  A     +   ++
Sbjct  1480  AKTIQDKNKEIERLKQLVDKETNERKCLEDENSKLQRVQYDLQKANNSATEAMSKLKVQE  1539

Query  326   KELLQEQLEQLQREYSKL---KASCQESARIEDMR  357
             +EL + +++  +    +    +   +  + ++D++
Sbjct  1540  QELTRLRIDYERVSQERTVKDQDITRIQSSLKDLQ  1574


 Score = 49.5 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 59/321 (18%), Positives = 133/321 (41%), Gaps = 20/321 (6%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMC---K  96
             H+  +Q   E L+R   + + LR  + Q  + +++      HFQ +  ++   L     +
Sbjct  1650  HVREKQRTQEELRRLSLDVEALRRQLVQEQENVKQAHLRNEHFQKAIEDKSRSLNESKIE  1709

Query  97    FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
              +  + L E L  E L L+ +      E + L+R + +   DK    + ++ L  +LQ S
Sbjct  1710  IERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADNDK---NSTISELRSQLQIS  1766

Query  157   QSRLEAATKECQALEGRARAASEQARQLESEREALQ---QQHSVQVDQLRMQGQSVEAAL  213
              +R          L+       ++  + + +        Q+   Q  Q+  + +S+   +
Sbjct  1767  NNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKSQCTQVVQERESLLVKI  1826

Query  214   RMERQAASEEKRKLAQLQVAYH--QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
             ++      ++K +L +L+   +  +   E +  +K  +   +++    L   K Q  + E
Sbjct  1827  KV----LEQDKARLQRLEDELNRAKATLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKE  1882

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
             E +   +   +K + E    +  +E     + QA+I + + +  R+  +   E +  L+ 
Sbjct  1883  ETIRKIESEREKSEREKNSLRSEIE-----RLQAEIKRIEERCRRKLEDSTRETQSQLET  1937

Query  332   QLEQLQREYSKLKASCQESAR  352
             +  +LQ+E  KL+     S R
Sbjct  1938  ERCRLQKEIDKLRQRPYGSHR  1958


 Score = 49.1 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 58/325 (18%), Positives = 128/325 (39%), Gaps = 15/325 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + +Q+  E+N   + ++ ++ + ++++ +E+   +A  +EE +       E  K+     
Sbjct  1304  QVIQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEYQEEAKRRWEYENELSKVRNSYD  1363

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E + L+ + E    E+   K    Q+   K    +   + +  L      L     E +
Sbjct  1364  EEIISLRNKFET---EINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSE---EVK  1417

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              L+      +E  R++E       QQ      ++  + Q +E  LR   Q  +EE  +  
Sbjct  1418  RLKNTLAQTTENLRRVEENV----QQQKASGSEMSQRKQQLEIELRQVSQMRTEESMRYK  1473

Query  229   QLQVAYHQLFQEYDNHIK--SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             Q      +  Q+ +  I+    +V  E      LED   +LQ+ +  L   Q+  +   E
Sbjct  1474  QSLDDAAKTIQDKNKEIERLKQLVDKETNERKCLEDENSKLQRVQYDL---QKANNSATE  1530

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
                + K+  + +  L+   +    +   + Q   ++    + LQ Q ++ + E S+LK +
Sbjct  1531  AMSKLKVQEQELTRLRIDYERVSQERTVKDQDITRIQSSLKDLQLQKQKAEEELSRLKRT  1590

Query  347   CQESARIEDMRKRHVEVSQAPLPPA  371
               + +    M +  +E  +  L   
Sbjct  1591  ASDESSKRKMLEEELEAMRRSLKEQ  1615


 Score = 39.8 bits (91),  Expect = 0.058, Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 88/231 (38%), Gaps = 18/231 (8%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             +R   QI   R  EL       + E+E L  + ++ +K          + K Q  Q ++E
Sbjct  1759  LRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKSQCTQVVQE  1818

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
              E L    + + +DKA ++     L  EL  +++ LEA T+  Q LE   +       Q 
Sbjct  1819  RESLLVKIKVLEQDKARLQ----RLEDELNRAKATLEAETRVKQRLECEKQQIQNDLNQW  1874

Query  185   ESEREALQQ----------QHSVQVDQLRMQGQSVEAALRME----RQAASEEKRKLAQL  230
             +++    ++          +   + + LR + + ++A ++      R+   +  R+    
Sbjct  1875  KTQYSRKEETIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQ  1934

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
                     Q+  + ++    GS R+   + E      +   + L  K   +
Sbjct  1935  LETERCRLQKEIDKLRQRPYGSHRETQTEYEWTVDSSKLVFDGLRKKVTAM  1985


 Score = 37.1 bits (84),  Expect = 0.41, Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 83/206 (40%), Gaps = 10/206 (5%)

Query  96    KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQE  155
             + +E  + + RL  E  D KR+++      +  K    Q+ + +   K    SL  +  E
Sbjct  1110  QIKELNEKITRLTYEIEDEKRRRKTVEDRFDQQKNDYDQLQKARQCEKE---SLGWQKLE  1166

Query  156   SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR-  214
             S+  ++    E + L    +    + R+ E+E   ++  ++ ++  LR + ++     + 
Sbjct  1167  SEKAIKEKEYEIERLRVLLQEEGARKREYENELAKVRNHYNEEMSNLRNKYETEINITKT  1226

Query  215   ----MERQAASEEKRKLAQLQ--VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQ  268
                 +  Q   + K    QL      ++  ++    +  S++ +  +R    E+  QQ  
Sbjct  1227  TIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKA  1286

Query  269   QAEEALVAKQEVIDKLKEEAEQHKIV  294
                E +  KQ +  +LK+  +Q    
Sbjct  1287  CGSEIMQKKQHLEVELKQVIQQRSED  1312


 Score = 36.4 bits (82),  Expect = 0.61, Method: Composition-based stats.
 Identities = 43/250 (17%), Positives = 97/250 (39%), Gaps = 25/250 (10%)

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D  R   + L+ +E LK    ++   +  ++        E       L+   ++ QA   
Sbjct  1019  DYYRFLSEMLKSLEDLKLKNTKIEVLEEELRL-ARDANSENCNKNKFLDQNLQKYQAECS  1077

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
             + +A      +L+ + E   +     +D+   Q + +   +        +EKR+   ++ 
Sbjct  1078  QFKAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKTVED  1137

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK----EEA  288
              + Q   +YD   K+     E     +LE        +E+A+  K+  I++L+    EE 
Sbjct  1138  RFDQQKNDYDQLQKARQCEKESLGWQKLE--------SEKAIKEKEYEIERLRVLLQEEG  1189

Query  289   EQHKIVMETVPVLKAQA--------DIYKADFQAERQAREKLAEKKE----LLQEQLEQL  336
              + +     +  ++           + Y+ +    +   ++++ +KE     L+ QL++L
Sbjct  1190  ARKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRL  1249

Query  337   QREYSKLKAS  346
              RE   LK  
Sbjct  1250  SRENRDLKDE  1259


 Score = 34.0 bits (76),  Expect = 3.3, Method: Composition-based stats.
 Identities = 49/249 (20%), Positives = 93/249 (37%), Gaps = 14/249 (6%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEAR  101
             QG    LQR  E  ++  +  ++       R +E         +E+E L+ K    ++ +
Sbjct  1774  QGLINDLQRERENLRQEIEKFQKQALEASNRIQESKSQCTQVVQERESLLVKIKVLEQDK  1833

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
               ++RL  E    K   E   R  + L+  +QQ+  D    K Q +     +++ +S  E
Sbjct  1834  ARLQRLEDELNRAKATLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEETIRKIESERE  1893

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
              + +E  +L         + +++E               +L    +  ++ L  ER    
Sbjct  1894  KSEREKNSLRSEIERLQAEIKRIEERCRR----------KLEDSTRETQSQLETERCRLQ  1943

Query  222   EEKRKLAQLQVAYHQLFQ-EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             +E  KL Q     H+  Q EY+  + SS +  +  R         + Q  ++  + K   
Sbjct  1944  KEIDKLRQRPYGSHRETQTEYEWTVDSSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLK  2003

Query  281   IDKLKEEAE  289
               K  EE  
Sbjct  2004  GKKSVEEVA  2012


>sp|O95153|RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated 
protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 
SV=2
Length=1857

 Score = 55.2 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 81/199 (41%), Gaps = 23/199 (12%)

Query  73   RERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQ  132
             +R ++L    + +R++ E L  + ++ ++  E L L+    + +  + + E   L    
Sbjct  334  EQRVQQLESELSKKRKKCESLEQEARKKQRRCEELELQLRQAQNENARLVEENSRLS---  390

Query  133  QQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQ  192
               A +K  V+ +   L G+L       ++A ++ Q L+ +  +  +  + +    +  Q
Sbjct  391  -GRATEKEQVEWENAELRGQLLGVTQERDSALRKSQGLQSKLESLEQVLKHMREVAQRRQ  449

Query  193  QQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH-------QLFQEYDNHI  245
            Q        L ++ +    +LR ++    EE R+L Q Q           QL +   + +
Sbjct  450  Q--------LEVEHEQARLSLREKQ----EEVRRLQQAQAEAQREHEGAVQLLESTLDSM  497

Query  246  KSSVVGSERKRGMQLEDLK  264
            ++ V   E +   Q E   
Sbjct  498  QARVRELEEQCRSQTEQFS  516


 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 81/199 (41%), Gaps = 15/199 (8%)

Query  40   HLPSEQGAPETLQRCLEENQELR------DAIRQSNQILRERCEEL-LHFQASQREEKEF  92
            +LP   G PE  QR  +   EL       +++ Q  +  + RCEEL L  + +Q E    
Sbjct  323  NLPVILGEPEKEQRVQQLESELSKKRKKCESLEQEARKKQRRCEELELQLRQAQNENARL  382

Query  93   LMC--KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL  150
            +    +        E++  E  +L+ Q     +E +   R  Q +     S++     +L
Sbjct  383  VEENSRLSGRATEKEQVEWENAELRGQLLGVTQERDSALRKSQGLQSKLESLEQ----VL  438

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              ++E   R +    E +      R   E+ R+L+  +   Q++H   V  L     S++
Sbjct  439  KHMREVAQRRQQLEVEHEQARLSLREKQEEVRRLQQAQAEAQREHEGAVQLLESTLDSMQ  498

Query  211  AALR--MERQAASEEKRKL  227
            A +R   E+  +  E+  L
Sbjct  499  ARVRELEEQCRSQTEQFSL  517


 Score = 34.8 bits (78),  Expect = 1.9, Method: Composition-based stats.
 Identities = 52/309 (17%), Positives = 106/309 (34%), Gaps = 44/309 (14%)

Query  93   LMCKFQEARKLVERLGLEKLDLKRQK-EQALREVEHLKRCQQQMAEDKASVKAQVTSLLG  151
            L+    E R+    L  E   L++    +   +V  LKR   ++A     ++ +   L  
Sbjct  126  LLRALGELRQRCAILKEENQMLRKSSFPETEEKVRRLKRKNAELAVIAKRLEERARKL--  183

Query  152  ELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEA  211
              QE+  R+ +A                    LE  R+AL +Q +  + +      + + 
Sbjct  184  --QETNLRVVSA------------PLPRPGTSLELCRKALARQRARDLSETASALLAKDK  229

Query  212  ALRMERQAASEEKRKLAQLQVAYHQLF--QEYDNHIKSSVVGSER-KRGMQLEDLKQQLQ  268
             +   ++   E + +L  +     Q    +++D  ++ S     R +R + L + ++ L 
Sbjct  230  QIAALQRECRELQARLTLVGKEGPQWLHVRDFDRLLRESQREVLRLQRQIALRNQRETLP  289

Query  269  QAEE-----ALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA  323
                     AL A+              +   + +PV+  +                   
Sbjct  290  LPPSWPPGPALQARAGAPAPGAPGEATPQEDADNLPVILGE-------------------  330

Query  324  EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPS  383
             +KE   +QLE    +  K   S ++ AR +  R   +E+         A L    +  S
Sbjct  331  PEKEQRVQQLESELSKKRKKCESLEQEARKKQRRCEELELQLRQAQNENARLVEENSRLS  390

Query  384  QRRSPPEEP  392
             R +  E+ 
Sbjct  391  GRATEKEQV  399


>sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 
PE=1 SV=3
Length=1972

 Score = 55.2 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 72/367 (20%), Positives = 145/367 (40%), Gaps = 35/367 (10%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   + LQ+  E  Q+  + +++  Q   +  EE    Q   + E E     + EA ++ 
Sbjct  855   QAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETEL----YAEAEEMR  910

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL-------QESQ  157
              RL  +K +L+    +    +E  +   QQ+  ++  +  Q+  L  +L       Q+ Q
Sbjct  911   VRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQ  970

Query  158   SRLEAATKECQALEGRARAASEQARQLESEREAL-------------QQQHSVQVDQLRM  204
                  A  + + LE       +Q  +L  ER+ L             +++ +  + +L+ 
Sbjct  971   LEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKN  1030

Query  205   QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
             + +S+ + L +  +   + +++L +L+        ++   I             Q+ +LK
Sbjct  1031  KHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIAD--------LQAQIAELK  1082

Query  265   QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAE  324
              QL + EE L A    +D    E  Q    ++ +  L+      + D  +ER AR K  +
Sbjct  1083  MQLAKKEEELQAALARLDD---EIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEK  1139

Query  325   KKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQ  384
             +K  L E+LE L+ E      S      +   R++ V V +  L        + +    Q
Sbjct  1140  QKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQ  1199

Query  385   RRSPPEE  391
             + +   E
Sbjct  1200  KHAQAVE  1206


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 63/331 (19%), Positives = 132/331 (40%), Gaps = 13/331 (4%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L+D   Q++  ++ R E +   +  Q + K+F        ++ +E     + ++    +
Sbjct  1625  DLKDLELQADSAIKGREEAIKQLRKLQAQMKDF--------QRELEDARASRDEIFATAK  1676

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
             +  ++ + L+    Q+ ED A+ +        E +E    L ++     AL+   R    
Sbjct  1677  ENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEA  1736

Query  180   QARQLESEREALQQQHSVQVDQLR---MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQ  236
             +  QLE E E  Q       D++R    Q + +   L  ER  A + +    QL+   ++
Sbjct  1737  RIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLE-RQNK  1795

Query  237   LFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQ-QAEEALVAKQEVIDKLKEEAEQHKIVM  295
               +   + ++ +V    +     LE    QL+ Q E+    KQ     LK++ ++ K ++
Sbjct  1796  ELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEIL  1855

Query  296   ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
               V   +  A+ YK   +      ++L  + E  +E+ +++     KL+    E+    +
Sbjct  1856  LQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNE  1915

Query  356   MRKRHVEVSQAPLPPAPAYLSSPLALPSQRR  386
                R V   ++ L         P      RR
Sbjct  1916  AMGREVNALKSKLRRGNETSFVPSRRSGGRR  1946


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 49/305 (16%), Positives = 107/305 (35%), Gaps = 9/305 (3%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E  +R      + +  + + N  L      L   +     +K+ L  + QE +       
Sbjct  1213  EQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE  1272

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
               + +L  +  +   EVE +     +       +   V SL  +LQ++Q  L+  T++  
Sbjct  1273  RARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKL  1332

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              +  + R   E+   L+ +      +       L     ++   L   ++   +    + 
Sbjct  1333  NVSTKLRQLEEERNSLQDQL----DEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVE  1388

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
              L+    +  +E +N  +      +     +LE  K +LQQ  + LV     +D  ++  
Sbjct  1389  ALEEGKKRFQKEIENLTQQ--YEEKAAAYDKLEKTKNRLQQELDDLV---VDLDNQRQLV  1443

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                +        L A+     + +  ER   E  A +KE     L +   E  + K   +
Sbjct  1444  SNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELE  1503

Query  349   ESARI  353
              + ++
Sbjct  1504  RTNKM  1508


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 112/299 (37%), Gaps = 22/299 (7%)

Query  74    ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ  133
             +R ++L   +  QR    +L  +  +  +L  ++       ++++E   +E E  K  ++
Sbjct  808   KRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKER  867

Query  134   QMAEDKA---------SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE---QA  181
             Q   +            +  +   L  +LQ        A +    L  + +   E   + 
Sbjct  868   QQKAENELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM  927

Query  182   RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL----  237
                  E E   QQ   +  ++  Q   +E  L  E  A  + + +    +    +L    
Sbjct  928   EARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEI  987

Query  238   --FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE---EALVAKQEVIDKLKEEAEQHK  292
                 + +N +       E +      +L ++ ++A+   +     + +I +L+   ++ +
Sbjct  988   LVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEE  1047

Query  293   IVMETVPVLKAQADIYKADFQAERQ-AREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
                + +  LK + +   +DF  +    + ++AE K  L ++ E+LQ   ++L     + 
Sbjct  1048  KSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQK  1106


 Score = 41.4 bits (95),  Expect = 0.017, Method: Composition-based stats.
 Identities = 50/292 (17%), Positives = 109/292 (37%), Gaps = 25/292 (9%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             L+E  +     +    ++K  L  + +  +  +E         +  + +  +EV  LK+ 
Sbjct  1123  LQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKA  1182

Query  132   --------QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
                     + Q+ E +      V  L  +L++ +       K  Q LE      + + R 
Sbjct  1183  LDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRV  1242

Query  184   LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
             L   +    Q+   +  +L  Q Q +++      +A +E   K+ +LQ     +    + 
Sbjct  1243  LGQAK----QEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNE  1298

Query  244   HIKSSVVGSERKRG----------MQLEDLKQQLQQAEEALVAKQEV---IDKLKEEAEQ  290
                 ++  ++              +  E+ +Q+L  + +    ++E     D+L EE E 
Sbjct  1299  AEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEA  1358

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
              + +   +  L  Q    K   Q      E L E K+  Q+++E L ++Y +
Sbjct  1359  KQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEE  1410


 Score = 41.4 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 50/312 (16%), Positives = 119/312 (38%), Gaps = 13/312 (4%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             L+ +  EL    A + EE +  + +  +          +  +L+        +++  +  
Sbjct  1074  LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAA  1133

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA----RAASEQARQLESE  187
             + +  + K  +  ++ +L  EL+++        +     E       +A  E+ R  E++
Sbjct  1134  RNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQ  1193

Query  188   REALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS  247
              + ++Q+H+  V++L  Q +  + A     +     +++ A L      L Q      K 
Sbjct  1194  VQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQ-----AKQ  1248

Query  248   SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP----VLKA  303
              V   ++K   Q+++L+ +    E A     + + KL+ E E    ++         L  
Sbjct  1249  EVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAK  1308

Query  304   QADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEV  363
                   +  Q  ++  ++   +K  +  +L QL+ E + L+    E    +   +RH+  
Sbjct  1309  DVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHIST  1368

Query  364   SQAPLPPAPAYL  375
                 L  +   L
Sbjct  1369  LNIQLSDSKKKL  1380


 Score = 39.4 bits (90),  Expect = 0.065, Method: Composition-based stats.
 Identities = 46/244 (19%), Positives = 93/244 (38%), Gaps = 3/244 (1%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             +EN++   ++      L+E        +     EKE L  +   +      L  EK  L+
Sbjct  1676  KENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLE  1735

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
              +  Q   E+E  +   + M++       Q   L  EL   +S  +      Q LE + +
Sbjct  1736  ARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNK  1795

Query  176   AASEQARQLESE-REALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
                 +  ++E   +   +   +    ++    + VE   R ++ A    K+K  +L+   
Sbjct  1796  ELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEIL  1855

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
              Q+  E +  +         K   +++ LK+QL++AEE          KL+ E ++    
Sbjct  1856  LQV--EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATES  1913

Query  295   METV  298
              E +
Sbjct  1914  NEAM  1917


 Score = 37.9 bits (86),  Expect = 0.19, Method: Composition-based stats.
 Identities = 50/346 (14%), Positives = 132/346 (38%), Gaps = 4/346 (1%)

Query  46    GAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             G    L +  +E +  +  +    Q L+ +C +    +A   ++   L  + +    ++ 
Sbjct  1238  GELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLN  1297

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
                 + + L +       +++  +   Q+    K +V  ++  L  E    Q +L+   +
Sbjct  1298  EAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEME  1357

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
               Q LE      + Q    + +     Q  +  V+ L    +  +  +    Q   E+  
Sbjct  1358  AKQNLERHISTLNIQLSDSKKKL----QDFASTVEALEEGKKRFQKEIENLTQQYEEKAA  1413

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
                +L+   ++L QE D+ +       +    ++ +  K     AEE  ++ +   ++ +
Sbjct  1414  AYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDR  1473

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
              EAE  +   + + + +A  +  +A  + ER  +   AE ++L+  + +  +  +   K+
Sbjct  1474  AEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKS  1533

Query  346   SCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   ++E+M+ +  E+         A L   + + + +     +
Sbjct  1534  KRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERD  1579


 Score = 36.4 bits (82),  Expect = 0.60, Method: Composition-based stats.
 Identities = 41/252 (16%), Positives = 96/252 (38%), Gaps = 11/252 (4%)

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
             L  E  DL   K+   + V  L++ ++ +      +K Q+  L  ELQ ++         
Sbjct  1509  LKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVN  1568

Query  167   CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
              QAL+G+        +  + + E  ++Q   Q+ +   + +       +   A  + +  
Sbjct  1569  MQALKGQ---FERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKKLEGD  1625

Query  227   LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA---KQEVIDK  283
             L  L++      +  +  IK  +   + +      +L+      +E        ++    
Sbjct  1626  LKDLELQADSAIKGREEAIKQ-LRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKS  1684

Query  284   LKEEAEQHKIVMETVPVLKAQADIYKADFQAER----QAREKLAEKKELLQEQLEQLQRE  339
             L+ +  Q +  +      + QAD+ K +   E       R  L ++K  L+ ++ QL+ E
Sbjct  1685  LEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEE  1744

Query  340   YSKLKASCQESA  351
               + + + +  +
Sbjct  1745  LEEEQGNMEAMS  1756


>sp|E9Q9R9|DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 
GN=Dlg5 PE=1 SV=1
Length=1921

 Score = 55.2 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 73/390 (19%), Positives = 144/390 (37%), Gaps = 83/390 (21%)

Query  53   RCLEENQELRDAIRQSNQILRERCEE--------------LLHFQASQREEKEFLMCKFQ  98
            +C+    +L+    Q    L+ RCEE              LL  Q   +++ + L  +  
Sbjct  194  QCVRAMSDLQSLQNQHTNALK-RCEEVAKETDFYHTLHSRLLSDQTQLKDDVDMLRRENG  252

Query  99   EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
            + R+    L     D+KR +E+  +E+  L+  QQQ+ +   S +     L      +  
Sbjct  253  KLRRERNLLQQSWEDMKRLREEDQKEIGDLRAQQQQVLKHNGSSEI----LNKLYDTAMD  308

Query  159  RLEAATKECQALEGRARA--------------ASEQARQLESEREALQQQHSVQVDQLRM  204
            +LE   K+  AL  R                   E+ ++L+ + E L QQ    + QL+ 
Sbjct  309  KLEVVKKDYDALRKRYSEKVAMHNSDLSRLEQLGEENQRLQKQTEMLTQQRDTAI-QLQH  367

Query  205  Q-------GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG  257
            Q        +++   L        + + ++  LQ    +L  +     K S    E +  
Sbjct  368  QCALSLRRFETIHHELSKATAQNKDLQWEMELLQSELTELRSKQVKTAKESEKYKEERDA  427

Query  258  M----------------QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP--  299
            +                +L+ L+ +++ AE  L +         EE E  + + +TV   
Sbjct  428  VYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAASEEMEALRQIKDTVTMD  487

Query  300  ---------VLKAQADIYK---------ADFQAER-----QAREKLAEKKELLQEQLEQL  336
                     +L+ Q              AD    R     Q R+K+  +++ ++   + L
Sbjct  488  AGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNL  547

Query  337  QREYSK-LKASCQESARIEDMRKRHVEVSQ  365
            +RE  + +    +    ++D RK+  +VS+
Sbjct  548  RRERDRAVSELAEALRSLDDTRKQKNDVSR  577


 Score = 36.7 bits (83),  Expect = 0.44, Method: Composition-based stats.
 Identities = 37/242 (15%), Positives = 92/242 (38%), Gaps = 9/242 (4%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E LQ  L E +  +    + ++  +E  + +         E++ ++ +  + +  VE   
Sbjct  398  ELLQSELTELRSKQVKTAKESEKYKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAE  457

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             +      +K+ A  E+E L++ +  +  D      +V  L  + +     L+ A +E  
Sbjct  458  SKLKSSTSEKKAASEEMEALRQIKDTVTMDAGRANKEVEILRKQCKALCQELKEALQEAD  517

Query  169  --------ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                    A + R +  +E+   + +  + L+++    V +L    +S++   + +   +
Sbjct  518  VAKCRRDWAFQERDKIVAERDS-IRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVS  576

Query  221  SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             E K    Q++    +  +       SS   +     M+ E    + ++  E +  K   
Sbjct  577  RELKELKEQMECQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALG  636

Query  281  ID  282
             D
Sbjct  637  FD  638


>sp|Q8NFZ5|TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens 
OX=9606 GN=TNIP2 PE=1 SV=1
Length=429

 Score = 54.5 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 80/375 (21%), Positives = 150/375 (40%), Gaps = 24/375 (6%)

Query  61   LRDAIRQSNQILRE--RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            L DA+ +     RE  R +E    +A  R+E E L  + +E  + +++L      L + +
Sbjct  63   LVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQL------LSQPQ  116

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
             +  +EV  L+R   +    +A+      SL  E  + +  L A    CQ L  +     
Sbjct  117  HEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHL-AKCLDER  175

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
            + A++   ER   Q +H+     ++   + ++   R+ +Q  +  +   A+ Q  Y+   
Sbjct  176  QHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQ-RYNASR  234

Query  239  QEYDNHIKSSVVGSERKRGMQL--EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
             EY   + + + G +     +L  +++ +  +Q EE +    EV  +L          +E
Sbjct  235  DEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALE  294

Query  297  TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS----------  346
             V +L+ Q   YK DF +ER  RE+   + + L+E++  L  + S  + S          
Sbjct  295  RVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHA  354

Query  347  CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPD  406
              ++A+        + V     P   +    P A      +      D  CP C     D
Sbjct  355  GSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSD  414

Query  407  M--DTLQIHVMECIE  419
               + L  HV EC +
Sbjct  415  EQGEELLRHVAECCQ  429


>sp|F4IAR2|KN14O_ARATH Kinesin-like protein KIN-14O OS=Arabidopsis 
thaliana OX=3702 GN=KIN14O PE=3 SV=1
Length=1140

 Score = 54.8 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 105/275 (38%), Gaps = 32/275 (12%)

Query  52   QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
            Q+CL+    +    + +   + +R +EL   +      ++ L  + +E    +E++G E 
Sbjct  378  QQCLQ----MESKTKGATAGIEDRVKELEQMRKDASVARKALEERVRE----LEKMGKEA  429

Query  112  LDLKRQKEQALREVEHLK-------RCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              +K   E+ ++E++  K          +    +    K +  ++   L+     LE A 
Sbjct  430  DAVKMNLEEKVKELQKYKDETITVTTSIEGKNRELEQFKQETMTVTTSLEAQNRELEQAI  489

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
            KE   +     A + +  Q + E   +      +  +L       ++  +   + +  + 
Sbjct  490  KETMTVNTSLEAKNRELEQSKKETMTVNTSLKAKNRELEQNLVHWKSKAKEMEEKSELKN  549

Query  225  RKLAQLQVAYH-------QLFQE---YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
            R  +Q +++Y        Q  QE   Y   IK  ++  + K  ++   L ++L +  +A 
Sbjct  550  RSWSQKELSYRSFISFQCQALQELRFYSKSIKQEILKVQDKYTVEFSQLGKKLLELGDAA  609

Query  275  VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
                EV+ +       ++ +   +  LK    +Y 
Sbjct  610  ANYHEVLTE-------NQKLFNELQELKGNIRVYC  637


>sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 
2 OS=Mus musculus OX=10090 GN=Smc2 PE=1 SV=2
Length=1191

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 89/227 (39%), Gaps = 15/227 (7%)

Query  74   ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ  133
            E+  +L      + EE + L  K Q++     +   E   LK+  E++   ++  K  Q+
Sbjct  710  EKYRQLKQQWEMKTEEGDLLQTKLQQSS--YHKQQEELDALKKTIEESEETLKSTKEIQK  767

Query  134  QMAEDKASVKAQVT----SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESERE  189
            +  E   +++ ++         EL+++Q +L+ A  +  A   + +   ++   +  E E
Sbjct  768  KAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELE  827

Query  190  ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
             L+++H+        Q  +V  A++       +   ++A+ + + ++   E     +   
Sbjct  828  ELKREHASN----EQQLDAVNEAIKAYEGQIEKMAAEVAKNKESVNKAQDELMKQKQIIT  883

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
                  +    E  K  LQ  E      Q  I +L     +HK   +
Sbjct  884  AQDNIIKDKCAEVAKHNLQNNES-----QLKIKELDHSISKHKREAD  925


 Score = 50.6 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 95/229 (41%), Gaps = 19/229 (8%)

Query  84   ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
               R +   ++ KFQE + + + L  ++ +L+        E+  LK   ++  + K   +
Sbjct  665  GGARSQAASILTKFQEVKDVQDELRTKENELR----ALEEELAGLKNVAEKYRQLKQQWE  720

Query  144  AQVTS---LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD  200
             +      L  +LQ+S    +   +E  AL+     + E  +  +  ++  ++++    +
Sbjct  721  MKTEEGDLLQTKLQQSSYHKQQ--EELDALKKTIEESEETLKSTKEIQKKAEEKYEALEN  778

Query  201  QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL  260
            +++      E  L+  ++     K K      A  +  +E    +++  +  E  +    
Sbjct  779  KMKNAEAEREKELKDAQKKLDCAKTK----ADASSKKMKEKQQEVEAITLELEELKREHA  834

Query  261  EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK  309
             + +QQL    EA+ A +  I+K+  E  ++K       V KAQ ++ K
Sbjct  835  SN-EQQLDAVNEAIKAYEGQIEKMAAEVAKNKE-----SVNKAQDELMK  877


 Score = 42.9 bits (99),  Expect = 0.005, Method: Composition-based stats.
 Identities = 30/201 (15%), Positives = 88/201 (44%), Gaps = 9/201 (4%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEF----LMCKFQEARKLV  104
            + L++ +EE++E   + ++  +   E+ E L +   +   E+E        K   A+   
Sbjct  746  DALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKA  805

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ----ESQSRL  160
            +    +  + +++ E    E+E LKR      +   +V   + +  G+++    E     
Sbjct  806  DASSKKMKEKQQEVEAITLELEELKREHASNEQQLDAVNEAIKAYEGQIEKMAAEVAKNK  865

Query  161  EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
            E+  K    L  + +  + Q   ++ +   +  +H++Q ++ +++ + ++ ++   ++ A
Sbjct  866  ESVNKAQDELMKQKQIITAQDNIIKDKCAEVA-KHNLQNNESQLKIKELDHSISKHKREA  924

Query  221  SEEKRKLAQLQVAYHQLFQEY  241
             +   K++++   Y  +  E 
Sbjct  925  DDAAAKVSKMLSDYDWINAEK  945


 Score = 33.7 bits (75),  Expect = 4.8, Method: Composition-based stats.
 Identities = 46/272 (17%), Positives = 104/272 (38%), Gaps = 22/272 (8%)

Query  47   APETLQRCLEENQELRDAIRQSNQILRE----------RCEELLHFQASQREEKEFLMCK  96
            A +T +R   E +E++D I    ++L E            EEL   +  +   K   +  
Sbjct  242  AEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEIEELERRKDKETGGKLKSLED  301

Query  97   FQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLG-----  151
                 + V        DLK++   +       K  Q  MAED  ++ A+   +       
Sbjct  302  ACAEAQRVNTKSQSAFDLKKKNLASEETKR--KELQNSMAEDSKALAAKEKEVKKITDGL  359

Query  152  -ELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              LQE+ ++   A    Q       A      +  +E     Q  + + D  + Q ++ +
Sbjct  360  HGLQEASNKDAEALAAAQQHFNAVSAGLSS-NEDGAEATLAGQMIACKNDISKAQTEAKQ  418

Query  211  AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
            A ++++     E K K A+++      +++  +  ++     E+    +++ L  +  + 
Sbjct  419  AQMKLKHAQ-QELKSKQAEVK-KMDSGYKKDQDAFEAVKKAKEKLET-EMKKLNYEENKE  475

Query  271  EEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
            E+ L   +++   +     +H+ ++   P L+
Sbjct  476  EKLLEKHRQLSRDINNLKGKHEALLAKFPNLQ  507


>sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus 
OX=9796 GN=CTTNBP2 PE=3 SV=1
Length=1665

 Score = 55.2 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/201 (21%), Positives = 86/201 (43%), Gaps = 25/201 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLASRLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        + ++V     +L+E  ++LE   K+  ALE    A  
Sbjct  172  ------LMLVKECKQ--------LSSKVIEEAQKLEEVMAKLEEEKKKTSALEEELSAEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQ  259
            +  DN    S+    + R + 
Sbjct  271  RGNDNKPSLSLPRKTKDRRLV  291


 Score = 49.5 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 69/180 (38%), Gaps = 18/180 (10%)

Query  125  VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
            + H ++ Q++M+   A+ +++   L  E  + Q+  +   K    LE            L
Sbjct  115  MAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLASRLEEERGKNKHVVLML  174

Query  185  ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE---EKRKLAQLQVAYHQLFQEY  241
              E + L  +   +  +L      +E   +       E   EKR+  +++    +   E+
Sbjct  175  VKECKQLSSKVIEEAQKLEEVMAKLEEEKKKTSALEEELSAEKRRSTEMEAQMEKQLSEF  234

Query  242  DNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVL  301
                      +ER      E L+ +L + E      +E IDK+K+  EQ K   +  P L
Sbjct  235  ---------DTER------EQLRAKLHREEAHTTDLKEEIDKMKKMIEQLKRGNDNKPSL  279


 Score = 49.1 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 76/183 (42%), Gaps = 22/183 (12%)

Query  180  QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ  239
            + ++  S + A  +    +++  ++Q Q++E   +       EE+ K        H +  
Sbjct  120  KMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLASRLEEERGK------NKHVVLM  173

Query  240  EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP  299
                  + S    E  +   LE++  +L++ ++   A +E +   K  + + +       
Sbjct  174  LVKECKQLSSKVIEEAQK--LEEVMAKLEEEKKKTSALEEELSAEKRRSTEME-------  224

Query  300  VLKAQADIYKADFQAER-QAREKLAEKKEL---LQEQLEQLQREYSKLKASCQESARIED  355
               AQ +   ++F  ER Q R KL  ++     L+E+++++++   +LK        +  
Sbjct  225  ---AQMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLKRGNDNKPSLSL  281

Query  356  MRK  358
             RK
Sbjct  282  PRK  284


>sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 
2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1
Length=1203

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 101/236 (43%), Gaps = 15/236 (6%)

Query  74   ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQ  133
            ER  +L      + EE E L  K Q++     +   E   LK+  E++   +++ K  Q+
Sbjct  711  ERYRQLKQQWEMKSEEAELLQTKLQQSS--YHKQQEELDSLKQTIEESEETLKNTKEVQK  768

Query  134  QMAEDKASVKAQVT----SLLGELQESQSRLEAATKECQALEGRARAASEQARQLESERE  189
            +  E    ++ ++         EL+E+Q +L+ A K+  A   + +   ++   L  E E
Sbjct  769  KAEEKFKVLEHKMKNAEAERERELKEAQQKLDTAKKKADASNKKMKEKQQEVDALVLELE  828

Query  190  ALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
             L+++ +      + Q ++V+ A++  ++ A     ++++ + A  +  Q+     K  +
Sbjct  829  ELKREQTT----YKQQIETVDEAMKAYQEQADSMASEVSKNKEAVKK-AQDELAKQKEII  883

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
            +G ++    +++    +  +  E     Q  I +L+    +HK          A+ 
Sbjct  884  MGHDK----EIKTKSSEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKM  935


 Score = 39.0 bits (89),  Expect = 0.081, Method: Composition-based stats.
 Identities = 34/230 (15%), Positives = 96/230 (42%), Gaps = 11/230 (5%)

Query  47   APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
            + E L+   +   +L+D + ++ + ++E  +E+   +  + +E    +   +EA    +R
Sbjct  249  SAEELKEMQDSILKLQDTMAENERKVKELGKEIAELEKMRDQEVGGALRSLEEALSEAQR  308

Query  107  --------LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
                    L L+K ++K ++E+  +E+        ++   K     ++T  L  LQE+  
Sbjct  309  ADTKVQSALDLKKQNMKAEREKKRKELVKSMEEDAKVLTAKEKEVKKITDGLSSLQEASQ  368

Query  159  RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME--  216
            +   A    Q       A      +   E     Q  + + +  + + ++ +A ++++  
Sbjct  369  KDVEAFTSAQQHFNAVSAGLSS-NEDGEEATLAGQMMACKNETSKAETEAKQAQMKLKHA  427

Query  217  RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
            +Q    ++ ++ ++   Y +  + ++   KS        + +  ED +++
Sbjct  428  QQELKTKQAEVKKMDGGYKKDNEAFEAVKKSKEKLEVEMKKLNYEDGREE  477


 Score = 33.3 bits (74),  Expect = 5.1, Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 85/213 (40%), Gaps = 17/213 (8%)

Query  175  RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
            +   ++  +L+  +  L+++ +  + +L+ +  S      +E Q    E   L++L VAY
Sbjct  183  KTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSY-----LEYQKIMREIEHLSRLYVAY  237

Query  235  HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKI-  293
              +  E           ++ +   +L++++  + + ++ +   +  + +L +E  + +  
Sbjct  238  QFVCAE----------ETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIAELEKM  287

Query  294  -VMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
               E    L++  +      +A+ + +  L  KK+ ++ + E+ ++E  K      +   
Sbjct  288  RDQEVGGALRSLEEALSEAQRADTKVQSALDLKKQNMKAEREKKRKELVKSMEEDAKVLT  347

Query  353  IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
             ++   + +    + L  A            Q 
Sbjct  348  AKEKEVKKITDGLSSLQEASQKDVEAFTSAQQH  380


>sp|Q076A4|MYH8_CANLF Myosin-8 OS=Canis lupus familiaris OX=9615 
GN=MYH8 PE=3 SV=1
Length=1939

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 54/325 (17%), Positives = 138/325 (42%), Gaps = 13/325 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERCE+L+  +     + + +  + ++  ++ 
Sbjct  879   EEKMVTLLKEKNDLQLQVQSEADALADAEERCEQLIKNKIQLEAKIKEVTERAEDEEEIN  938

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  939   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  998

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  ER+   + +
Sbjct  999   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQERKLRMDLE  1054

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE--DLKQQLQQAEEALVAKQEVID  282
             R   +L+       +   +         E+ +  + E  +L  +++  +   +  Q+ I 
Sbjct  1055  RAKRKLEGDLKLAQESTMDAENDKQQLDEKLKKKEFEISNLLSKIEDEQAIEIQLQKKIK  1114

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
             +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              K
Sbjct  1115  ELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNKK  1171

Query  343   LKASCQESAR-IEDMRKRHVEVSQA  366
              +A  Q+  R +E+   +H   +  
Sbjct  1172  REAEFQKMRRDLEEATLQHEATAAT  1196


 Score = 50.6 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 63/334 (19%), Positives = 123/334 (37%), Gaps = 14/334 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
               R L+E   L   + +S Q   ++ EEL      + + K  L    Q +R         
Sbjct  1292  YSRQLDEKDALVSQLSRSKQASTQQIEELKRQLEEETKAKNALAHALQSSRH--------  1343

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+    
Sbjct  1344  --DCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR  1401

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ 
Sbjct  1402  LQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLAEW  1461

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E +   K +   S     ++   E+   Q++  +      Q+ I  L E+ 
Sbjct  1462  KQKYEETQAELEASQKEARTLSTELFKVKNAYEESLDQVETLKRENKNLQQEISDLTEQI  1521

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  +K Q +  K D QA  E        E+ ++L+ QLE  Q +    +  
Sbjct  1522  AEGGKQIHELEKIKKQVEQEKCDIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKI  1581

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              ++   I+ +++ H+ V ++      A + S   
Sbjct  1582  AEKDEEIDQLKRNHIRVMESMQSTLDAEIRSRND  1615


 Score = 41.0 bits (94),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/286 (15%), Positives = 101/286 (35%), Gaps = 5/286 (2%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL       E L+  L   +   + ++   + LR   E+    + +  +E     
Sbjct  1656  KDTQLHLDDALRGQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKTAEQELLDAS  1715

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              + Q        L   K  L+    Q   EVE + +  +   E           +  EL+
Sbjct  1716  ERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELK  1775

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
             + Q       +  + +E   +    +  + E       ++   Q+ +L  +   +E  + 
Sbjct  1776  KEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVHELEGEVE  1832

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEE  272
              E++  +E  + L + +    +L  + +   K+ +   +    +Q  ++  K+Q ++AEE
Sbjct  1833  SEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEE  1892

Query  273   ALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
                       KL+ E E+ +   +       +  +   +   +  A
Sbjct  1893  QSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKISA  1938


 Score = 38.7 bits (88),  Expect = 0.11, Method: Composition-based stats.
 Identities = 62/350 (18%), Positives = 139/350 (40%), Gaps = 21/350 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E  +  +  +++  E L  K  E   L+ ++
Sbjct  1040  EGSLEQERKLRMDLERAKRKLEGDLKLAQESTMDAENDKQQLDEKLKKKEFEISNLLSKI  1099

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A 
Sbjct  1100  EDEQAIEIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1159

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME-------R  217
                 A     +    + +++  + E    QH      LR +     A L  +       +
Sbjct  1160  GATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVK  1219

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             Q   +EK ++ ++++       E  +  K ++    R    Q+ +LK + ++ +  +   
Sbjct  1220  QKLEKEKSEM-KMEIDDLASNAETISKAKGNLEKMCRTLEDQVSELKTKEEEQQRLINDL  1278

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
                  +L+ EA ++   ++    L +Q            ++++   ++ E L+ QLE+  
Sbjct  1279  TAQRARLQTEAGEYSRQLDEKDALVSQLS----------RSKQASTQQIEELKRQLEEET  1328

Query  338   REYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +  + L  + Q S    D+ +   E  Q         LS   +  +Q R+
Sbjct  1329  KAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRT  1378


 Score = 38.3 bits (87),  Expect = 0.17, Method: Composition-based stats.
 Identities = 86/416 (21%), Positives = 161/416 (39%), Gaps = 57/416 (14%)

Query  8     SQLCEMVQPSGGPAADQDVLGEESPLGKPAMLH-LPSEQGAPETLQRCLEENQE----LR  62
             SQL    Q S     +     EE    K A+ H L S +   + L+   EE QE    L+
Sbjct  1304  SQLSRSKQASTQQIEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQ  1363

Query  63    DAIRQSNQIL---RERCEELLHFQASQREE-KEFLMCKFQEARKLVERLGLEKLDLKRQK  118
              A+ ++N  +   R + E     +  + EE K+ L  + QEA + VE +  +   L++ K
Sbjct  1364  RALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTK  1423

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
             ++   EVE L    ++     A++  +  +    L E + + E    E +A +  AR  S
Sbjct  1424  QRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLAEWKQKYEETQAELEASQKEARTLS  1483

Query  179   --------------EQARQLESEREALQQ-------------QHSVQVDQLRMQGQS---  208
                           +Q   L+ E + LQQ             +   ++++++ Q +    
Sbjct  1484  TELFKVKNAYEESLDQVETLKRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKC  1543

Query  209   --------VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL  260
                      EA+L  E       + +L Q++    +   E D  I        R      
Sbjct  1544  DIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRVMESMQ  1603

Query  261   EDLKQQLQQAEEALVAKQEVIDKLKEEAEQ----HKIVMETVPVLKAQADIYK-ADFQAE  315
               L  +++   +AL  K+++   L E   Q    +++  E++   +    I K      +
Sbjct  1604  STLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKDTQLHLD  1663

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPA  371
                R +     E L+EQL  ++R  + L+A  +E     +  +R  + ++  L  A
Sbjct  1664  DALRGQ-----EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKTAEQELLDA  1714


>sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus 
musculus OX=10090 GN=Rabgap1 PE=1 SV=1
Length=1064

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 83/211 (39%), Gaps = 9/211 (4%)

Query  93    LMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGE  152
             L C  + ++K +++   E   ++ Q+ Q    +E  +R  +++ E    ++ +   L  E
Sbjct  798   LACNTKISQKKLKKFEKEYHTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHE  857

Query  153   LQESQS----RLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
             L  S+      L+ A ++  AL        ++    E E+  L+++ +   +  R +   
Sbjct  858   LVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEDEKRRLEEESAQLKEMCRRELDK  917

Query  209   VEAALRMERQAASEEKRKLAQLQVAYHQ---LFQEYDNHIKSSVVGSERKRGMQLEDLKQ  265
              E+ ++       + K+  +QL     +     +     I+  V   +R R    ++   
Sbjct  918   AESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCDRCRDFFNKE--G  975

Query  266   QLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
             +++    A     E  D+ KE  +     ME
Sbjct  976   RVKGISSAKGVSDEDTDEEKETLKNQLREME  1006


 Score = 32.5 bits (72),  Expect = 9.0, Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 22/143 (15%)

Query  50    TLQRCLEENQELRDAIRQSNQILRERCE-ELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             T Q+ ++   E R    +S Q L+E C  EL   ++  ++    +    Q   +L ERL 
Sbjct  886   TKQKLIDAEDEKRRLEEESAQ-LKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLE  944

Query  109   LEKLDLKRQKEQALREVEHLKRCQ--------------------QQMAEDKASVKAQVTS  148
              ++   K + E+  ++V+   RC+                    +   E+K ++K Q+  
Sbjct  945   KQQTANKVEIEKIRQKVDDCDRCRDFFNKEGRVKGISSAKGVSDEDTDEEKETLKNQLRE  1004

Query  149   LLGELQESQSRLEAATKECQALE  171
             +  EL +++ +L  A  + Q LE
Sbjct  1005  MELELAQTKLQLVEAECKIQDLE  1027


>sp|Q7TNF8|RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated 
protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 
SV=2
Length=1846

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 83/216 (38%), Gaps = 28/216 (13%)

Query  61   LRDAIRQSNQILRE-----RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
            L+D +     +LRE     R ++L      +R++ E L  + ++ ++  E L L+    +
Sbjct  313  LQDDVESPQVVLREPEKQQRVQQLESELCKKRKKCESLEQEARKKQRRCEELELQLRAAQ  372

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             +  + + E   L       A +K  V+ + + L G+L       ++A  + Q L+ +  
Sbjct  373  NENARLVEENSRLS----GRATEKEQVEWENSELKGQLLGVTQERDSALLKSQGLQSKLE  428

Query  176  AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
            +  +  + +              V Q R Q +      R+  Q   EE R+L Q Q    
Sbjct  429  SLEQVLKHMRE------------VAQRRQQLEVEHEQARLSLQEKQEEVRRLQQAQAEAK  476

Query  236  -------QLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
                   QL +   + +++ V   E +   Q E   
Sbjct  477  REHEGAVQLLESTLDSMQARVRELEGQCRSQTERFS  512


>sp|Q9EP53|TSC1_MOUSE Hamartin OS=Mus musculus OX=10090 GN=Tsc1 
PE=1 SV=1
Length=1161

 Score = 54.8 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 57/303 (19%), Positives = 105/303 (35%), Gaps = 25/303 (8%)

Query  7    KSQLCEMVQPSGGPAADQDVLGEESPLGKP---AMLHLPSEQ-------GAPETLQRCLE  56
            K    E   PS  P    D L E+         + L LPS+        G+P +     +
Sbjct  629  KGNPEEDCVPSTSPMEVLDRLIEQGAGAHSKELSRLSLPSKSVDWTHFGGSPPS-----D  683

Query  57   ENQELRDAIRQSNQILR-ERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
            E + LRD +   +  L  ER +   H   ++R     L+ K   A  L E     K  LK
Sbjct  684  ELRTLRDQLLLLHNQLLYERFKRQQHALRNRR-----LLRKVIRAAALEEHNAAMKDQLK  738

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             Q++        L++ Q + ++ +      VT L  ++++ Q   E    + Q L+ +  
Sbjct  739  LQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTQLHSQIRQLQHDREEFYNQSQELQTKLE  798

Query  176  AASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYH  235
                   +L  E            + L  Q     +     +Q      R+L  L     
Sbjct  799  DCRNMIAELRVE-LKKANNKVCHTELLLSQVSQKLSNSESVQQQMEFLNRQLLVLGEVNE  857

Query  236  QLFQEYDNHIKSSVVGSERKRGMQLEDL---KQQLQQAEEALVAKQEVIDKLKEEAEQHK  292
               ++  +    +    E  +    ++L   +  L Q  + L A Q  + +L+    +  
Sbjct  858  LYLEQLQSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQRLDASQRRVLELESLLAKKD  917

Query  293  IVM  295
             ++
Sbjct  918  HLL  920


 Score = 50.6 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 97/249 (39%), Gaps = 28/249 (11%)

Query  52   QRCLEENQELRDAIR-----QSNQILRERCE----ELLHFQASQREEKEFLMCKFQEARK  102
            Q  L   + LR  IR     + N  ++++ +    ++  ++ S ++E+       QE R 
Sbjct  708  QHALRNRRLLRKVIRAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQ-LQEQRD  766

Query  103  LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
             +         L  Q  Q   + E      Q++       +  +  L  EL+++ +++  
Sbjct  767  TMVT------QLHSQIRQLQHDREEFYNQSQELQTKLEDCRNMIAELRVELKKANNKVCH  820

Query  163  ATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE  222
                             Q  Q  S  E++QQQ      QL + G+  E  L   +    +
Sbjct  821  TE-----------LLLSQVSQKLSNSESVQQQMEFLNRQLLVLGEVNELYLEQLQSKHPD  869

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
              +++  ++ AY +  ++  +H+       +  +   L +L+  L + +  L+ +++ ++
Sbjct  870  TTKEVEMMKTAYRKELEKNRSHLLQQNQRLDASQRRVL-ELESLLAKKDHLLLEQKKYLE  928

Query  283  KLKEEAEQH  291
             +K +A   
Sbjct  929  DVKSQASGQ  937


 Score = 37.5 bits (85),  Expect = 0.24, Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 69/187 (37%), Gaps = 12/187 (6%)

Query  50   TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
            +LQ+      +L++        L  +  +L H +     + + L  K ++ R ++  L +
Sbjct  750  SLQKEQARYSQLQEQRDTMVTQLHSQIRQLQHDREEFYNQSQELQTKLEDCRNMIAELRV  809

Query  110  EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
            E      +       +  +     Q   +  SV+ Q+  L  +L      L         
Sbjct  810  ELKKANNKVCHTELLLSQVS----QKLSNSESVQQQMEFLNRQL------LVLGEVNELY  859

Query  170  LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR--MERQAASEEKRKL  227
            LE       +  +++E  + A +++       L  Q Q ++A+ R  +E ++   +K  L
Sbjct  860  LEQLQSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQRLDASQRRVLELESLLAKKDHL  919

Query  228  AQLQVAY  234
               Q  Y
Sbjct  920  LLEQKKY  926


>sp|Q076A3|MYH13_CANLF Myosin-13 OS=Canis lupus familiaris OX=9615 
GN=MYH13 PE=3 SV=1
Length=1940

 Score = 54.5 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 63/334 (19%), Positives = 120/334 (36%), Gaps = 6/334 (2%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   +N EL   + +   ++ +  +          E K  L  + +    L   L   + 
Sbjct  1283  RLQTQNGELSHQLEEKESLISQLTKGKQALTQQLEELKRQLEEETKAKNALAHALQSSRH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A   +E      +  E  +Q+   +VD L +  +    A  +  +   +  + LA+ + 
Sbjct  1403  EAEENTEAVSSKCASLEKTKQRLQGEVDDLMLDLERTSTARAILDRKQRDLDKVLAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
                    E +   K S   S     MQ   E++  QL+         QE I  L E+  +
Sbjct  1463  KLDGSQAELEAAQKGSRSLSTEIFKMQNAYEEVVDQLETLRRENKNLQEEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKL----AEKKELLQEQLEQLQREYSKLKAS  346
                 ++ V   K Q +  K+D Q   +  E       E+ ++L+ QLE  Q +    +  
Sbjct  1523  TGKHLQEVEKSKKQVEQEKSDLQVALEEVEASGSLEHEESKILRVQLELSQVKSELDRRV  1582

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              ++   IE +++     ++A      A + S   
Sbjct  1583  TEKDEEIEQLKRNSQRAAEAMQSMLDAEIRSRND  1616


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 65/362 (18%), Positives = 152/362 (42%), Gaps = 20/362 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERCE L+  +     + + L  + +E  ++ 
Sbjct  878   EEKMVSLLQEKNDLQLQVQSETENLIDAEERCEGLIKSKIQLEAKVKELNERLEEEEEVN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +     R+++ L+    ++ ++K + + +V +L  E+   +  +   T
Sbjct  938   SDLVAKKRSLEDKCSSLKRDIDDLELTLTKVEKEKHATENKVKNLSEEMTALEENISKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE ++L+   + A +  +  E +   L         +L  Q   +E +L  E++  ++ +
Sbjct  998   KEKKSLQEAHQQALDDLQVEEDKVNGL----IKINVKLEQQTDDLEGSLEQEKKLRADLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHI---KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +   K  V    +K+  ++  L+ ++   +   +  Q+ I
Sbjct  1054  RIKKKLEGDL-KLSQESIMDLENDKQQVEEKLKKKEFEISQLQTKIDDEQVHSLQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQREY  340
              +L+   E+ +  +E     +A+A+  ++D   E  +  E+L E   +   Q+E  ++  
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEASGVTSAQVEMNKKRE  1172

Query  341   SKL--------KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             ++         +A+ Q  A    +RK+H +                  L  ++     E 
Sbjct  1173  AEFQKLRRDLEEATLQHEATTAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEI  1232

Query  393   PD  394
              D
Sbjct  1233  DD  1234


 Score = 43.7 bits (101),  Expect = 0.003, Method: Composition-based stats.
 Identities = 56/343 (16%), Positives = 130/343 (38%), Gaps = 4/343 (1%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             +G+ E  ++   + + ++  +    ++ +E   +L + +    E+ +    +  + +  +
Sbjct  1039  EGSLEQEKKLRADLERIKKKLEGDLKLSQESIMDLENDKQQVEEKLKKKEFEISQLQTKI  1098

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             +   +  L L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A+
Sbjct  1099  DDEQVHSLQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAS  1158

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                 A     +    + ++L  + E    QH      LR +     A L  +       K
Sbjct  1159  GVTSAQVEMNKKREAEFQKLRRDLEEATLQHEATTAALRKKHADSVAELGEQIDNLQRVK  1218

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
             +KL + +        +  ++I++          M      Q  +   +     Q + D  
Sbjct  1219  QKLEKEKSELKMEIDDLASNIETVSKSKSNVERMCRTVEDQFNEIKAKDDQQTQLIHDLN  1278

Query  285   KEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
              ++A       E    L  Q +  ++      + ++ L ++ E L+ QLE+  +  + L 
Sbjct  1279  MQKARLQTQNGE----LSHQLEEKESLISQLTKGKQALTQQLEELKRQLEEETKAKNALA  1334

Query  345   ASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
              + Q S    D+ +   E  Q         LS   +  +Q R+
Sbjct  1335  HALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRT  1377


 Score = 37.5 bits (85),  Expect = 0.27, Method: Composition-based stats.
 Identities = 45/275 (16%), Positives = 111/275 (40%), Gaps = 19/275 (7%)

Query  50    TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
             T+Q  L+++Q   D   +SN+ L+E+   +        EE E +    ++  +       
Sbjct  1651  TVQGQLKDSQLHLDDALRSNEDLKEQLAIVERRNGLLLEELEEMKAALEQTERTRRLSEQ  1710

Query  110   EKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQA  169
             E LD   + +    +   L   ++++  D A  +A+V + L E + ++ + + A  +   
Sbjct  1711  ELLDASDRVQLLHSQNTSLINTKKKLEVDIAQCQAEVENSLQESRNAEEKAKKAITDAAM  1770

Query  170   LEGRARAASEQARQLESEREALQQQH------------------SVQVDQLRMQGQSVEA  211
             +    +   + +  LE  ++ L+Q                      Q+ +L  + + +E+
Sbjct  1771  MAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELES  1830

Query  212   ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
              L  E++  +E  +   + +    +L  + +   K+ +   +    +Q + +K   +QAE
Sbjct  1831  ELDAEQKRGAEALKGAHKYERKVKELTYQAEEDRKNILRLQDLVDKLQAK-VKAYKRQAE  1889

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             EA       + K +    + +   E   + ++Q +
Sbjct  1890  EAEEQANTQMSKCRRVQHELEEAEERADIAESQVN  1924


 Score = 35.2 bits (79),  Expect = 1.3, Method: Composition-based stats.
 Identities = 45/251 (18%), Positives = 95/251 (38%), Gaps = 19/251 (8%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             ++  LE+ +  R    Q      +R + L     S    K+ L     + +  VE    E
Sbjct  1694  MKAALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEVDIAQCQAEVENSLQE  1753

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT------  164
               + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A       
Sbjct  1754  SRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKG  1813

Query  165   --KECQALEGRARAASEQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
               K+ Q LE R R    +    ++  +E      ++  +V +L  Q +      R     
Sbjct  1814  GKKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKELTYQAE----EDRKNILR  1869

Query  220   ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE---EALVA  276
               +   KL     AY +  +E +    + +    R +  +LE+ +++   AE     L A
Sbjct  1870  LQDLVDKLQAKVKAYKRQAEEAEEQANTQMSKCRRVQH-ELEEAEERADIAESQVNKLRA  1928

Query  277   KQEVIDKLKEE  287
             K   +   K E
Sbjct  1929  KSRDVGAQKME  1939


 Score = 35.2 bits (79),  Expect = 1.7, Method: Composition-based stats.
 Identities = 47/314 (15%), Positives = 112/314 (36%), Gaps = 7/314 (2%)

Query  60    ELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKE  119
             +L +   Q     R+  E   H +  Q + K+  +    +A +  E L  +   ++R+  
Sbjct  1627  DLNELEIQLGHSSRQVAETQKHLRTVQGQLKDSQLH-LDDALRSNEDLKEQLAIVERRNG  1685

Query  120   QALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASE  179
               L E+E +K   +Q    +   + ++      +Q   S+  +     + LE        
Sbjct  1686  LLLEELEEMKAALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEVDIAQCQA  1745

Query  180   QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ  239
             +      E    +++    +    M  + ++            +K     ++   H+L +
Sbjct  1746  EVENSLQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDE  1805

Query  240   EYDNHIKSSVVGSERKRGMQLE---DLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
                  +K      ++      E   +L  + ++  EAL    +   K+KE   Q +   +
Sbjct  1806  AEQLALKGGKKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKELTYQAEEDRK  1865

Query  297   TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDM  356
              +  L+   D  +A  +A ++  E   E +E    Q+ + +R   +L+ + + +   E  
Sbjct  1866  NILRLQDLVDKLQAKVKAYKRQAE---EAEEQANTQMSKCRRVQHELEEAEERADIAESQ  1922

Query  357   RKRHVEVSQAPLPP  370
               +    S+     
Sbjct  1923  VNKLRAKSRDVGAQ  1936


 Score = 34.8 bits (78),  Expect = 1.8, Method: Composition-based stats.
 Identities = 44/283 (16%), Positives = 105/283 (37%), Gaps = 45/283 (16%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQRE---EKEFLMCKFQEARKLVE  105
             + L+    EN+ L++ I    + + E  + L   + S+++   EK  L    +E      
Sbjct  1497  DQLETLRRENKNLQEEISDLTEQIAETGKHLQEVEKSKKQVEQEKSDLQVALEEVEASGS  1556

Query  106   RLGLEKLDLKRQKE-------------QALREVEHLKRCQQQMAE---------------  137
                 E   L+ Q E             +   E+E LKR  Q+ AE               
Sbjct  1557  LEHEESKILRVQLELSQVKSELDRRVTEKDEEIEQLKRNSQRAAEAMQSMLDAEIRSRND  1616

Query  138   ---DKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
                 K  ++  +  L  +L  S  ++    K  + ++G+ + +           E L++Q
Sbjct  1617  ALRLKKKMEGDLNELEIQLGHSSRQVAETQKHLRTVQGQLKDSQLHLDDALRSNEDLKEQ  1676

Query  195   HSV----------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
              ++          ++++++   +  E   R+  Q   +   ++  L      L       
Sbjct  1677  LAIVERRNGLLLEELEEMKAALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTK-KK  1735

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             ++  +   + +    L++ +   ++A++A+     + ++LK+E
Sbjct  1736  LEVDIAQCQAEVENSLQESRNAEEKAKKAITDAAMMAEELKKE  1778


>sp|Q6A163|K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo 
sapiens OX=9606 GN=KRT39 PE=1 SV=2
Length=491

 Score = 54.1 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 56/347 (16%), Positives = 126/347 (36%), Gaps = 26/347 (7%)

Query  85   SQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK-EQALREVEHLKRCQQQMAEDKASVK  143
            +++E  + L  +     + V  L  E  +L+ +  E++ +E+  L             ++
Sbjct  95   NEKETMQILNERLANYLQKVRMLERENAELESKIQEESNKELPVLCPDYLSYYTTIEELQ  154

Query  144  AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQV---D  200
             ++     E     S+++        L  +  A     + +ES+   L+Q  +V      
Sbjct  155  QKILCTKAENSRLVSQIDNTKLTADDLRAKYEAEVSLRQLVESDANGLKQILNVLTLGKA  214

Query  201  QLRMQGQSVEAALRMERQAASEEKRKL-------------AQLQVAYHQLFQE----YDN  243
             L  Q QS++  L   +    EE   L             A      +Q+ QE    Y+ 
Sbjct  215  DLEAQVQSLKEELLCLKNNHKEEINSLQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEP  274

Query  244  HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKA  303
             ++++    E+    Q+E+L QQ+  + +     Q+ I +L+      ++ ++    ++ 
Sbjct  275  IMETNRKDVEQWFNTQIEELNQQVVTSSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRD  334

Query  304  QADIYKADFQAERQA-----REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK  358
              +    + +A   A     +  +   +  L E    L+R+  + +      +R+E    
Sbjct  335  SQECILTETEARYTALLTQIQSLIDNLEAQLAEIRCALERQNQEYEILLDVKSRLECEIT  394

Query  359  RHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAP  405
             +  + ++     P Y  +    PS   S      +   P C   +P
Sbjct  395  TYRSLLESSDGKRPCYPRATKCEPSPWTSCKSGAIESTAPACTSSSP  441


>sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus OX=10036 
GN=MYH6 PE=2 SV=2
Length=1939

 Score = 54.5 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 53/325 (16%), Positives = 140/325 (43%), Gaps = 13/325 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  876   EEKMVSLLQEKNDLQFQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  935

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  936   AELTSKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  995

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  996   KEKKALQEAHQQALDDLQAEEDKVNTLTKSKV----KLEQQVDDLEGSLEQEKKVRMDLE  1051

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA-EEALVAK-QEVID  282
             R   +L+   +   +   +     +   E+ +  + +  +Q  +   E+AL  + Q+ + 
Sbjct  1052  RAKRKLEGDLNVTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLK  1111

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
             + +   E+ +  +E     +A+ +  ++D   E    E+++E+ E              K
Sbjct  1112  ENQARIEELEEELEAERTARAKVEKLRSDLTRE---LEEISERLEEAGGATSVQIEMNKK  1168

Query  343   LKASCQESAR-IEDMRKRHVEVSQA  366
              +A  Q+  R +E+   +H   + A
Sbjct  1169  REAEFQKMRRDLEEATLQHEATAAA  1193


 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 51/308 (17%), Positives = 117/308 (38%), Gaps = 2/308 (1%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
                +E  E    + +E  + +  L  EK DL+ Q +     +   +    Q+ ++K  ++
Sbjct  859   GRVKESLEKSEARRKELEEKMVSLLQEKNDLQFQVQAEQDNLNDAEERCDQLIKNKIQLE  918

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
             A+V  +   L++ +      T + + LE       +    LE     ++++     ++++
Sbjct  919   AKVKEMTERLEDEEEMNAELTSKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVK  978

Query  204   MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL  263
                + +     +  +   E+K      Q A   L  E D    +++  S+ K   Q++DL
Sbjct  979   NLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKV--NTLTKSKVKLEQQVDDL  1036

Query  264   KQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA  323
             +  L+Q ++  +  +    KL+ +    +  +  +   K Q +      + +   +    
Sbjct  1037  EGSLEQEKKVRMDLERAKRKLEGDLNVTQESIMDLENDKLQLEEKLKKKEFDISQQNSKI  1096

Query  324   EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPS  383
             E ++ L  QL++  +E        +E    E   +  VE  ++ L      +S  L    
Sbjct  1097  EDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAG  1156

Query  384   QRRSPPEE  391
                S   E
Sbjct  1157  GATSVQIE  1164


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 56/314 (18%), Positives = 120/314 (38%), Gaps = 14/314 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L R LEE + L   + +      ++ E+L      + + K  L    Q AR       L 
Sbjct  1289  LARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSAR---HDCDLL  1345

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
             +   + + E        L +   ++A+ +   +        EL+E++ +L       Q  
Sbjct  1346  REQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQ---RLQDA  1402

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             E    A + +   LE  +  LQ +    ++ L +  +   AA     +      + LA+ 
Sbjct  1403  EEAVEAVNAKCSSLEKTKHRLQNE----IEDLMVDVERSNAAAAALDKKQRNFDKILAEW  1458

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+ 
Sbjct  1459  KQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQL  1518

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  ++ Q ++ K + Q+  E        E+ ++L+ QLE  Q +    +  
Sbjct  1519  GEGGKNVHELEKVRKQLEVEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKL  1578

Query  347   CQESARIEDMRKRH  360
              ++   +E  ++ H
Sbjct  1579  AEKDEEMEQAKRNH  1592


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 101/229 (44%), Gaps = 8/229 (3%)

Query  75    RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQ  134
             + ++ LH     +E    +  +    +  +E L       +R ++ A +E+       Q 
Sbjct  1658  QLDDALHANDDLKENIAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQL  1717

Query  135   MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
             +     S+  Q   +  +L + Q+ +E A +EC+  E +A+ A   A  +  E    +Q 
Sbjct  1718  LHSQNTSLINQKKKMEADLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEE-LKKEQD  1776

Query  195   HSVQVDQLRMQGQSVEAALR-----MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
              S  +++++   +     L+      E+ A    K++L +L+    +L  E +   K + 
Sbjct  1777  TSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNA  1836

Query  250   VGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
                +  R  +  +++L  Q ++ ++ LV  Q+++DKL+ + + +K   E
Sbjct  1837  ESVKGMRKSERRIKELTYQTEEDKKNLVRLQDLVDKLQLKVKAYKRQAE  1885


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 62/341 (18%), Positives = 127/341 (37%), Gaps = 47/341 (14%)

Query  41    LPSEQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEEL  79
             +  EQ     LQ+ L+ENQ                     +LR  + +  + + ER EE 
Sbjct  1096  IEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEA  1155

Query  80    LHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAED  138
                 + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   
Sbjct  1156  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1215

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH-SV  197
             K  ++ + +    EL +  S +E   K    LE  +R   +QA +   + E  Q+     
Sbjct  1216  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEESQRSLNDF  1275

Query  198   QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE----  253
                + ++Q ++ E A ++E +       +L + +++Y Q  ++    ++           
Sbjct  1276  TTQRAKLQTENGELARQLEEK--EALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAH  1333

Query  254   --RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
               +      + L++Q ++  EA    Q V+ K   E  Q +   ET  + +         
Sbjct  1334  ALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRT--------  1385

Query  312   FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                     E+L E K+ L ++L+  +     + A C    +
Sbjct  1386  --------EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1418


 Score = 40.6 bits (93),  Expect = 0.034, Method: Composition-based stats.
 Identities = 46/249 (18%), Positives = 106/249 (43%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  +E+ +  R    Q      ER + L     S   +K+ +     + +  V
Sbjct  1684  QAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLTQLQTEV  1743

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1744  EEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAE  1803

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E EA Q++++  V  +R      E  ++       E+
Sbjct  1804  QIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMR----KSERRIKELTYQTEED  1859

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             K+ L +LQ    +L Q      K     +E +    L   ++   +L +AEE     +  
Sbjct  1860  KKNLVRLQDLVDKL-QLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQ  1918

Query  281   IDKLKEEAE  289
             ++KL+ ++ 
Sbjct  1919  VNKLRAKSR  1927


 Score = 35.6 bits (80),  Expect = 1.2, Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 103/282 (37%), Gaps = 16/282 (6%)

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
             L L+++ ++    +E L+   +     +A V+   + L  EL+E   RLE A        
Sbjct  1104  LQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAGGATSVQI  1163

Query  172   GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                +    + +++  + E    QH      LR +     A L  +       K+KL + +
Sbjct  1164  EMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEK  1223

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRG------MQLEDLKQQLQQAEEALVAKQEVIDKLK  285
               +     +  ++++  +               Q  + + +L++++ +L        KL+
Sbjct  1224  SEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEESQRSLNDFTTQRAKLQ  1283

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
              E  +    +E    L +Q            + +    ++ E L+ QLE+  +  + L  
Sbjct  1284  TENGELARQLEEKEALISQLT----------RGKLSYTQQMEDLKRQLEEEGKAKNALAH  1333

Query  346   SCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1334  ALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRT  1375


 Score = 33.7 bits (75),  Expect = 4.4, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 91/229 (40%), Gaps = 23/229 (10%)

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH---S  196
             A  + ++ ++  E    +  LE +    + LE +  +  ++   L+ + +A Q       
Sbjct  845   AETEKEMANMKEEFGRVKESLEKSEARRKELEEKMVSLLQEKNDLQFQVQAEQDNLNDAE  904

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ-----------------  239
              + DQL      +EA ++   +   +E+   A+L     +L                   
Sbjct  905   ERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTSKKRKLEDECSELKKDIDDLELTLA  964

Query  240   --EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV-AKQEVIDKLKEEAEQHKIVME  296
               E + H   + V +  +    L+++  +L + ++AL  A Q+ +D L+ E ++   + +
Sbjct  965   KVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTK  1024

Query  297   TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             +   L+ Q D  +   + E++ R  L   K  L+  L   Q     L+ 
Sbjct  1025  SKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLNVTQESIMDLEN  1073


>sp|A0A8M9PQ61|DESPB_DANRE Desmoplakin-B OS=Danio rerio OX=7955 
GN=dspb PE=2 SV=1
Length=2207

 Score = 54.5 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 51/317 (16%), Positives = 116/317 (37%), Gaps = 31/317 (10%)

Query  58   NQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMC----------KFQEARKLVERL  107
            N  L+DA+ Q  Q L      LL  +  +R E    M           + +E  + V RL
Sbjct  537  NASLQDALLQYQQELNNSQSHLLSLEEVKRTETMKCMATQESLDSSKDRLEELTEEVRRL  596

Query  108  GLEKLDLKRQKE------------------QALREVEHLKRCQQQMAEDKASVKAQVTSL  149
             L+  D++R+K+                  + L+E+E     + ++ +  +    ++  L
Sbjct  597  KLQLEDMERKKKIVEERYTFLQEEHDETMRKKLKELEQASWAKMELEKTVSERNRELERL  656

Query  150  LGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV  209
              EL++   R++ A  E   +         + +Q    +  + Q     + +L  + +S 
Sbjct  657  RKELEDEARRIKEAQTELAKVRQEHSTEIREVKQTYESQILVAQS---SMQKLSQEKESD  713

Query  210  EAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
             AA+ +E +    E  +L +          + +   +      +R   +  E+ +++ + 
Sbjct  714  SAAMSLEFERLEGESSELKEQLKRLRISLSQEEAQRRILEEEVKRLTALNTEESRKRHEL  773

Query  270  AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL  329
              +  V   +  +   +  E  +    T+     + +    +F+ ER+ +  L   K  L
Sbjct  774  ESQIQVMMSQKREGDNKMREVQESSSRTLQDKINEINRLTRNFEEERRLKRSLETDKRRL  833

Query  330  QEQLEQLQREYSKLKAS  346
            +  L  L+ +       
Sbjct  834  EGDLAVLKSKNETTNEE  850


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 66/361 (18%), Positives = 143/361 (40%), Gaps = 17/361 (5%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            ET+++ L+E ++   A  +  + + ER  EL   +    +E   +     E  K+ +   
Sbjct  623  ETMRKKLKELEQASWAKMELEKTVSERNRELERLRKELEDEARRIKEAQTELAKVRQEHS  682

Query  109  LEKLDLKR-QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
             E  ++K+  + Q L     +++  Q+   D A++  +   L GE  E + +L+      
Sbjct  683  TEIREVKQTYESQILVAQSSMQKLSQEKESDSAAMSLEFERLEGESSELKEQLKRLRISL  742

Query  168  QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
               E + R   E+ ++L     AL  + S +  +L  Q Q + +  R       E   K+
Sbjct  743  SQEEAQRRILEEEVKRL----TALNTEESRKRHELESQIQVMMSQKR-------EGDNKM  791

Query  228  AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             ++Q +  +  Q+  N I       E +R ++   L+   ++ E  L   +   +   EE
Sbjct  792  REVQESSSRTLQDKINEINRLTRNFEEERRLK-RSLETDKRRLEGDLAVLKSKNETTNEE  850

Query  288  AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
              Q +     + +++ + + +  +     Q   +L  + + LQE+L++L+ E  K +   
Sbjct  851  LVQLRSSHRELSLIRVELEAHALEKGRSEQTIARLQARIQELQEELKRLEGELEKQRQVA  910

Query  348  QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDM  407
            +E A     ++R  E        A    ++ +      +            KC+     +
Sbjct  911  EEEAG----KRRRTESQLEKSSQAMREYTTTITTLRTSQEETNIGAKHADEKCKQLQEAL  966

Query  408  D  408
            D
Sbjct  967  D  967


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 46/300 (15%), Positives = 120/300 (40%), Gaps = 11/300 (4%)

Query  64   AIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ--A  121
            A +++ + L+ R   +   +    + ++ +  +      L + L   + +L   +    +
Sbjct  501  ASQKNMEELKIRNTRIELLEEELEQLRDAIKDQTANNASLQDALLQYQQELNNSQSHLLS  560

Query  122  LREVEHLKRCQ-QQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ  180
            L EV+  +  +     E   S K ++  L  E++  + +LE   ++ + +E R     E+
Sbjct  561  LEEVKRTETMKCMATQESLDSSKDRLEELTEEVRRLKLQLEDMERKKKIVEERYTFLQEE  620

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE  240
              +   ++    +Q S    +L          L   R+   +E R++ + Q    ++ QE
Sbjct  621  HDETMRKKLKELEQASWAKMELEKTVSERNRELERLRKELEDEARRIKEAQTELAKVRQE  680

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            +   I+      E +  +    +++  Q+ E    A     ++L+ E+ + K  ++ + +
Sbjct  681  HSTEIREVKQTYESQILVAQSSMQKLSQEKESDSAAMSLEFERLEGESSELKEQLKRLRI  740

Query  301  LKAQADIYKADFQAE--------RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
              +Q +  +   + E         +   K  E +  +Q  + Q +   +K++   + S+R
Sbjct  741  SLSQEEAQRRILEEEVKRLTALNTEESRKRHELESQIQVMMSQKREGDNKMREVQESSSR  800


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 58/371 (16%), Positives = 128/371 (35%), Gaps = 20/371 (5%)

Query  30    ESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREE  89
             ES   K  +  L       E  +R LEE  +   A+       R   E  +    SQ+ E
Sbjct  727   ESSELKEQLKRLRISLSQEEAQRRILEEEVKRLTALNTEESRKRHELESQIQVMMSQKRE  786

Query  90    KEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSL  149
              +  M + QE+     +  +       +  +  R  E  +R ++ +  DK  ++  +  L
Sbjct  787   GDNKMREVQESSSRTLQDKI------NEINRLTRNFEEERRLKRSLETDKRRLEGDLAVL  840

Query  150   LGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV  209
               + + +   L       + L          A + +   E    +   ++ +L+ + + +
Sbjct  841   KSKNETTNEELVQLRSSHRELSLIRVELEAHALE-KGRSEQTIARLQARIQELQEELKRL  899

Query  210   EAALRMERQAASEE--KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
             E  L  +RQ A EE  KR+  + Q+              +++  S+ +  +  +   ++ 
Sbjct  900   EGELEKQRQVAEEEAGKRRRTESQLEKSSQAMREYTTTITTLRTSQEETNIGAKHADEKC  959

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK-  326
             +Q +EAL    +      +     K  + T+ +   Q      D     +A  +  E+K 
Sbjct  960   KQLQEALDRASKENKVTSQNLAALKAEINTLKLQLTQEQGRVQDSNQRYEALHRSMEEKS  1019

Query  327   ----------ELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLS  376
                       E LQ   E L ++  +++   +      +   ++ +     +      L 
Sbjct  1020  CALNVSSGETERLQRLTETLTKDRQRVEEELRAVRLEHEELLKNKKRGDREMTEQITALQ  1079

Query  377   SPLALPSQRRS  387
               L    +  +
Sbjct  1080  KQLDSSQRAGA  1090


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 49/308 (16%), Positives = 116/308 (38%), Gaps = 5/308 (2%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
                 L++  +  +E    I        E      H     ++ +E L    +E +   + 
Sbjct  920   TESQLEKSSQAMREYTTTITTLRTSQEETNIGAKHADEKCKQLQEALDRASKENKVTSQN  979

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL---GELQESQSRLEAA  163
             L   K ++   K Q  +E   ++   Q+      S++ +  +L    GE +  Q   E  
Sbjct  980   LAALKAEINTLKLQLTQEQGRVQDSNQRYEALHRSMEEKSCALNVSSGETERLQRLTETL  1039

Query  164   TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             TK+ Q +E   RA   +  +L   ++   ++ + Q+  L+ Q  S + A     +   + 
Sbjct  1040  TKDRQRVEEELRAVRLEHEELLKNKKRGDREMTEQITALQKQLDSSQRAGAEHDRLMRQL  1099

Query  224   KRKLAQLQVAYHQLFQE--YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
              R+  +LQV    + ++    + +  +          + +DL +++   E+ +V  + + 
Sbjct  1100  SREREKLQVEIENVQKQARETSSVIQTSQSQCSSLSQERDDLLKKITTMEQEIVRLKRLE  1159

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
             D+L       +  +     L+ + +  K DF   +       E+      +   L+ ++S
Sbjct  1160  DELARIKLSLESELRFKSQLQEENNKIKKDFTQWKTKCASHEEQLRQHASERSGLESQFS  1219

Query  342   KLKASCQE  349
              ++   + 
Sbjct  1220  SVRTELER  1227


 Score = 36.7 bits (83),  Expect = 0.56, Method: Composition-based stats.
 Identities = 38/230 (17%), Positives = 102/230 (44%), Gaps = 22/230 (10%)

Query  46    GAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             G  E LQR  E   + R  + +  + +R   EELL  +  +R ++E              
Sbjct  1027  GETERLQRLTETLTKDRQRVEEELRAVRLEHEELL--KNKKRGDRE--------------  1070

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
              +  +   L++Q + + R      R  +Q++ ++  ++ ++ ++  + +E+ S ++ +  
Sbjct  1071  -MTEQITALQKQLDSSQRAGAEHDRLMRQLSREREKLQVEIENVQKQARETSSVIQTSQS  1129

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS---VEAALRMERQAASE  222
             +C +L        ++   +E E   L+ +   ++ ++++  +S    ++ L+ E     +
Sbjct  1130  QCSSLSQERDDLLKKITTMEQEIVRLK-RLEDELARIKLSLESELRFKSQLQEENNKIKK  1188

Query  223   EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEE  272
             +  +      ++ +  +++    +S +         +LE L+ QL++AEE
Sbjct  1189  DFTQWKTKCASHEEQLRQH-ASERSGLESQFSSVRTELERLRTQLREAEE  1237


>sp|Q8BWY9|CIP2A_MOUSE Protein CIP2A OS=Mus musculus OX=10090 
GN=Cip2a PE=1 SV=3
Length=907

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 50/275 (18%), Positives = 107/275 (39%), Gaps = 23/275 (8%)

Query  65   IRQSNQILRE-RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALR  123
            ++ S    +E R ++LL  +A    + + L+ +++  R   E        + R+ E+   
Sbjct  630  MKLSTLASKESRLQDLLEAKALALAQADRLIAQYRCQRTQAETEARTLAGMLREVERKNE  689

Query  124  EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
            E+  L + QQ  +E   +    +     +L+   +  E  TK    L  R  A  ++   
Sbjct  690  ELSVLLKSQQLESERAQNDIEHLFQHSKKLESVAAEHEILTKSYMELVQRNEATEKKNTD  749

Query  184  LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
            L++  E+L +             Q  E  +    +   + K   +QL     +L   +  
Sbjct  750  LQTTCESLNKHIETMKKLNEALKQQNEKTIAQLIEKEEQRKEVQSQLADRECKLSNLHKI  809

Query  244  HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKA  303
                                 ++L   ++    KQE ID L++E  + + + + + +  +
Sbjct  810  AKSQE----------------EKLNVLQKEKEDKQETIDILRKELSRTEQIRKELSIKAS  853

Query  304  QADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
              +++KA  +       +L EK+ LL+ Q E+L +
Sbjct  854  SLEMHKAQLEG------RLEEKESLLKLQQEELNK  882


 Score = 34.8 bits (78),  Expect = 1.7, Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 64/132 (48%), Gaps = 7/132 (5%)

Query  45   QGAPETLQRCLEENQELRDAIRQSN------QILRERCEELLHFQASQREEKEFLMCKFQ  98
            Q   E+L + +E  ++L +A++Q N       I +E   + +  Q + RE K   + K  
Sbjct  751  QTTCESLNKHIETMKKLNEALKQQNEKTIAQLIEKEEQRKEVQSQLADRECKLSNLHKIA  810

Query  99   EARK-LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
            ++++  +  L  EK D +   +   +E+   ++ +++++   +S++     L G L+E +
Sbjct  811  KSQEEKLNVLQKEKEDKQETIDILRKELSRTEQIRKELSIKASSLEMHKAQLEGRLEEKE  870

Query  158  SRLEAATKECQA  169
            S L+   +E   
Sbjct  871  SLLKLQQEELNK  882


>sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus 
murinus OX=30608 GN=CTTNBP2 PE=3 SV=1
Length=1647

 Score = 54.5 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/201 (20%), Positives = 86/201 (43%), Gaps = 25/201 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K+  
Sbjct  112  EAVMAHCRKMQERMATQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKQVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E+ ++LE   K+   LE    A  
Sbjct  172  ------LMLVKECKQ--------LSGKVIEEAQKLEEAMAKLEEEKKKTNELEEELSAEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLNREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQ  259
            +  D+    S+    + R + 
Sbjct  271  RGSDSKPSLSLPRKTKDRRLV  291


 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 108/276 (39%), Gaps = 37/276 (13%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            RK  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   RKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALEGRARAASEQARQLESE---REALQQQHSVQVDQLRMQG  206
              +  E+ +  +     C        A     R+++     + A  +    +++  ++Q 
Sbjct  88   QRDY-EAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMATQLAAAESRQKKLEMEKLQL  146

Query  207  QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
            Q++E   +       EE+ K  Q+ +                V   ++  G  +E+  Q+
Sbjct  147  QALEQEHKKLAARLEEERGKNKQVVLML--------------VKECKQLSGKVIEE-AQK  191

Query  267  LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEK  325
            L++A   L  +++  ++L+EE    K     +    AQ +   ++F  ER Q R KL  +
Sbjct  192  LEEAMAKLEEEKKKTNELEEELSAEKRRSTEME---AQMEKQLSEFDTEREQLRAKLNRE  248

Query  326  KEL---LQEQLEQLQREYSKLKASCQESARIEDMRK  358
            +     L+E+++++++   +LK        +   RK
Sbjct  249  EAHTTDLKEEIDKMKKMIEQLKRGSDSKPSLSLPRK  284


 Score = 40.6 bits (93),  Expect = 0.027, Method: Composition-based stats.
 Identities = 28/160 (18%), Positives = 76/160 (48%), Gaps = 10/160 (6%)

Query  41   LPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
            + ++  A E+ Q+ LE  +    A+ Q ++ L  R EE       + + K+ ++   +E 
Sbjct  125  MATQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEE------ERGKNKQVVLMLVKEC  178

Query  101  RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
            ++L  ++  E     ++ E+A+ ++E  K+   ++ E+ ++ K + T +  ++++  S  
Sbjct  179  KQLSGKVIEEA----QKLEEAMAKLEEEKKKTNELEEELSAEKRRSTEMEAQMEKQLSEF  234

Query  161  EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVD  200
            +   ++ +A   R  A +   ++   + + + +Q     D
Sbjct  235  DTEREQLRAKLNREEAHTTDLKEEIDKMKKMIEQLKRGSD  274


>sp|Q6ZQQ6|WDR87_HUMAN WD repeat-containing protein 87 OS=Homo 
sapiens OX=9606 GN=WDR87 PE=1 SV=3
Length=2873

 Score = 54.5 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 41/232 (18%), Positives = 103/232 (44%), Gaps = 10/232 (4%)

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
               Q+E+   E   L + ++ + ++K  +      +  E +    + E   ++   L  + 
Sbjct  1757  AWQREKLSEEETKLAQEEELLIQEKEKLAQHKEKMPEEEERLGRKREQLIEKKMKLAQKR  1816

Query  175   RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME-----RQAASEEKRKLAQ  229
                     +L   +  L Q+ ++  ++  +  +  + A R E     ++  +  K++L Q
Sbjct  1817  ERWINSMEELTKNKMILYQKKNLAQEKKNLAQEKEKLAQRKENLLYNKERLTHSKKQLVQ  1876

Query  230   LQVA---YHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             ++     ++++  + +  +      +  K+  +L + +++L Q E++L  KQE + + K 
Sbjct  1877  VKNKLGMFNKILAQVEEKLTQE-KETVIKKKEKLAETEKKLVQVEDSLAKKQEKLAQEKM  1935

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
             +    K +++    L+ + DI K + +A     ++LAE+K  L E  E L +
Sbjct  1936  KLALEKAMVQGKKRLRGELDIAKEE-KALNLEMKRLAEEKMRLVEGKETLSK  1986


 Score = 46.0 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 62/350 (18%), Positives = 143/350 (41%), Gaps = 27/350 (8%)

Query  22    ADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDA---IRQSNQILRERCEE  78
              ++ +  EE  L +        E+   +   +  ++++E+  A     Q  + L +R E+
Sbjct  1591  EERKLAQEEEKLAQEERQLAQEERKLAQAYVKITQDDREMAQAEGKFAQKEETLAQRGEK  1650

Query  79    LLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAED  138
             L        ++++ L  K+++  +  E+L  +   L   K    ++VE L + +Q +   
Sbjct  1651  LSQEAEKLAQKRKKLAKKWEKVAREEEKLAKKGGKLAEVKNILAQKVEELPQREQNLDWQ  1710

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALE---------------GRARAASEQARQ  183
             +  +  ++  L  +++E   + E   +E   L                 R + + E+ + 
Sbjct  1711  EKELAQELEELEWDMEELSWKEEELNQEEGKLVEEKKKLAEEEEALAWQREKLSEEETKL  1770

Query  184   LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD-  242
              + E   +Q++  +   + +M  +      + E+    E+K KLAQ +  +    +E   
Sbjct  1771  AQEEELLIQEKEKLAQHKEKMPEEEERLGRKREQ--LIEKKMKLAQKRERWINSMEELTK  1828

Query  243   NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLK  302
             N +      +  +    L   K++L Q +E L+  +E +   K++  Q K  +     + 
Sbjct  1829  NKMILYQKKNLAQEKKNLAQEKEKLAQRKENLLYNKERLTHSKKQLVQVKNKLGMFNKIL  1888

Query  303   AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
             AQ +      +   Q +E + +KKE L E  ++L +    L    ++ A+
Sbjct  1889  AQVE------EKLTQEKETVIKKKEKLAETEKKLVQVEDSLAKKQEKLAQ  1932


 Score = 39.4 bits (90),  Expect = 0.070, Method: Composition-based stats.
 Identities = 53/319 (17%), Positives = 128/319 (40%), Gaps = 21/319 (7%)

Query  50    TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL  109
             T Q+  ++ ++     R+  +I RE  +E         E         ++  KLV    +
Sbjct  1395  TFQKSPKQGRKAVQKERKVGKIKREMTKEERDMSEEVEEMATLEEKVVKQEGKLVM---I  1451

Query  110   EKLDLKRQKEQALREVEHLK-RCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             E+    +  ++A  E + +    ++     K   + ++     +L ++  +L    +  Q
Sbjct  1452  ERTPSWQDWKKAWDEWKQVHGETRKSWKAWKEEWEKRLLQEEEKLHQAGEKLSPEEEMLQ  1511

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
               +       +Q  +     ++ +QQ+  + +    +  S E   + E+Q   E++    
Sbjct  1512  EDKKLKWEEWKQVWENMLSSKSKEQQYKDEEEVTLEEEVSREGEEK-EQQVTEEQRH---  1567

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
                   H+  + +    ++    ++ +R +  E+  ++L Q E  L  ++  + +   + 
Sbjct  1568  --IQEEHKWARIHRKRARAEKKRAQEERKLAQEE--EKLAQEERQLAQEERKLAQAYVKI  1623

Query  289   EQHKIVMETVPVLKAQADIYKADFQAERQAR-----EKLAEKKELLQEQLEQLQREYSKL  343
              Q    M       AQ +    +  A+R  +     EKLA+K++ L ++ E++ RE  KL
Sbjct  1624  TQDDREMAQAEGKFAQKE----ETLAQRGEKLSQEAEKLAQKRKKLAKKWEKVAREEEKL  1679

Query  344   KASCQESARIEDMRKRHVE  362
                  + A ++++  + VE
Sbjct  1680  AKKGGKLAEVKNILAQKVE  1698


>sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus OX=10090 GN=Myh3 
PE=2 SV=2
Length=1940

 Score = 54.5 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/271 (16%), Positives = 127/271 (47%), Gaps = 11/271 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E L   ++E  +L+  ++  ++ L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  875   EEKLVTLVQEKNDLQLQVQAESENLLDAEERCDQLIKAKFQLEAKIKEVTERAEDEEEIN  934

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  EL      +   T
Sbjct  935   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEELAGLDETIAKLT  994

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             +E +AL+   +   +  +  E +  +L +  S    +L  Q   +E++L  E++   + +
Sbjct  995   REKKALQEAHQQTLDDLQAEEDKVNSLSKLKS----KLEQQVDDLESSLEQEKKLRVDLE  1050

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +   L+ +++  +   +  Q+ I
Sbjct  1051  RNKRKLEGDL-KLAQESILDLENDKQQLDERLKKKDFEYSQLQSKVEDEQTLSLQLQKKI  1109

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              +L+   E+ +  +E     +A+ +  ++D+
Sbjct  1110  KELQARIEELEEEIEAERATRAKTEKQRSDY  1140


 Score = 46.4 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 58/355 (16%), Positives = 132/355 (37%), Gaps = 15/355 (4%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQE  99
              L   +G  E +QR L E    +  ++     L  + EE     +     K+    + +E
Sbjct  1256  QLSEARGKNEEMQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQIEE  1315

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
              ++ +E     K  L    + +  + + L+   ++  E KA ++  ++    E+ + +++
Sbjct  1316  LKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTK  1375

Query  160   -----------LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
                        LE A K+       +    E      +  E  +Q+   +V+ L +  + 
Sbjct  1376  YETDAIQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVER  1435

Query  209   VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQ  266
               +      +      + LA+ +    +   E +  +K S   S     ++   E+   Q
Sbjct  1436  ANSLAAALDKKQRNFDKVLAEWKTKCEESQAELEAALKESRSLSTELFKLKNAYEEALDQ  1495

Query  267   LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
             L+  +      ++ I  L E+  ++   +  +   + Q ++ KAD Q   +  E   E +
Sbjct  1496  LETVKRENKNLEQEIADLTEQIAENGKSIHELEKSRKQMELEKADIQMALEEAEAALEHE  1555

Query  327   EL--LQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
             E   L+ QLE  Q +    +   ++   IE +++ +    +       A + S  
Sbjct  1556  EAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQGALDAEVRSRN  1610


 Score = 36.4 bits (82),  Expect = 0.68, Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 104/249 (42%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  V
Sbjct  1683  QAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLTQLQSEV  1742

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    +  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1743  EDACRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAE  1802

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E  Q++++  V  LR      E  ++     + E+
Sbjct  1803  QLALKGGKKQIQKLETRIRELEFELEGEQKRNTESVKGLR----KYERRVKELTYQSEED  1858

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     ++ +    L   ++   +L++AEE     +  
Sbjct  1859  RKNVLRLQDLVDKL-QVKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQ  1917

Query  281   IDKLKEEAE  289
             ++KL+ +  
Sbjct  1918  VNKLRAKTR  1926


 Score = 36.0 bits (81),  Expect = 0.83, Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 131/352 (37%), Gaps = 41/352 (12%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             ++G  E  +   + N E+     +      +R EEL   +    +  +    + +     
Sbjct  1352  QEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDSEEQVEAVNAK  1411

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
                L   K  L+ + E  + +VE        + + + +    +     + +ESQ+ LEAA
Sbjct  1412  CASLEKTKQRLQGEVEDLMVDVERANSLAAALDKKQRNFDKVLAEWKTKCEESQAELEAA  1471

Query  164   TKECQALEGRARAAS-------EQARQLESEREALQQ-------------QHSVQVDQLR  203
              KE ++L               +Q   ++ E + L+Q             +   ++++ R
Sbjct  1472  LKESRSLSTELFKLKNAYEEALDQLETVKRENKNLEQEIADLTEQIAENGKSIHELEKSR  1531

Query  204   MQGQSVEAALRM-----------ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
              Q +  +A ++M           E       + +L Q++    +   E D  I+      
Sbjct  1532  KQMELEKADIQMALEEAEAALEHEEAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNY  1591

Query  253   ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ----HKIVMETVPVLKA-QADI  307
             +R        L  +++   EA+  K+++   L E   Q    ++   ET+  L++ Q  +
Sbjct  1592  QRTVETMQGALDAEVRSRNEAIRLKKKMEGDLNEIEIQLSHANRQAAETIKHLRSVQGQL  1651

Query  308   YKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
                    +   R +     E L+EQL  ++R  + L+A  +E     +  +R
Sbjct  1652  KDTQLHLDDALRGQ-----EDLKEQLAIVERRANLLQAEVEELRATLEQTER  1698


>sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus OX=10116 GN=Myh3 
PE=3 SV=1
Length=1940

 Score = 54.5 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/271 (16%), Positives = 127/271 (47%), Gaps = 11/271 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E L   ++E  +L+  ++  ++ L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  875   EEKLVTLVQEKNDLQLQVQAESENLLDAEERCDQLIKAKFQLEAKIKEVTERAEDEEEIN  934

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  EL      +   T
Sbjct  935   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEELAGLDETIAKLT  994

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             +E +AL+   +   +  +  E +  +L +  S    +L  Q   +E++L  E++   + +
Sbjct  995   REKKALQEAHQQTLDDLQAEEDKVNSLSKLKS----KLEQQVDDLESSLEQEKKLRVDLE  1050

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +   L+ +++  +   +  Q+ I
Sbjct  1051  RNKRKLEGDL-KLAQESILDLENDKQQLDERLKKKDFEYSQLQSKVEDEQTLSLQLQKKI  1109

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              +L+   E+ +  +E     +A+ +  ++D+
Sbjct  1110  KELQARIEELEEEIEAERATRAKTEKQRSDY  1140


 Score = 45.6 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 58/355 (16%), Positives = 131/355 (37%), Gaps = 15/355 (4%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQE  99
              L   +G  E  QR L E    +  ++     L  + EE     +     K+    + +E
Sbjct  1256  QLSEARGKNEETQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQIEE  1315

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
              ++ +E     K  L    + +  + + L+   ++  E KA ++  ++    E+ + +++
Sbjct  1316  LKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTK  1375

Query  160   -----------LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
                        LE A K+       +    E      +  E  +Q+   +V+ L +  + 
Sbjct  1376  YETDAIQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVER  1435

Query  209   VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQ  266
               +      +      + LA+ +    +   E +  +K S   S     ++   E+   Q
Sbjct  1436  ANSLAAALDKKQRNFDKVLAEWKTKCEESQAELEAALKESRSLSTELFKLKNAYEEALDQ  1495

Query  267   LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
             L+  +      ++ I  L E+  ++   +  +   + Q ++ KAD Q   +  E   E +
Sbjct  1496  LETVKRENKNLEQEIADLTEQIAENGKSIHELEKSRKQMELEKADIQMALEEAEAALEHE  1555

Query  327   EL--LQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
             E   L+ QLE  Q +    +   ++   IE +++ +    +       A + S  
Sbjct  1556  EAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQGALDAEVRSRN  1610


 Score = 38.3 bits (87),  Expect = 0.18, Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 105/249 (42%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  V
Sbjct  1683  QAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLTQLQSEV  1742

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    +  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1743  EDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAE  1802

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E  Q++++  V  LR      E  ++     + E+
Sbjct  1803  QLALKGGKKQIQKLETRIRELEFELEGEQKRNTESVKGLR----KYERRVKELTYQSEED  1858

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     ++ +  + L   ++   +L++AEE     +  
Sbjct  1859  RKNVLRLQDLVDKL-QVKVKSYKRQAEEADEQANVHLTKFRKAQHELEEAEERADIAESQ  1917

Query  281   IDKLKEEAE  289
             ++KL+ +  
Sbjct  1918  VNKLRAKTR  1926


 Score = 36.0 bits (81),  Expect = 0.86, Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 131/352 (37%), Gaps = 41/352 (12%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             ++G  E  +   + N E+     +      +R EEL   +    +  +    + +     
Sbjct  1352  QEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDSEEQVEAVNAK  1411

Query  104   VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
                L   K  L+ + E  + +VE        + + + +    +     + +ESQ+ LEAA
Sbjct  1412  CASLEKTKQRLQGEVEDLMVDVERANSLAAALDKKQRNFDKVLAEWKTKCEESQAELEAA  1471

Query  164   TKECQALEGRARAAS-------EQARQLESEREALQQ-------------QHSVQVDQLR  203
              KE ++L               +Q   ++ E + L+Q             +   ++++ R
Sbjct  1472  LKESRSLSTELFKLKNAYEEALDQLETVKRENKNLEQEIADLTEQIAENGKSIHELEKSR  1531

Query  204   MQGQSVEAALRM-----------ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
              Q +  +A ++M           E       + +L Q++    +   E D  I+      
Sbjct  1532  KQMELEKADIQMALEEAEAALEHEEAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNY  1591

Query  253   ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ----HKIVMETVPVLKA-QADI  307
             +R        L  +++   EA+  K+++   L E   Q    ++   ET+  L++ Q  +
Sbjct  1592  QRTVETMQGALDAEVRSRNEAIRLKKKMEGDLNEIEIQLSHANRQAAETIKHLRSVQGQL  1651

Query  308   YKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKR  359
                    +   R +     E L+EQL  ++R  + L+A  +E     +  +R
Sbjct  1652  KDTQLHLDDALRGQ-----EDLKEQLAIVERRANLLQAEVEELRATLEQTER  1698


>sp|Q9D180|CFA57_MOUSE Cilia- and flagella-associated protein 
57 OS=Mus musculus OX=10090 GN=Cfap57 PE=1 SV=3
Length=1249

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 58/316 (18%), Positives = 127/316 (40%), Gaps = 25/316 (8%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKE--------FLMCKFQEA  100
             + ++    +NQ L+    + +   RER EEL+  Q  + ++ E            K+QE 
Sbjct  738   QEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLECCNNQKLLLEYEKYQEL  797

Query  101   RKLVERLGLE----KLDLKRQKEQALREVEHLKRCQ-QQMAEDKASVKAQVTSLLGELQE  155
             +   +R+  E      D    K QAL E+      + Q+        +  V   L E +E
Sbjct  798   QLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEE  857

Query  156   SQSRLEAATKE-----CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
             ++ ++E              E + R   E   +L+ E   ++++ S    ++  +   +E
Sbjct  858   TKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIE  917

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE--RKRGMQLED----LK  264
               L+ E+       R L +      +  QE D  I+         +K+  +LE     L 
Sbjct  918   L-LKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLD  976

Query  265   QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAE  324
              ++++ ++ +  ++  I  +KE+ ++ +  +E       Q ++   +   + +A ++   
Sbjct  977   YKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELNITELLQKLRATDQEMR  1036

Query  325   KKELLQEQLEQLQREY  340
             K++  +  LE L R +
Sbjct  1037  KEQQKERDLEALVRRF  1052


 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 57/339 (17%), Positives = 120/339 (35%), Gaps = 30/339 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E + +   E Q+L     Q   +  E+ +EL       +EE E      ++ R   E  
Sbjct  766   EELVDKQTRELQDLECCNNQKLLLEYEKYQELQLKSQRMQEEYE------KQLRDNDETK  819

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
                  +L    E  L+E   L    ++  ED      +      +++E + R        
Sbjct  820   SQALEELTEFYEAKLQEKTGL---LEEAQEDVRQQLREFEETKKQIEEDEDR--EIQDIK  874

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
                E + R   E   +L+ E   ++++ S    ++  +   +E  L+ E+       R L
Sbjct  875   TKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIEL-LKSEQMKLQGIIRSL  933

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
              +      +  QE D  I+             + DLK++ Q+ E+        I +LK++
Sbjct  934   EKDIQGLKREIQERDETIQDKEKR--------IYDLKKKNQELEKFKFVLDYKIKELKKQ  985

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASC  347
              E  +  ++ +     + +             E+  ++   L+  + +L ++        
Sbjct  986   IEPRENEIKVMKEQIQEME----------AELERFHKQNTQLELNITELLQKLRATDQEM  1035

Query  348   QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRR  386
             ++  + E   +  V   +  L    AY+  P  L  + R
Sbjct  1036  RKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIR  1074


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 43/298 (14%), Positives = 113/298 (38%), Gaps = 29/298 (10%)

Query  101  RKLVERLGLEKLDLKRQKEQALR-EVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
            R+       E L  K   E+  +  +E   R ++   E++  ++ +  +   +++E   +
Sbjct  676  REREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRLKDMNYTEKIKELTDK  735

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
                 +E ++L+ + +       + E +  + +++    VD+   + Q +E       Q 
Sbjct  736  F---IQEMESLKTKNQVLK---TEKEKQDISHRERLEELVDKQTRELQDLECCNN---QK  786

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIK----SSVVGSERKRGMQLEDLKQQLQQAEEALV  275
               E  K  +LQ+   ++ +EY+  ++    +     E         L+++    EEA  
Sbjct  787  LLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQE  846

Query  276  AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
              ++ + + +E  +Q +   +         +I     + ER+ R++  E    L+ +   
Sbjct  847  DVRQQLREFEETKKQIEEDEDR--------EIQDIKTKYERKLRDE-KESNLRLKGETGI  897

Query  336  LQREYSKLKASCQESA------RIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
            +++++S L+   +E        + E M+ + +  S                   Q + 
Sbjct  898  MRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKE  955


>sp|Q8CGU1|CACO1_MOUSE Calcium-binding and coiled-coil domain-containing 
protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 
SV=2
Length=691

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 70/331 (21%), Positives = 139/331 (42%), Gaps = 41/331 (12%)

Query  59   QELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMC-------KFQEARKLVERLG  108
            QEL  A+   RQ +  L E+ + L        EE++ L         +  E    ++ + 
Sbjct  182  QELEAALATARQEHSELTEQYKGLSRSHGELSEERDILSQQQGDHVARILELEDDIQTMS  241

Query  109  LEKL--------------DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
             + L               L R++E+ LR+++  +  ++Q   +  +V+ +   L  EL+
Sbjct  242  DKVLMKEVELDRVRDTVKALTREQEKLLRQLKEFQADKEQSEAELQTVREENCCLNTELE  301

Query  155  ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
            E++SR E    + Q L+ +     +   Q         QQ   +++ L+ Q + V+    
Sbjct  302  EAKSRQEEQGAQVQRLKDKLAHMKDTLGQ--------AQQKVAELEPLKEQLRGVQELAA  353

Query  215  MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA-  273
              +Q A+    +LA    A  +   E           + R   + L   +++ Q ++E  
Sbjct  354  SSQQKAALLGEELASAAGARDRTIAELHRSRLEVAEVNGRLAELSLHMKEEKCQWSKERT  413

Query  274  --LVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKKELLQ  330
              L + +   DK+ + + +   + +TV   + Q+ ++K +   E+  +  +L+E K  L 
Sbjct  414  GLLQSMEAEKDKILKLSAEILRLEKTVQEERTQSHVFKTELAREKDSSLVQLSESKRELT  473

Query  331  E---QLEQLQREYSKLKASCQESARIEDMRK  358
            E    L  LQ+E  +L+   QE   +E MRK
Sbjct  474  ELRSALRVLQKEKEQLQTEKQE--LLEYMRK  502


 Score = 37.9 bits (86),  Expect = 0.20, Method: Composition-based stats.
 Identities = 37/221 (17%), Positives = 87/221 (39%), Gaps = 12/221 (5%)

Query  79   LLHFQASQREEKEFLMC-------KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
            L +     ++E+  LM        +  E R  V+ L       +++  +   + + L R 
Sbjct  149  LQNQLDESQQERNDLMQLKLQLEDQVTELRSRVQELEAALATARQEHSELTEQYKGLSRS  208

Query  132  QQQMAEDKASVKAQV---TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESER  188
              +++E++  +  Q     + + EL++    +       +    R R   +   + + + 
Sbjct  209  HGELSEERDILSQQQGDHVARILELEDDIQTMSDKVLMKEVELDRVRDTVKALTREQEKL  268

Query  189  EALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSS  248
                ++     +Q   + Q+V            E K +  + Q A  Q  ++   H+K +
Sbjct  269  LRQLKEFQADKEQSEAELQTVREENCCLNTELEEAKSRQEE-QGAQVQRLKDKLAHMKDT  327

Query  249  VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
            +  ++ ++  +LE LK+QL+  +E   + Q+    L EE  
Sbjct  328  LGQAQ-QKVAELEPLKEQLRGVQELAASSQQKAALLGEELA  367


 Score = 37.9 bits (86),  Expect = 0.21, Method: Composition-based stats.
 Identities = 39/235 (17%), Positives = 99/235 (42%), Gaps = 13/235 (6%)

Query  126  EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
            E +   +     D   V  + T L  +L ESQ       +    LE +      + ++LE
Sbjct  126  ELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEDQVTELRSRVQELE  185

Query  186  SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI  245
            +     +Q+HS   +Q +   +S            SEE+  L+Q Q  +     E ++ I
Sbjct  186  AALATARQEHSELTEQYKGLSRSH--------GELSEERDILSQQQGDHVARILELEDDI  237

Query  246  KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVP----VL  301
            ++ +      + ++L+ ++  ++            + + + + EQ +  ++TV      L
Sbjct  238  QT-MSDKVLMKEVELDRVRDTVKALTREQEKLLRQLKEFQADKEQSEAELQTVREENCCL  296

Query  302  KAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDM  356
              + +  K+  + +    ++L +K   +++ L Q Q++ ++L+   ++   ++++
Sbjct  297  NTELEEAKSRQEEQGAQVQRLKDKLAHMKDTLGQAQQKVAELEPLKEQLRGVQEL  351


 Score = 36.0 bits (81),  Expect = 0.65, Method: Composition-based stats.
 Identities = 46/257 (18%), Positives = 97/257 (38%), Gaps = 17/257 (7%)

Query  48   PETLQRCLEENQELRD-------AIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
             E L R L+E Q  ++        +R+ N  L    EE    Q  Q  + + L  K    
Sbjct  265  QEKLLRQLKEFQADKEQSEAELQTVREENCCLNTELEEAKSRQEEQGAQVQRLKDKLAHM  324

Query  101  RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ-SR  159
            +  + +   +  +L+  KEQ     E     QQ+ A     + +   +    + E   SR
Sbjct  325  KDTLGQAQQKVAELEPLKEQLRGVQELAASSQQKAALLGEELASAAGARDRTIAELHRSR  384

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
            LE A    +  E       E+ +  +     LQ   + +   L++  + +     ++ + 
Sbjct  385  LEVAEVNGRLAELSLHMKEEKCQWSKERTGLLQSMEAEKDKILKLSAEILRLEKTVQEER  444

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
                        V   +L +E D+ +   +  S+R+       L+   ++ E+    KQE
Sbjct  445  TQS--------HVFKTELAREKDSSLVQ-LSESKRELTELRSALRVLQKEKEQLQTEKQE  495

Query  280  VIDKLKEEAEQHKIVME  296
            +++ +++   + + V +
Sbjct  496  LLEYMRKLEARLEKVAD  512


>sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 
GN=Itsn2 PE=1 SV=2
Length=1659

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 59/330 (18%), Positives = 143/330 (43%), Gaps = 25/330 (8%)

Query  43   SEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
            +E+ A +  +    + +EL++   +    L +R E+    +  + EE+   + + + A++
Sbjct  394  AERKAQKEKEEWERKQRELQEQEWKKQLELEKRLEKQRELERQREEERRKEIERREAAKQ  453

Query  103  LVER------LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQES  156
             +ER        L + +L  QK +   ++  L   ++ +  +  +V  +   + G LQ+ 
Sbjct  454  ELERQRRLEWERLRRQELLSQKTREQEDIVRLSSRKKSLHLELEAVNGKHQQISGRLQDV  513

Query  157  QSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE------  210
            Q R +    E + L+ +      + +QL+ E +  Q +    V + ++  + ++      
Sbjct  514  QIRKQTQKTELEVLDKQCDLEIMEIKQLQQELKEYQNKLIYLVPEKQLLNERIKNMQLSN  573

Query  211  ---AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
               + + +  + +SE++    +L+     L  E +   K S + S      QL++L++  
Sbjct  574  TPDSGISLLHKKSSEKEELCQRLKEQLDAL--EKETASKLSEMDSFNN---QLKELRESY  628

Query  268  QQAEEAL-VAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD-IYKADFQAERQAREKLAEK  325
               + AL    +   DKLKE   +    +E +   K + +   KA    E   RE + ++
Sbjct  629  NTQQLALEQLHKIKRDKLKEIERKR---LEQIQKKKLEDEAARKAKQGKENLWRESIRKE  685

Query  326  KELLQEQLEQLQREYSKLKASCQESARIED  355
            +E  Q++L++ + +    +   +  A+  +
Sbjct  686  EEEKQKRLQEEKSQDKTQEEERKAEAKQSE  715


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 39/199 (20%), Positives = 74/199 (37%), Gaps = 23/199 (12%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELL---------HFQASQREEKEFLMCKFQEAR  101
            LQ+ L+E Q     +    Q+L ER + +               +  EKE L  + +E  
Sbjct  541  LQQELKEYQNKLIYLVPEKQLLNERIKNMQLSNTPDSGISLLHKKSSEKEELCQRLKEQL  600

Query  102  KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK-AQVTSLL-GELQESQSR  159
              +E+    KL         L+E+      QQ   E    +K  ++  +    L++ Q +
Sbjct  601  DALEKETASKLSEMDSFNNQLKELRESYNTQQLALEQLHKIKRDKLKEIERKRLEQIQKK  660

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
                    +A +G+     E  R+ E E++             R+Q +  +   + E + 
Sbjct  661  KLEDEAARKAKQGKENLWRESIRKEEEEKQK------------RLQEEKSQDKTQEEERK  708

Query  220  ASEEKRKLAQLQVAYHQLF  238
            A  ++ + A   V Y  L+
Sbjct  709  AEAKQSETASALVNYRALY  727


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 59/348 (17%), Positives = 123/348 (35%), Gaps = 53/348 (15%)

Query  86   QREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE----VEHLKRCQQQMAED---  138
            ++  +  +  + +EA +  ++   E    ++Q+E   +E    +E  KR ++Q   +   
Sbjct  380  EKRRQVLMEQQQREAERKAQKEKEEWE--RKQRELQEQEWKKQLELEKRLEKQRELERQR  437

Query  139  --------------KASVKAQ------------VTSLLGELQESQSRLEAATKECQ-ALE  171
                          K  ++ Q            + S     QE   RL +  K     LE
Sbjct  438  EEERRKEIERREAAKQELERQRRLEWERLRRQELLSQKTREQEDIVRLSSRKKSLHLELE  497

Query  172  GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                   + + +L+  +   +Q    +++ L  Q       ++  +Q   E + KL  L 
Sbjct  498  AVNGKHQQISGRLQDVQIR-KQTQKTELEVLDKQCDLEIMEIKQLQQELKEYQNKLIYL-  555

Query  232  VAYHQLFQEYDNHIKSS---------VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
            V   QL  E   +++ S         +     ++    + LK+QL   E+   +K   +D
Sbjct  556  VPEKQLLNERIKNMQLSNTPDSGISLLHKKSSEKEELCQRLKEQLDALEKETASKLSEMD  615

Query  283  KLKEEAEQHKIVMETVPVLKAQADIYKAD--FQAERQAREKLAEKKELLQEQLEQLQREY  340
                + ++ +    T  +   Q    K D   + ER+  E++ +KK     + E  ++  
Sbjct  616  SFNNQLKELRESYNTQQLALEQLHKIKRDKLKEIERKRLEQIQKKK----LEDEAARKAK  671

Query  341  SKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSP  388
               +   +ES R E+  K+     +              A  S+  S 
Sbjct  672  QGKENLWRESIRKEEEEKQKRLQEEKSQDKTQEEERKAEAKQSETASA  719


>sp|Q076A6|MYH1_CANLF Myosin-1 OS=Canis lupus familiaris OX=9615 
GN=MYH1 PE=3 SV=2
Length=1939

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 54/326 (17%), Positives = 144/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  878   EEKMVALMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKI----KLEQQVDDLEGSLEQEKKIRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAT  1195


 Score = 51.8 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 62/332 (19%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +     L F     E K  L  + +    L   L   + 
Sbjct  1283  RLQTESGEYSRQLDEKDSLVSQLSRGKLAFTQQIEELKRQLEEEIKAKSALAHALQSARH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEGKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1403  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1463  KYEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K + QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1523  GGKRIHELEKIKKQVEQEKTELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1582

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1583  KDEEIDQLKRNHIRVVESMQSTLDAEIRSRND  1614


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 68/390 (17%), Positives = 148/390 (38%), Gaps = 48/390 (12%)

Query  46    GAPETLQRCLEENQELRDAIRQSNQILR--------------------ERCEELLHFQAS  85
             G  ET+ +  +E + L++A +Q+   L+                    +  E  L  +  
Sbjct  988   GLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKK  1047

Query  86    QREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ  145
              R + E    K +   KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q
Sbjct  1048  IRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQ  1107

Query  146   VTSLLGELQESQSRLEAATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRM  204
             +   + ELQ     LE   +  +A   +A        R+LE   E L++       Q+ M
Sbjct  1108  LQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM  1167

Query  205   QGQSVEAALRMER---QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERK  255
               +      +M R   +A  + +   A L+  +     E    I      K  +   + +
Sbjct  1168  NKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSE  1227

Query  256   RGMQLEDLKQQLQQAEEALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIY  308
               M+++DL   ++   +A    ++        + +LK + E+ + ++  +   +A+    
Sbjct  1228  MKMEIDDLASNMETVSKAKGNLEKMCRTLEDQVSELKTKEEEQQRLINDLTAQRARLQTE  1287

Query  309   KADFQAERQAREKLA-----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
               ++  +   ++ L            ++ E L+ QLE+  +  S L  + Q +    D+ 
Sbjct  1288  SGEYSRQLDEKDSLVSQLSRGKLAFTQQIEELKRQLEEEIKAKSALAHALQSARHDCDLL  1347

Query  358   KRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +   E  Q         +S   +  +Q R+
Sbjct  1348  REQYEEEQEGKAELQRAMSKANSEVAQWRT  1377


 Score = 42.5 bits (98),  Expect = 0.008, Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 106/250 (42%), Gaps = 9/250 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  +
Sbjct  1686  QAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEM  1745

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E +  E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1746  EDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAE  1805

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E+ Q+ +   V  LR      E  ++       E+
Sbjct  1806  QLALKGGKKQIQKLEARVRELEGEVESEQKHNIETVKSLR----KHERRVKELTYQTEED  1861

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL---EDLKQQLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     +E +  + L     L+ +L++AEE     +  
Sbjct  1862  RKNVLRLQDLVDKL-QAKVKAYKRQAEEAEEQSNVNLSKFRKLQHELEEAEERADIAESQ  1920

Query  281   IDKLKEEAEQ  290
             ++KL+ ++ +
Sbjct  1921  VNKLRVKSRE  1930


 Score = 37.5 bits (85),  Expect = 0.29, Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 109/278 (39%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  L    +EA   +E   
Sbjct  1500  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKTELQAALEEAEASLEHEE  1559

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQ-QQMAEDKASVKAQV----------  146
                      L   K ++ R+  +   E++ LKR   + +   ++++ A++          
Sbjct  1560  GKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRVVESMQSTLDAEIRSRNDAIRLK  1619

Query  147   TSLLGELQESQSRLE-------AATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               + G+L E + +L         A +  +  +G  +            +E L++Q ++  
Sbjct  1620  KKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQEDLKEQLAMVE  1679

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1680  RRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1738

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1739  SQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKE  1776


>sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus OX=9986 
GN=MYH4 PE=1 SV=2
Length=1938

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 54/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  877   EEKMVALMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  997   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKIRMDLE  1052

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1053  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1111

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1112  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1168

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1169  KREAEFQKMRRDLEEATLQHEATAAT  1194


 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 61/332 (18%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1282  RLQTESGEFSRQLDEKDSLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSARH  1341

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1342  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1401

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1402  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKH  1461

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1462  KYEETHAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1521

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1522  GGKRIHELEKVKKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1581

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1582  KDEEIDQLKRNHIRVVESMQSTLDAEIRSRND  1613


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 67/374 (18%), Positives = 146/374 (39%), Gaps = 34/374 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1003  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDL  1062

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1063  KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKIKELQARIEELE  1122

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMER---  217
                +  +A   +A        R+LE   E L++       Q+ M  +      +M R   
Sbjct  1123  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLE  1182

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERKRGMQLEDLKQQLQQAE  271
             +A  + +   A L+  +     E    I      K  +   + +  M+++DL   ++   
Sbjct  1183  EATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVS  1242

Query  272   EALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA-  323
             +A    ++        + +LK + E+H+ ++  +   +A+      +F  +   ++ L  
Sbjct  1243  KAKGNLEKMCRTLEDQVSELKTKEEEHQRLINDLSAQRARLQTESGEFSRQLDEKDSLVS  1302

Query  324   ----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
                       ++ E L+ QLE+  +  S L  + Q +    D+ +   E  Q        
Sbjct  1303  QLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSARHDCDLLREQYEEEQEAKAELQR  1362

Query  374   YLSSPLALPSQRRS  387
              +S   +  +Q R+
Sbjct  1363  AMSKANSEVAQWRT  1376


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 35/255 (14%), Positives = 100/255 (39%), Gaps = 5/255 (2%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1668  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLLHTQNTSLI  1727

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
               K++   ++  ++   + + ++  + + +    + +       L+        LE   +
Sbjct  1728  NTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1787

Query  176   AASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                +  + L+   +  +Q        Q+ +L  + + +EA +  E++   E  + L + +
Sbjct  1788  NMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEAEVESEQKRNVEAVKGLRKHE  1847

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
                 +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++   + 
Sbjct  1848  RRVKELTYQTEEDRKNVLRLQDLVDKLQAK-VKSYKRQAEEAEEQSNVNLSKFRKLQHEL  1906

Query  292   KIVMETVPVLKAQAD  306
             +   E   + ++Q +
Sbjct  1907  EEAEERADIAESQVN  1921


 Score = 40.2 bits (92),  Expect = 0.047, Method: Composition-based stats.
 Identities = 43/281 (15%), Positives = 110/281 (39%), Gaps = 43/281 (15%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRE---RCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             + L+    EN+ L+  I    + + E   R  EL   +    +EK  L    +EA   +E
Sbjct  1496  DQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKVKKQVEQEKSELQAALEEAEASLE  1555

Query  106   R-----------LGLEKLDLKRQKEQALREVEHLKRCQ-QQMAEDKASVKAQV-------  146
                         L   K ++ R+  +   E++ LKR   + +   ++++ A++       
Sbjct  1556  HEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRVVESMQSTLDAEIRSRNDAI  1615

Query  147   ---TSLLGELQESQSRLE-------AATKECQALEGRARAASEQARQLESEREALQQQHS  196
                  + G+L E + +L         A +  +  +G  +            +E L++Q +
Sbjct  1616  RIKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQEDLKEQLA  1675

Query  197   V----------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK  246
             +          ++++LR   +  E + ++  Q   +   ++  L      L       ++
Sbjct  1676  MVERRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTK-KKLE  1734

Query  247   SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             + +   + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1735  TDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKE  1775


>sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 
PE=1 SV=2
Length=1938

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 59/326 (18%), Positives = 144/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  875   EEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  934

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  935   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  994

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  995   KEKKALQEAHQQALDDLQAEEDKVNTLTKSKV----KLEQQVDDLEGSLEQEKKVRMDLE  1050

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA--EEALVAK-QEVI  281
             R   +L+    +L QE    +++  +  E K   +  D+ QQ  +   E+AL  + Q+ +
Sbjct  1051  RAKRKLEGDL-KLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKL  1109

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              + +   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1110  KENQARIEELEEELEAERTARAKVEKLRSDLTRE---LEEISERLEEAGGATSVQIEMNK  1166

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1167  KREAEFQKMRRDLEEATLQHEATAAA  1192


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 50/308 (16%), Positives = 118/308 (38%), Gaps = 2/308 (1%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
                ++  E    + +E  + +  L  EK DL+ Q +     +   +    Q+ ++K  ++
Sbjct  858   GRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLE  917

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
             A+V  +   L++ +      T + + LE       +    LE     ++++     ++++
Sbjct  918   AKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVK  977

Query  204   MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL  263
                + +     +  +   E+K      Q A   L  E D    +++  S+ K   Q++DL
Sbjct  978   NLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKV--NTLTKSKVKLEQQVDDL  1035

Query  264   KQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA  323
             +  L+Q ++  +  +    KL+ + +  +  +  +   K Q +      + +   +    
Sbjct  1036  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKI  1095

Query  324   EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPS  383
             E ++ L  QL++  +E        +E    E   +  VE  ++ L      +S  L    
Sbjct  1096  EDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAG  1155

Query  384   QRRSPPEE  391
                S   E
Sbjct  1156  GATSVQIE  1163


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 117/312 (38%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1280  KLQTENGELARQLEEKEALIWQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARH  1339

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E+E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1340  DCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1399

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + LA+ + 
Sbjct  1400  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQ  1459

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+  +
Sbjct  1460  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGE  1519

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q ++ K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1520  GGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1579

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1580  KDEEMEQAKRNH  1591


 Score = 42.5 bits (98),  Expect = 0.008, Method: Composition-based stats.
 Identities = 55/315 (17%), Positives = 125/315 (40%), Gaps = 14/315 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L+R LEE  + ++A+  + Q  R  C+ L      + E K  L     +A   V +  
Sbjct  1314  EDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWR  1373

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              +      Q+ +   E+E  K+   Q  +D       V +    L++++ RL+   ++  
Sbjct  1374  TKYETDAIQRTE---ELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLM  1430

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                 R+ AA+          +  Q+     + + + + +  ++ L   ++ A     +L 
Sbjct  1431  VDVERSNAAAAAL-------DKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELF  1483

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +L+ AY +  +  +   + +    E    +  +  +      E   + KQ  ++KL+ ++
Sbjct  1484  KLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQS  1543

Query  289   EQHKIVM----ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
                +       E   +L+AQ +  +   + ER+  EK  E ++  +  L  +    + L 
Sbjct  1544  ALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLD  1603

Query  345   ASCQESARIEDMRKR  359
             A  +       ++K+
Sbjct  1604  AETRSRNEALRVKKK  1618


 Score = 41.0 bits (94),  Expect = 0.026, Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 96/217 (44%), Gaps = 8/217 (4%)

Query  87    REEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV  146
             +E    +  +    +  +E L       +R ++ A +E+       Q +     S+  Q 
Sbjct  1669  KENIAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQK  1728

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQG  206
               +  +L + Q+ +E A +EC+  E +A+ A   A  +  E    +Q  S  +++++   
Sbjct  1729  KKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEE-LKKEQDTSAHLERMKKNM  1787

Query  207   QSVEAALR-----MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--  259
             +     L+      E+ A    K++L +L+    +L  E +   K +    +  R  +  
Sbjct  1788  EQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERR  1847

Query  260   LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVME  296
             +++L  Q ++ ++ LV  Q+++DKL+ + + +K   E
Sbjct  1848  IKELTYQTEEDKKNLVRLQDLVDKLQLKVKAYKRQAE  1884


 Score = 40.6 bits (93),  Expect = 0.036, Method: Composition-based stats.
 Identities = 62/341 (18%), Positives = 127/341 (37%), Gaps = 47/341 (14%)

Query  41    LPSEQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEEL  79
             +  EQ     LQ+ L+ENQ                     +LR  + +  + + ER EE 
Sbjct  1095  IEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEA  1154

Query  80    LHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAED  138
                 + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   
Sbjct  1155  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1214

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH-SV  197
             K  ++ + +    EL +  S +E   K    LE  +R   +QA +   + E  Q+     
Sbjct  1215  KQKLEKEKSEFKLELDDVTSHMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDF  1274

Query  198   QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE----  253
                + ++Q ++ E A ++E +       +L + +++Y Q  ++    ++           
Sbjct  1275  TTQRAKLQTENGELARQLEEK--EALIWQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAH  1332

Query  254   --RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
               +      + L++Q ++  EA    Q V+ K   E  Q +   ET  + +         
Sbjct  1333  ALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRT--------  1384

Query  312   FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                     E+L E K+ L ++L+  +     + A C    +
Sbjct  1385  --------EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1417


 Score = 39.8 bits (91),  Expect = 0.049, Method: Composition-based stats.
 Identities = 46/249 (18%), Positives = 106/249 (43%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  +E+ +  R    Q      ER + L     S   +K+ +     + +  V
Sbjct  1683  QAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEV  1742

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1743  EEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAE  1802

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E EA Q++++  V  +R      E  ++       E+
Sbjct  1803  QIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMR----KSERRIKELTYQTEED  1858

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             K+ L +LQ    +L Q      K     +E +    L   ++   +L +AEE     +  
Sbjct  1859  KKNLVRLQDLVDKL-QLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQ  1917

Query  281   IDKLKEEAE  289
             ++KL+ ++ 
Sbjct  1918  VNKLRAKSR  1926


 Score = 37.5 bits (85),  Expect = 0.30, Method: Composition-based stats.
 Identities = 58/349 (17%), Positives = 127/349 (36%), Gaps = 19/349 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEARKLV  104
               +L++  +   +L  A R+    L+   E ++  +  + + +E L  K     +    +
Sbjct  1036  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKI  1095

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E      L L+++ ++    +E L+   +     +A V+   + L  EL+E   RLE A 
Sbjct  1096  EDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAG  1155

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                       +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1156  GATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1215

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG------MQLEDLKQQLQQAEEALVAKQ  278
             +KL + +  +     +  +H++  +               Q  + + +L++A+ +L    
Sbjct  1216  QKLEKEKSEFKLELDDVTSHMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFT  1275

Query  279   EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
                 KL+ E  +    +E    L  Q            + +    ++ E L+ QLE+  +
Sbjct  1276  TQRAKLQTENGELARQLEEKEALIWQLT----------RGKLSYTQQMEDLKRQLEEEGK  1325

Query  339   EYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + L  + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1326  AKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRT  1374


>sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis OX=8355 
GN=dctn1 PE=2 SV=1
Length=1232

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/212 (21%), Positives = 93/212 (44%), Gaps = 23/212 (11%)

Query  98   QEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
            + A +  E L  E   LK + E+   ++E LK   ++   D A+   QV     +L+E  
Sbjct  270  EMAEERAESLQQEVDTLKDKVEEHKIDLEILKHEIEEKGSDGAASSYQV----KQLEEQN  325

Query  158  SRLEAA-----------TKECQALEGRARAASEQARQLESEREALQQ---QHSVQVDQLR  203
            +RL+ A            +E   ++ +    + +   L  ++E LQ+        +D+L+
Sbjct  326  ARLKEALVRMRDLSASEKQEHIKVQKQMEKKNTELDTLRQQKEKLQEEASHMEKTIDELK  385

Query  204  MQGQSVEAALRM-----ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
             Q  +   A  M     ER    EEK +  +  V+  +   E ++ ++ +   +E +   
Sbjct  386  EQVDAALGAEEMVETLAERNLDLEEKVRELRETVSDLEAINEMNDELQENARETELELRE  445

Query  259  QLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
            QL+    ++++AE+ + A QE +   ++  ++
Sbjct  446  QLDMAGARVREAEKRVEAAQETVADYQQTIKK  477


 Score = 41.7 bits (96),  Expect = 0.014, Method: Composition-based stats.
 Identities = 40/242 (17%), Positives = 90/242 (37%), Gaps = 1/242 (0%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E L+  +EE      A     + L E+   L       R+       +  + +K +E+  
Sbjct  298  EILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHIKVQKQMEKKN  357

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             E   L++QKE+   E  H+++   ++ E   +       ++  L E    LE   +E +
Sbjct  358  TELDTLRQQKEKLQEEASHMEKTIDELKEQVDA-ALGAEEMVETLAERNLDLEEKVRELR  416

Query  169  ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                   A +E   +L+      + +   Q+D    + +  E  +   ++  ++ ++ + 
Sbjct  417  ETVSDLEAINEMNDELQENARETELELREQLDMAGARVREAEKRVEAAQETVADYQQTIK  476

Query  229  QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
            + +     L +             E+++    E    +++ AE    AK   ++  K E 
Sbjct  477  KYRDLTAHLQEVNSELRNQQEASVEKEQQPSPEMFDFKIKFAETKAHAKAIEMELRKMEV  536

Query  289  EQ  290
             Q
Sbjct  537  TQ  538


 Score = 39.4 bits (90),  Expect = 0.076, Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 87/225 (39%), Gaps = 19/225 (8%)

Query  151  GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
             E +  +++++   ++ + L+ +      + +++E  +  L+Q    +      Q     
Sbjct  173  KEEENLRAQVKDLEEKLETLKMKRAEDKAKLKEMEKSKLQLEQVQEWKSKMQEQQADIQR  232

Query  211  AALR---------------MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERK  255
                               ME  A + +  ++A L     +   E       ++     +
Sbjct  233  QLKEAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEE  292

Query  256  RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKA--QADIYKADFQ  313
              + LE LK ++++      A    + +L+E+  + K  +  +  L A  + +  K   Q
Sbjct  293  HKIDLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHIKVQKQ  352

Query  314  AERQARE--KLAEKKELLQEQLEQLQREYSKLKASCQESARIEDM  356
             E++  E   L ++KE LQE+   +++   +LK     +   E+M
Sbjct  353  MEKKNTELDTLRQQKEKLQEEASHMEKTIDELKEQVDAALGAEEM  397


 Score = 39.0 bits (89),  Expect = 0.10, Method: Composition-based stats.
 Identities = 58/347 (17%), Positives = 131/347 (38%), Gaps = 58/347 (17%)

Query  98   QEARKLVERLGLEKLDLKRQKEQ---ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
            +  R  V+ L  +   LK ++ +    L+E+E  K   +Q+ E K+ ++ Q   +  +L+
Sbjct  176  ENLRAQVKDLEEKLETLKMKRAEDKAKLKEMEKSKLQLEQVQEWKSKMQEQQADIQRQLK  235

Query  155  ESQSR----------------------------LEAATKECQALEGRARAASEQARQLES  186
            E++                               E A +  ++L+       ++  + + 
Sbjct  236  EAKKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVDTLKDKVEEHKI  295

Query  187  EREALQQQH----------SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQ  236
            + E L+ +           S QV QL  Q   ++ AL   R  ++ EK++  ++Q    +
Sbjct  296  DLEILKHEIEEKGSDGAASSYQVKQLEEQNARLKEALVRMRDLSASEKQEHIKVQKQMEK  355

Query  237  LFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEA------LVAKQEVIDKLKEEA  288
               E D   +      E    M+  +++LK+Q+  A  A      L  +   +++   E 
Sbjct  356  KNTELDTLRQQKEKLQEEASHMEKTIDELKEQVDAALGAEEMVETLAERNLDLEEKVREL  415

Query  289  EQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
             +    +E +  +  +          +  ARE   E +E L     +++    +++A+ +
Sbjct  416  RETVSDLEAINEMNDEL---------QENARETELELREQLDMAGARVREAEKRVEAAQE  466

Query  349  ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
              A  +   K++ +++           +   A   + + P  E  DF
Sbjct  467  TVADYQQTIKKYRDLTAHLQEVNSELRNQQEASVEKEQQPSPEMFDF  513


>sp|Q8TDM6|DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=9606 
GN=DLG5 PE=1 SV=4
Length=1919

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 48/279 (17%), Positives = 105/279 (38%), Gaps = 40/279 (14%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
            L++  EENQ L   ++Q+  + ++R   +             L  +   + +  E +  E
Sbjct  338  LEQLGEENQRL---LKQTEMLTQQRDTAIQ------------LQHQCALSLRRFEAIHHE  382

Query  111  -------KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
                     DL+ + E    E+  L+  Q + A++    + +  ++  E +   S  +  
Sbjct  383  LNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYREERDAVYSEYKLIMSERDQV  442

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHS-----------------VQVDQLRMQG  206
              E   L+     A  + +   SE++A  ++                    +V+ LR Q 
Sbjct  443  ISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQIKDTVTMDAGRANKEVEILRKQC  502

Query  207  QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQ  266
            +++   L+   Q A   K +         ++  E  + I++      R+R   + +L + 
Sbjct  503  KALCQELKEALQEADVAKCRRDWAFQERDKIVAER-DSIRTLCDNLRRERDRAVSELAEA  561

Query  267  LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
            L+  ++    K +V  +LKE  EQ +  +E     +   
Sbjct  562  LRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLM  600


 Score = 37.9 bits (86),  Expect = 0.23, Method: Composition-based stats.
 Identities = 38/242 (16%), Positives = 92/242 (38%), Gaps = 9/242 (4%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E LQ  L E +  +    + ++  RE  + +         E++ ++ +  + +  VE   
Sbjct  398  ELLQSELTELRTTQVKTAKESEKYREERDAVYSEYKLIMSERDQVISELDKLQTEVELAE  457

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             +      +K+ A  E+E L++ +  +  D      +V  L  + +     L+ A +E  
Sbjct  458  SKLKSSTSEKKAANEEMEALRQIKDTVTMDAGRANKEVEILRKQCKALCQELKEALQEAD  517

Query  169  --------ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                    A + R +  +E+   + +  + L+++    V +L    +S++   + +   +
Sbjct  518  VAKCRRDWAFQERDKIVAERDS-IRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVS  576

Query  221  SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
             E K    Q++    +  +       SS   +     M+ E    + ++  E +  K   
Sbjct  577  RELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALG  636

Query  281  ID  282
             D
Sbjct  637  FD  638


>sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens OX=9606 GN=MYH3 
PE=1 SV=3
Length=1940

 Score = 54.1 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 45/271 (17%), Positives = 129/271 (48%), Gaps = 11/271 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E L   ++E  +L+  ++  ++ L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  875   EEKLVTLVQEKNDLQLQVQAESENLLDAEERCDQLIKAKFQLEAKIKEVTERAEDEEEIN  934

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  EL      +   T
Sbjct  935   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEELSGLDETIAKLT  994

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             +E +AL+   + A +  +  E +  +L +  S    +L  Q + +E++L  E++   + +
Sbjct  995   REKKALQEAHQQALDDLQAEEDKVNSLNKTKS----KLEQQVEDLESSLEQEKKLRVDLE  1050

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  +   L+ +++  +   +  Q+ I
Sbjct  1051  RNKRKLEGDL-KLAQESILDLENDKQQLDERLKKKDFEYCQLQSKVEDEQTLGLQFQKKI  1109

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              +L+   E+ +  +E     +A+ +  ++D+
Sbjct  1110  KELQARIEELEEEIEAERATRAKTEKQRSDY  1140


 Score = 44.8 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 60/359 (17%), Positives = 138/359 (38%), Gaps = 23/359 (6%)

Query  40    HLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQE  99
              L   +G  E +QR L E    +  ++     L  + EE     +     K+    + +E
Sbjct  1256  QLSEARGKNEEIQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQTEE  1315

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
              ++ +E     K  L    + +  + + L+   ++  E KA ++  ++    E+ + +++
Sbjct  1316  LKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTK  1375

Query  160   -----------LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
                        LE A K+   L  R + + EQ   + ++  +L++       ++      
Sbjct  1376  YETDAIQRTEELEEAKKK---LAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVD  1432

Query  209   VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR------GMQLED  262
             VE A  +   A  +++R   ++   +    +E    +++S+  S              E+
Sbjct  1433  VERANSLA-AALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEE  1491

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
                QL+  +      ++ I  L E+  ++   +  +   + Q ++ KAD Q   +  E  
Sbjct  1492  ALDQLETVKRENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEAA  1551

Query  323   AEKKEL--LQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPL  379
              E +E   L+ QLE  Q +    +   ++   IE +++ +    +       A + S  
Sbjct  1552  LEHEEAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQSALDAEVRSRN  1610


 Score = 38.3 bits (87),  Expect = 0.19, Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 104/249 (42%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  V
Sbjct  1683  QAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQSEV  1742

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    +  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1743  EDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAE  1802

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E  Q++++  V  LR      E  ++     + E+
Sbjct  1803  QLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLR----KYERRVKELTYQSEED  1858

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     ++ +    L   ++   +L++AEE     +  
Sbjct  1859  RKNVLRLQDLVDKL-QVKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQ  1917

Query  281   IDKLKEEAE  289
             ++KL+ +  
Sbjct  1918  VNKLRAKTR  1926


 Score = 36.4 bits (82),  Expect = 0.65, Method: Composition-based stats.
 Identities = 59/328 (18%), Positives = 137/328 (42%), Gaps = 24/328 (7%)

Query  53    RCLEENQELRDAIRQSNQI------LRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             +C E   EL  ++++S  +      L+   EE L    + + E + L  +  +  + +  
Sbjct  1460  KCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVKRENKNLEQEIADLTEQIAE  1519

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE----A  162
              G    +L++ ++Q   E   ++   ++        +A++  +  EL + +S ++     
Sbjct  1520  NGKTIHELEKSRKQIELEKADIQLALEEAEAALEHEEAKILRIQLELTQVKSEIDRKIAE  1579

Query  163   ATKECQALEGRARAASEQAR-------QLESEREALQQQHSVQVDQLRMQGQ--SVEAAL  213
               +E + L+   +   E  +       +  +E   L+++    ++++ +Q    + +AA 
Sbjct  1580  KDEEIEQLKRNYQRTVETMQSALDAEVRSRNEAIRLKKKMEGDLNEIEIQLSHANRQAAE  1639

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA  273
              ++   + + + K  QL +      QE      + V         ++E+L+  L+Q E A
Sbjct  1640  TLKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRANLLQAEVEELRATLEQTERA  1699

Query  274   -LVAKQEVIDKLKEEAEQHKIVMETV-PVLKAQADIYKADFQAERQARE-KLAEKKELLQ  330
               +A+QE++D  +     H      +    K + D+ +   + E  +R+ + AE+K    
Sbjct  1700  RKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQSEVEDASRDARNAEEKAKKA  1759

Query  331   EQLEQLQREYSKLKASCQESARIEDMRK  358
                  +  E  +LK     SA +E M+K
Sbjct  1760  ITDAAMMAE--ELKKEQDTSAHLERMKK  1785


>sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus 
OX=10090 GN=Tbc1d2 PE=2 SV=1
Length=922

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 100/256 (39%), Gaps = 23/256 (9%)

Query  136  AEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES-EREALQQQ  194
             E  A+++ QV  L  EL+  +  +    K  +A +   RA+S      E  +R  L + 
Sbjct  308  QEKVAALEQQVLMLTKELKSQKELVIILHKALEAAQQEKRASSAYLAATEDRDRLELVRH  367

Query  195  HSVQVDQLRMQGQSVE-AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE  253
               Q+ +L  + +++E    R+  +A   E++  A  Q  + QL  + ++  +  +    
Sbjct  368  KVRQIAELNQRVEALEQGRERLAHEAGLREQQVQALQQ--HVQLLMDKNHAKQQVIC---  422

Query  254  RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQ  313
            +      EDL Q         +++QE ++ LK          + +   + Q     ++  
Sbjct  423  KLTQKLTEDLAQPADATNGDFLSQQERMEHLK----------DDMEAYRTQNRFLNSEIH  472

Query  314  AERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK-RHVEVSQAPLPPAP  372
               +   K+AEK++ L  +   LQ    +++     S  +  +R+ +    ++A   P  
Sbjct  473  QVTKIWRKVAEKEKALLTKCAYLQARNCQVE-----SKYLAGLRRLQEAAGAEAGDFPEL  527

Query  373  AYLSSPLALPSQRRSP  388
                   AL  +    
Sbjct  528  LQQLIQEALQWEAGEA  543


>sp|Q9QYE6|GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus 
OX=10090 GN=Golga5 PE=1 SV=2
Length=729

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 49/284 (17%), Positives = 115/284 (40%), Gaps = 19/284 (7%)

Query  72   LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
            LR + ++L    A++  +   L  + QEA +++         L+ +K + +++ +     
Sbjct  281  LRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALRSEKSRIMQDHKEGSSL  340

Query  132  QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREAL  191
            Q Q  +   +++ ++      L+  Q   +    E  A   +     +   +  +  E  
Sbjct  341  QNQALQ---TLQERLHEADATLKREQESYKQMQSEFAARLNKMEVDRQNLAEAVTLAERK  397

Query  192  QQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG  251
              +   +VD+L+ Q +   A+L   +Q   + K+K  ++  +  +L            + 
Sbjct  398  YSEEKKKVDELQQQVKLHRASLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLE  457

Query  252  SERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
            S     M+LE+L+ + +  +E +      + +L+ E       ME   V +A+       
Sbjct  458  SSTASSMELEELRHEKEMQKEEIQKLMGQMHQLRSEL----QDMEAQQVSEAE-------  506

Query  312  FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
                  ARE+L + ++ + +Q    Q   ++L+   QE   +E+
Sbjct  507  -----SAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEE  545


 Score = 36.7 bits (83),  Expect = 0.41, Method: Composition-based stats.
 Identities = 39/247 (16%), Positives = 91/247 (37%), Gaps = 21/247 (9%)

Query  62   RDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQA  121
            +++ +Q       R  ++   + +  E       K+ E +K V+ L  +    +   E A
Sbjct  363  QESYKQMQSEFAARLNKMEVDRQNLAEAVTLAERKYSEEKKKVDELQQQVKLHRASLESA  422

Query  122  LREVEHLKRCQQQMAEDKASVKAQVTSLLG------------ELQESQSRLEAATKECQA  169
             +E+   K+   ++ + K  +   +                 EL+E +   E   +E Q 
Sbjct  423  KQELVDYKQKATRILQSKEKLINSLKEGSSFEGLESSTASSMELEELRHEKEMQKEEIQK  482

Query  170  LEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQ  229
            L G+      + + +E+++ +  +    Q+  L+ Q      + +         K++   
Sbjct  483  LMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRY  542

Query  230  LQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE---------DLKQQLQQAEEALVAKQEV  280
            ++   H+      + IK      ++ R              +L+ +L Q  E L+ KQ +
Sbjct  543  MEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQTM  602

Query  281  IDKLKEE  287
            ++ L  E
Sbjct  603  LESLSTE  609


 Score = 35.6 bits (80),  Expect = 0.95, Method: Composition-based stats.
 Identities = 36/213 (17%), Positives = 85/213 (40%), Gaps = 8/213 (4%)

Query  85   SQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKA  144
            S+ +E   L  + Q  R  V+ L  E   L ++ ++   E+   +   ++   D +    
Sbjct  217  SRSQELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARVRVEKWNVDNSKSDR  276

Query  145  QVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRM  204
                L  ++ +    + A   +   L+ R + A +         EAL+ + S  +   + 
Sbjct  277  ITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALRSEKSRIMQDHKE  336

Query  205  QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
                   AL+  ++   E    L + Q +Y Q+  E+   +    V          ++L 
Sbjct  337  GSSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKMEVDR--------QNLA  388

Query  265  QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMET  297
            + +  AE     +++ +D+L+++ + H+  +E+
Sbjct  389  EAVTLAERKYSEEKKKVDELQQQVKLHRASLES  421


 Score = 35.2 bits (79),  Expect = 1.4, Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 75/192 (39%), Gaps = 9/192 (5%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            + LQ+ ++ ++   ++ +Q     +++   +L  Q+ ++           E  +      
Sbjct  406  DELQQQVKLHRASLESAKQELVDYKQKATRIL--QSKEKLINSLKEGSSFEGLESSTASS  463

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ----VTSLLGELQESQSRLEAAT  164
            +E  +L+ +KE    E++ L     Q+  +   ++AQ      S   +LQ+ Q ++    
Sbjct  464  MELEELRHEKEMQKEEIQKLMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQR  523

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAAL---RMERQAAS  221
               Q LE       ++ R +E +    +     ++     + Q +   L    +   + S
Sbjct  524  TSKQELETELERMKQEFRYMEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS  583

Query  222  EEKRKLAQLQVA  233
            E + +L QL   
Sbjct  584  ELESRLHQLTET  595


>sp|Q2KJ21|CACO1_BOVIN Calcium-binding and coiled-coil domain-containing 
protein 1 OS=Bos taurus OX=9913 GN=CALCOCO1 PE=2 
SV=1
Length=680

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 63/334 (19%), Positives = 141/334 (42%), Gaps = 22/334 (7%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
            +G    L+  ++E ++   A RQ +  L E+ + L        EE++ L  +  +    +
Sbjct  171  EGQVTELKSQVQELEKALAAARQEHAELAEQYKGLSRSHGELTEERDILSRQQGDHVARI  230

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              L  +   +  +      E++ ++   + +  ++  +  Q+  +  + ++S++ L+ A 
Sbjct  231  LELEEDIQTISEKVLMKEVELDRVRDSVKALTREQEKLLGQLKEVQADKEQSEAELQMAQ  290

Query  165  KECQAL-------EGRARAASEQARQLESEREALQ------QQHSVQVDQLRMQGQSVEA  211
            +E + L       + R    S QA++L+ +   ++      QQ   +++ L+ Q +  + 
Sbjct  291  QENRRLNLELQEAKDRQEEQSAQAQRLKDKVAQMKDTLGQVQQRVAELEPLKEQLRGAQE  350

Query  212  ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL---EDLKQQLQ  268
                 +Q A+    +LA    A  +   E           + R   + L   E+  Q  +
Sbjct  351  LAASSQQKAALLGEELASAAGARDRTIAELHRSRLEVAGVNGRLAELSLHLKEEKSQWSK  410

Query  269  QAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKKE  327
            +    L + +   DK+ + + +   + + V   K Q+ ++K +   E+  +  +L+E K 
Sbjct  411  ERAGLLQSVEAEKDKILKLSAEILRLEKAVQEEKTQSQVFKTELAREKDSSLVQLSESKR  470

Query  328  LLQE---QLEQLQREYSKLKASCQESARIEDMRK  358
             L E    L  LQ+E  +L+   QE   +E MRK
Sbjct  471  ELTELRSALRVLQKEKEQLQEEKQE--LLEYMRK  502


 Score = 37.1 bits (84),  Expect = 0.34, Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 99/255 (39%), Gaps = 16/255 (6%)

Query  52   QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
            ++ L + +E++    QS   L+   +E        +E K+    +  +A++L +++   K
Sbjct  266  EKLLGQLKEVQADKEQSEAELQMAQQENRRLNLELQEAKDRQEEQSAQAQRLKDKVAQMK  325

Query  112  LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
              L  Q +Q + E+E LK   +   E  AS + +   L  EL  +    +    E     
Sbjct  326  DTL-GQVQQRVAELEPLKEQLRGAQELAASSQQKAALLGEELASAAGARDRTIAELHRSR  384

Query  172  GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS-------VEAALRMERQAASEEK  224
                  + +  +L    +  + Q S +   L    ++       + A +    +A  EEK
Sbjct  385  LEVAGVNGRLAELSLHLKEEKSQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEEK  444

Query  225  RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
                Q QV   +L +E D+ +             +L +L+  L+  ++     QE   +L
Sbjct  445  ---TQSQVFKTELAREKDSSLVQLSESKR-----ELTELRSALRVLQKEKEQLQEEKQEL  496

Query  285  KEEAEQHKIVMETVP  299
             E   + +  +E V 
Sbjct  497  LEYMRKLEARLEKVA  511


 Score = 37.1 bits (84),  Expect = 0.37, Method: Composition-based stats.
 Identities = 39/220 (18%), Positives = 91/220 (41%), Gaps = 10/220 (5%)

Query  79   LLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAED  138
            L +     ++E+  LM    +    V  L  +  +L++    A +E   L    + ++  
Sbjct  149  LQNQLDESQQERNDLMQLKLQLEGQVTELKSQVQELEKALAAARQEHAELAEQYKGLSRS  208

Query  139  KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV-  197
               +  +   L  +  +  +R+    ++ Q +  +      +  ++    +AL ++    
Sbjct  209  HGELTEERDILSRQQGDHVARILELEEDIQTISEKVLMKEVELDRVRDSVKALTREQEKL  268

Query  198  --QVDQLRMQGQSVEAALRMERQAA------SEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
              Q+ +++   +  EA L+M +Q         +E +   + Q A  Q  ++    +K ++
Sbjct  269  LGQLKEVQADKEQSEAELQMAQQENRRLNLELQEAKDRQEEQSAQAQRLKDKVAQMKDTL  328

Query  250  VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
               + +R  +LE LK+QL+ A+E   + Q+    L EE  
Sbjct  329  GQVQ-QRVAELEPLKEQLRGAQELAASSQQKAALLGEELA  367


 Score = 34.8 bits (78),  Expect = 1.7, Method: Composition-based stats.
 Identities = 41/247 (17%), Positives = 103/247 (42%), Gaps = 14/247 (6%)

Query  126  EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
            E +   +     D   V  + T L  +L ESQ       +    LEG+      Q ++LE
Sbjct  126  ELVTLEETDGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELKSQVQELE  185

Query  186  SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI  245
                A +Q+H+   +Q +   +S            +EE+  L++ Q  +     E +  I
Sbjct  186  KALAAARQEHAELAEQYKGLSRSH--------GELTEERDILSRQQGDHVARILELEEDI  237

Query  246  KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV-IDKLKEEAEQHKIVMETVPVLKAQ  304
            ++ +      + ++L+ ++  +    +AL  +QE  + +LKE     +     + + + +
Sbjct  238  QT-ISEKVLMKEVELDRVRDSV----KALTREQEKLLGQLKEVQADKEQSEAELQMAQQE  292

Query  305  ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVS  364
                  + Q  +  +E+ + + + L++++ Q++    +++    E   +++  +   E++
Sbjct  293  NRRLNLELQEAKDRQEEQSAQAQRLKDKVAQMKDTLGQVQQRVAELEPLKEQLRGAQELA  352

Query  365  QAPLPPA  371
             +    A
Sbjct  353  ASSQQKA  359


>sp|P15800|LAMB2_RAT Laminin subunit beta-2 OS=Rattus norvegicus 
OX=10116 GN=Lamb2 PE=1 SV=1
Length=1801

 Score = 53.7 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 52/289 (18%), Positives = 112/289 (39%), Gaps = 30/289 (10%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             A +  Q  L++    R  + Q+NQ LRE  + +  F + +  + + +         +   
Sbjct  1490  AQQRAQAALDKANASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIP  1549

Query  107   LGLEKLD-LKRQKEQALREV-----------------EHLKRCQQQMAEDKASVKAQVTS  148
                E++  L  +  + +R +                 E L +  Q+        + +  +
Sbjct  1550  ASPEQIQRLASEIAERVRSLADVDTILAHTMGDVRRAEQLLQDAQRARSRAEGERQKAET  1609

Query  149   LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
             +   L+E+Q    AA    +      +   +  +Q++      +Q  +   ++ R Q  +
Sbjct  1610  VQAALEEAQRAQGAAQGAIRGAVVDTKNTEQTLQQVQERMAGTEQSLNSASERAR-QLHA  1668

Query  209   VEAALRMER------QAASEEKRKLAQLQV--AYHQLFQEYDNHIKSSVVGSERKRGMQL  260
             +  AL+++R       + +EE    AQ +   A  QL ++  +  ++    +ERK    L
Sbjct  1669  LLEALKLKRAGNSLAASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVL  1728

Query  261   EDLKQQLQQAEEA---LVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
                 +  Q  +EA   L A Q+ + +L+E    ++     + V  AQ D
Sbjct  1729  AAQARAEQLRDEARGLLQAAQDKLQRLQELEGTYEENERELEVKAAQLD  1777


 Score = 47.5 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 37/195 (19%), Positives = 70/195 (36%), Gaps = 20/195 (10%)

Query  43    SEQGAPETLQRCLEENQELRDAIR--------------QSNQILRERCEE----LLHFQA  84
              E+   ET+Q  LEE Q  + A +              Q+ Q ++ER       L     
Sbjct  1602  GERQKAETVQAALEEAQRAQGAAQGAIRGAVVDTKNTEQTLQQVQERMAGTEQSLNSASE  1661

Query  85    SQREEKEFLMC-KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
               R+    L   K + A   +     E+     Q      E +  ++   Q    +A  +
Sbjct  1662  RARQLHALLEALKLKRAGNSLAASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAE  1721

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
              +   +L     ++   + A    QA + + +   E     E     L+ + + Q+D L 
Sbjct  1722  RKAEGVLAAQARAEQLRDEARGLLQAAQDKLQRLQELEGTYEENERELEVK-AAQLDGLE  1780

Query  204   MQGQSVEAALRMERQ  218
              + +SV  A+ ++ Q
Sbjct  1781  ARMRSVLQAINLQVQ  1795


>sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus OX=9913 GN=MYH2 PE=2 
SV=1
Length=1940

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 147/326 (45%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  879   EEKMVTLLKEKNDLQLQVQSEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  938

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  939   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  998

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  999   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1054

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1055  RAKRKLEGDL-KLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKI  1113

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1114  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1170

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1171  KREAEFQKMRRDLEEATLQHEATAAA  1196


 Score = 51.4 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 60/332 (18%), Positives = 119/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + +   ++ +       F     E K  L  + +    L   L   + 
Sbjct  1284  RLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHGLQSARH  1343

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++    V    T    +  +    LE A K+      
Sbjct  1344  DCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1403

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1404  AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQ  1463

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K +         M+   E+   QL+  +      Q+ I  L E+  +
Sbjct  1464  KYEETHAELEAAQKEARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1523

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 M  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1524  GGKRMHELEKIKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1583

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1584  KDEEIDQLKRNHIRVVESMQTMLDAEIRSRND  1615


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 100/255 (39%), Gaps = 5/255 (2%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1670  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLI  1729

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
               K++   ++  ++   + + ++  + + +    + +       L+        LE   +
Sbjct  1730  NTKKKLETDITQIQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1789

Query  176   AASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                +  + L++  +  +Q        Q+ +L  + + +E  +  E++   E  + L + +
Sbjct  1790  NMEQTVKDLQNRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHE  1849

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
                 +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++   + 
Sbjct  1850  RRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNTNLSKFRKLQHEL  1908

Query  292   KIVMETVPVLKAQAD  306
             +   E   + ++Q +
Sbjct  1909  EEAEERADIAESQVN  1923


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 61/344 (18%), Positives = 131/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  ++
Sbjct  1040  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKI  1099

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A 
Sbjct  1100  EDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1159

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                 A     +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1160  GATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1219

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
             +KL + +        +  +++++            LE + + L+     L +K+E   +L
Sbjct  1220  QKLEKEKSEMKMEIDDLASNVETISKA-----KGNLEKMCRTLEDQVNELKSKEEEQQRL  1274

Query  285   KEEAEQHKIVMETVP-VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               +    +  ++T       Q D  +A      + ++   ++ E L+ QLE+  +  + L
Sbjct  1275  INDLTTQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNAL  1334

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
                 Q +    D+ +   E  Q         LS      +Q R+
Sbjct  1335  AHGLQSARHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRT  1378


 Score = 40.2 bits (92),  Expect = 0.042, Method: Composition-based stats.
 Identities = 52/263 (20%), Positives = 103/263 (39%), Gaps = 20/263 (8%)

Query  44    EQGAPETLQRCL-EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             EQ +   LQR L + N E+     +      +R EEL   +    +  +      +    
Sbjct  1355  EQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNA  1414

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                 L   K  L+ + E  + +VE        + + + +    +     + +E+ + LEA
Sbjct  1415  KCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKYEETHAELEA  1474

Query  163   ATKECQAL-------EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRM  215
             A KE ++L       +     + +Q   L+ E + LQQ+ S   +Q+   G+ +    ++
Sbjct  1475  AQKEARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRMHELEKI  1534

Query  216   ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
             ++Q   E+    A L+ A   L  E    ++  +            +L Q   + +  + 
Sbjct  1535  KKQVEQEKSEIQAALEEAEASLEHEEGKILRIQL------------ELNQVKSEIDRKIA  1582

Query  276   AKQEVIDKLKEEAEQHKIVMETV  298
              K E ID+LK    +    M+T+
Sbjct  1583  EKDEEIDQLKRNHIRVVESMQTM  1605


>sp|Q8SS35|Y4A0_ENCCU Probable myosin heavy chain ECU04_1000 OS=Encephalitozoon 
cuniculi (strain GB-M1) OX=284813 GN=ECU04_1000 
PE=1 SV=2
Length=1649

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 58/315 (18%), Positives = 128/315 (41%), Gaps = 20/315 (6%)

Query  47    APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER  106
             + E  +R   E  EL  A+R  +    +  E+         EE++    +  E    +E 
Sbjct  836   SVEDEKRFSMEKDELLMALRYKSDETAQELEKARKEVFDGHEERKMWETRVNEVAIQLEE  895

Query  107   LGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR-LEAATK  165
                E L L+R+  +    +        Q  ++  S++ +V S L E      + L     
Sbjct  896   KDSEILRLRREVSEQKGALS-------QQEKEICSLREEVVSKLSEKDAMVEKMLRERDS  948

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
             E QAL+ + +    +  ++    + ++++   +   L+ + +S    LR         K 
Sbjct  949   EVQALKEKVKEKDAEVERILEGMKRMEREGEERNRMLK-ENESTIDELRTRCLNMKRWKD  1007

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             + A+L+  Y  L ++  + ++   V ++R       ++++  ++ EE    +++++D L+
Sbjct  1008  EYAELREDYEALQKKLKDEVEDMQVENDR----LHNEIRKISKEREELGRMQKKLLDDLE  1063

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
              E  +   + +    L+ + +  +   Q ERQ R+     +E L E+   L+R    L  
Sbjct  1064  FERNRGSKLEKAFQELRGEYEAVEGQLQKERQFRDS---TQESLLEKTRGLERRVKSLNE  1120

Query  346   SCQESARIEDMRKRH  360
               +     E+M  R 
Sbjct  1121  KLRR----EEMANRQ  1131


 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 57/315 (18%), Positives = 138/315 (44%), Gaps = 24/315 (8%)

Query  49    ETLQRCLEENQELRDAIRQSNQI---LRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             E ++R   E +E    ++++      LR RC  +  ++    E +E      ++ +  VE
Sbjct  969   EGMKRMEREGEERNRMLKENESTIDELRTRCLNMKRWKDEYAELREDYEALQKKLKDEVE  1028

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT-  164
              + +E   L  +  +  +E E L R Q+++ +D    + + + L    QE +   EA   
Sbjct  1029  DMQVENDRLHNEIRKISKEREELGRMQKKLLDDLEFERNRGSKLEKAFQELRGEYEAVEG  1088

Query  165   ---KECQALEGRARAASEQARQLESEREALQQQH---SVQVDQLRMQGQSVEAALRMERQ  218
                KE Q  +    +  E+ R LE   ++L ++     +   QL  +   +   + + +Q
Sbjct  1089  QLQKERQFRDSTQESLLEKTRGLERRVKSLNEKLRREEMANRQLMSEKDEMYREIHVLQQ  1148

Query  219   AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQ  278
             +  +E   +   +  ++ + +     I+   + ++R   + L + K   + +EE++ A +
Sbjct  1149  SKLDE---IFDREAGFNSIKKNLQMEIQRLEMENQRL-SVDLMEAKCMGEASEESISATE  1204

Query  279   EVIDKLKEEAEQHKIVMETVP-------VLKAQADIYKADFQAERQAREKL---AEKKEL  328
                  L+EE ++ K +            +L ++ ++ +   + ER+++E++    EK+  
Sbjct  1205  RFCGMLEEERKKRKEIEYQASEHENRNVILSSEVEMLREMVEMERRSKEEVIRGHEKETG  1264

Query  329   LQEQLEQLQREYSKL  343
             L + +  +++E   L
Sbjct  1265  LCKAIAGVRKEVEDL  1279


>sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus OX=10090 GN=Myh11 
PE=1 SV=1
Length=1972

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 143/360 (40%), Gaps = 35/360 (10%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             Q+  E  Q+    +++  Q   +  EE    Q   + E E     + E+ ++  RL  +K
Sbjct  862   QKITERQQKAETELKELEQKHTQLAEEKTLLQEQLQAETEL----YAESEEMRVRLAAKK  917

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL-------QESQSRLEAAT  164
              +L+    +    +E  +  +QQ+  ++  +  Q+  L  +L       Q+ Q     A 
Sbjct  918   QELEEILHEMEARLEEEEDRRQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAE  977

Query  165   KECQALEGRARAASEQARQLESEREAL-------------QQQHSVQVDQLRMQGQSVEA  211
              + + LE       +Q  +L  ER+ L             +++ +  + +L+ + +S+ +
Sbjct  978   AKIKKLEDDILVMDDQNSKLSKERKLLEERVSDLTTNLAEEEEKAKNLTKLKSKHESMIS  1037

Query  212   ALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE  271
              L +  +   + +++L +L+        ++   I             Q+ +LK QL + E
Sbjct  1038  ELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIAD--------LQAQIAELKMQLAKKE  1089

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQE  331
             E L A    +D+   E  Q    ++ +  L+      + D  +ER AR K  ++K  L E
Sbjct  1090  EELQAALARLDE---EIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGE  1146

Query  332   QLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
             +LE L+ E      S      +   R++ V V +  L        + +    Q+ +   E
Sbjct  1147  ELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQAVE  1206


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 56/325 (17%), Positives = 119/325 (37%), Gaps = 13/325 (4%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQREE-KEFLMCKFQEARKLVERLGLEKLDLKRQ  117
             QELR    Q   +L++  +E      +Q +E ++      +E  + +E+    K +L + 
Sbjct  1166  QELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHTQAVEELTEQLEQFKRAKANLDKS  1225

Query  118   KEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAA  177
             K+   +E   L    + + + K  V+ +   L  +LQ+ QS+     +    L  +    
Sbjct  1226  KQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKL  1285

Query  178   SEQARQLE---SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
               +   +    +E E    + +  V  L  Q Q  +  L+ E +       KL QL+   
Sbjct  1286  QNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDER  1345

Query  235   HQLFQEYDNHIKSSVVGSERK---------RGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             + L  + D  +++                    +L+D    ++  EE     Q+ ++ L 
Sbjct  1346  NSLQDQLDEEMEAKQNLERHVSTLNIQLSDSKKKLQDFASTIEVMEEGKKRLQKEMEGLS  1405

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             ++ E+     + +   K +      D   +   + +L    E  Q++ +QL  E   + +
Sbjct  1406  QQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISS  1465

Query  346   SCQESARIEDMRKRHVEVSQAPLPP  370
                +     +   R  E     L  
Sbjct  1466  KYADERDRAEAEAREKETKALSLAR  1490


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 55/312 (18%), Positives = 123/312 (39%), Gaps = 13/312 (4%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             L+ +  EL    A + EE +  + +  E          +  +L+        +++  +  
Sbjct  1074  LQAQIAELKMQLAKKEEELQAALARLDEEIAQKNNALKKIRELEGHISDLQEDLDSERAA  1133

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA----RAASEQARQLESE  187
             + +  + K  +  ++ +L  EL+++        +     E       +A  E+ R  E++
Sbjct  1134  RNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQ  1193

Query  188   REALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKS  247
              + ++Q+H+  V++L  Q +  + A     ++    +++ A L      L Q      K 
Sbjct  1194  VQEMRQKHTQAVEELTEQLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQ-----AKQ  1248

Query  248   SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADI  307
              V   ++K  +QL+DL+ +    E A     + + KL+ E E    ++        +   
Sbjct  1249  EVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKLQNEVESVTGMLNEAEGKAIKLAK  1308

Query  308   YKADFQAERQAREKLAEK----KELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEV  363
               A   ++ Q  ++L ++    K  +  +L QL+ E + L+    E    +   +RHV  
Sbjct  1309  DVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHVST  1368

Query  364   SQAPLPPAPAYL  375
                 L  +   L
Sbjct  1369  LNIQLSDSKKKL  1380


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 55/309 (18%), Positives = 121/309 (39%), Gaps = 23/309 (7%)

Query  98    QEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ  157
             +EA K + +L  +  D +R+ + A    + +    ++  +   S++A +  L  +L  ++
Sbjct  1641  EEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEKKAKSLEADLMQLQEDLAAAE  1700

Query  158   SRLEAATKECQALEGRARAASEQARQLESEREALQ-----------------QQHSVQVD  200
                + A  E + L     ++      L+ E+  L+                 +  S +V 
Sbjct  1701  RARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVR  1760

Query  201   QLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL---FQEYDNHIKSSVVGSERKRG  257
             +  +Q + +   L  ER  A + +    QL+    +L    QE +  +K+ +  +     
Sbjct  1761  KATLQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLQEVEGAVKAKLKSTVAALE  1820

Query  258   MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
              ++  L++Q+   E+    KQ     LK++ ++ K V+  V   +  A+ YK   +    
Sbjct  1821  AKIAQLEEQV---EQEAREKQAATKSLKQKDKKLKEVLLQVEDERKMAEQYKEQAEKGNT  1877

Query  318   AREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSS  377
               ++L  + E  +E+ + +     KL+    E+    +   R V   ++ L         
Sbjct  1878  KVKQLKRQLEEAEEESQCINANRRKLQRELDEATESNEAMGREVNALKSKLRRGNEASFV  1937

Query  378   PLALPSQRR  386
             P      RR
Sbjct  1938  PSRRAGGRR  1946


 Score = 41.4 bits (95),  Expect = 0.018, Method: Composition-based stats.
 Identities = 51/292 (17%), Positives = 110/292 (38%), Gaps = 25/292 (9%)

Query  72    LRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
             L+E  +     +    ++K  L  + +  +  +E         +  + +  +EV  LK+ 
Sbjct  1123  LQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKA  1182

Query  132   --------QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQ  183
                     + Q+ E +      V  L  +L++ +       K  Q LE      + + R 
Sbjct  1183  LDEETRSHEAQVQEMRQKHTQAVEELTEQLEQFKRAKANLDKSKQTLEKENADLAGELRV  1242

Query  184   LESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
             L   +    Q+   +  +L +Q Q +++      +A +E   K+ +LQ     +    + 
Sbjct  1243  LGQAK----QEVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKLQNEVESVTGMLNE  1298

Query  244   HIKSSVVGSERKRG----------MQLEDLKQQLQQAEEALVAKQEV---IDKLKEEAEQ  290
                 ++  ++              +  E+ +Q+L  + +    + E     D+L EE E 
Sbjct  1299  AEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEA  1358

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
              + +   V  L  Q    K   Q      E + E K+ LQ+++E L ++Y +
Sbjct  1359  KQNLERHVSTLNIQLSDSKKKLQDFASTIEVMEEGKKRLQKEMEGLSQQYEE  1410


 Score = 41.4 bits (95),  Expect = 0.019, Method: Composition-based stats.
 Identities = 47/244 (19%), Positives = 95/244 (39%), Gaps = 3/244 (1%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             +EN++   ++      L+E        +     EKE L  +   +      L  EK  L+
Sbjct  1676  KENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLE  1735

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
              +  Q   E+E  +   + M++       Q   L  EL   +S  +      Q LE + +
Sbjct  1736  ARIAQLEEELEEEQGNMEAMSDRVRKATLQAEQLSNELATERSTAQKNESARQQLERQNK  1795

Query  176   AASEQARQLESE-REALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
                 + +++E   +  L+   +    ++    + VE   R ++ A    K+K  +L+   
Sbjct  1796  ELRSKLQEVEGAVKAKLKSTVAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEVL  1855

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
              Q+  E +  +         K   +++ LK+QL++AEE          KL+ E ++    
Sbjct  1856  LQV--EDERKMAEQYKEQAEKGNTKVKQLKRQLEEAEEESQCINANRRKLQRELDEATES  1913

Query  295   METV  298
              E +
Sbjct  1914  NEAM  1917


 Score = 36.7 bits (83),  Expect = 0.52, Method: Composition-based stats.
 Identities = 48/346 (14%), Positives = 132/346 (38%), Gaps = 4/346 (1%)

Query  46    GAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVE  105
             G    L +  +E +  +  +    Q L+ +C +    +A   ++   L  + +    ++ 
Sbjct  1238  GELRVLGQAKQEVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKLQNEVESVTGMLN  1297

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
                 + + L +       +++  +   Q+    K +V  ++  L  E    Q +L+   +
Sbjct  1298  EAEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEME  1357

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
               Q LE      + Q    + +     Q  +  ++ +    + ++  +    Q   E+  
Sbjct  1358  AKQNLERHVSTLNIQLSDSKKKL----QDFASTIEVMEEGKKRLQKEMEGLSQQYEEKAA  1413

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
                +L+   ++L QE D+ +       +    ++ +  K     AEE  ++ +   ++ +
Sbjct  1414  AYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDR  1473

Query  286   EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
              EAE  +   + + + +A  +  +A  + ER  +   AE ++L+  + +  +  +   K+
Sbjct  1474  AEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKS  1533

Query  346   SCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
                   ++E+M+ +  E          A L   + + + +     +
Sbjct  1534  KRALETQMEEMKTQLEESEDDVQATEDAKLRLEVNMQALKGQFERD  1579


 Score = 36.4 bits (82),  Expect = 0.72, Method: Composition-based stats.
 Identities = 47/299 (16%), Positives = 120/299 (40%), Gaps = 22/299 (7%)

Query  74    ERCEELLHFQASQREEKEFLMCKFQEARKLVERLG--LEKLDLKRQKEQALREVEHLKRC  131
             +R ++L   +  QR    +L  +  +  +L  ++   L+    + + +    E++ +   
Sbjct  808   KRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEEEMQKITER  867

Query  132   QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES-----  186
             QQ+   +   ++ + T L  E    Q +L+A T+     E      + + ++LE      
Sbjct  868   QQKAETELKELEQKHTQLAEEKTLLQEQLQAETELYAESEEMRVRLAAKKQELEEILHEM  927

Query  187   -----EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL----  237
                  E E  +QQ   +  ++  Q   +E  L  E  A  + + +    +    +L    
Sbjct  928   EARLEEEEDRRQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDI  987

Query  238   --FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE---EALVAKQEVIDKLKEEAEQHK  292
                 + ++ +       E +      +L ++ ++A+   +     + +I +L+   ++ +
Sbjct  988   LVMDDQNSKLSKERKLLEERVSDLTTNLAEEEEKAKNLTKLKSKHESMISELEVRLKKEE  1047

Query  293   IVMETVPVLKAQADIYKADFQAERQ-AREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
                + +  LK + +   +DF  +    + ++AE K  L ++ E+LQ   ++L     + 
Sbjct  1048  KSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDEEIAQK  1106


 Score = 32.9 bits (73),  Expect = 8.5, Method: Composition-based stats.
 Identities = 64/336 (19%), Positives = 131/336 (39%), Gaps = 42/336 (13%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             +G  E +++  +   +++D  R+ +     R E     + ++++ K       Q      
Sbjct  1638  KGREEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEKKAKSLEADLMQ------  1691

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +    +R ++QA  E E L          + +++ +   L   + + +       
Sbjct  1692  --LQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEE----L  1745

Query  165   KECQ----ALEGRARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVE  210
             +E Q    A+  R R A+ QA QL +E           E+ +QQ   Q  +LR + Q VE
Sbjct  1746  EEEQGNMEAMSDRVRKATLQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLQEVE  1805

Query  211   AALRMERQAA-SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQ  269
              A++ + ++  +  + K+AQL+    Q  +E     K S+   ++K    L  ++ + + 
Sbjct  1806  GAVKAKLKSTVAALEAKIAQLEEQVEQEAREKQAATK-SLKQKDKKLKEVLLQVEDERKM  1864

Query  270   AEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL  329
             AE+     ++   K+K+   Q +   E    + A               R KL  + +  
Sbjct  1865  AEQYKEQAEKGNTKVKQLKRQLEEAEEESQCINAN--------------RRKLQRELDEA  1910

Query  330   QEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQ  365
              E  E + RE + LK+  +       +  R     +
Sbjct  1911  TESNEAMGREVNALKSKLRRGNEASFVPSRRAGGRR  1946


>sp|Q05070|Y4393_NOSS1 Uncharacterized protein alr4393 OS=Nostoc 
sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr4393 
PE=3 SV=2
Length=496

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/211 (17%), Positives = 90/211 (43%), Gaps = 16/211 (8%)

Query  145  QVTSLLGELQESQSRLEAATKECQALE-GRARAASEQARQLESEREALQQQHSVQVDQLR  203
            ++  +  +L++ + +L+ A ++   +E  R +   E       +++   Q+   + ++L+
Sbjct  77   ELEDIQKDLRQKREQLKVAEEQKTQVEIERNKVNQELETTRTDKKQVETQRDQAKKEKLK  136

Query  204  MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD------NHIKSSVVGSERKRG  257
             Q     A  + + Q       +L Q+   Y +   E          ++ +V   + +R 
Sbjct  137  AQQD--LAQTQAQYQRTQ---SRLGQVVTQYQKAIAELQSVYNQRKALQGAVEQLKTERR  191

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQ  317
                + K+ ++Q +  L  +Q+ I++   E    +  ++      +Q D    +   E  
Sbjct  192  RLYAEAKKAIEQRDRELANRQQAIEQRDRELANRQQALQQRDQKISQLDKIIQNRNLEIA  251

Query  318  AREKLAEKKE----LLQEQLEQLQREYSKLK  344
             RE++  K+E     L+ Q + L++E ++L+
Sbjct  252  QREEVIAKRESRLKELETQQDYLEQEVARLE  282


 Score = 39.4 bits (90),  Expect = 0.050, Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 71/187 (38%), Gaps = 7/187 (4%)

Query  52   QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
            Q       + +    Q +Q  +E+ +       +Q + +     +  +     ++   E 
Sbjct  111  QELETTRTDKKQVETQRDQAKKEKLKAQQDLAQTQAQYQR-TQSRLGQVVTQYQKAIAEL  169

Query  112  LDLKRQKEQALREVEHLKRCQQQ-MAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
              +  Q++     VE LK  +++  AE K +++ +   L    Q  + R        QAL
Sbjct  170  QSVYNQRKALQGAVEQLKTERRRLYAEAKKAIEQRDRELANRQQAIEQRDRELANRQQAL  229

Query  171  EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
            + R +  S+  + +++    + Q+  V   +     +S    L  ++    +E  +L + 
Sbjct  230  QQRDQKISQLDKIIQNRNLEIAQREEVIAKR-----ESRLKELETQQDYLEQEVARLEKY  284

Query  231  QVAYHQL  237
              +Y  L
Sbjct  285  YQSYRDL  291


>sp|Q9ZTZ7|KEA1_ARATH K(+) efflux antiporter 1, chloroplastic 
OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
Length=1193

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 51/313 (16%), Positives = 97/313 (31%), Gaps = 42/313 (13%)

Query  103  LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
             VE       +LK    +A++E+E  +       E    +  +  +L  E   +   +  
Sbjct  133  RVENDTDSLEELKELLHKAIKELEVARLNSTMFEEKAQRISERAIALKDEAATAWLDVNK  192

Query  163  ATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE  222
                        R    +    +   +      S+   +L++  +S+EA    +    SE
Sbjct  193  TL-------DVIRDTVYEEALAKEAVQTATMALSLAEARLQVIVESLEAGAGNDIPHVSE  245

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
            E  +   +      L    D+                +++ +  L   E  L A     D
Sbjct  246  ETEETIDVNDKEEALLAAKDD----------------IKECQVNLDNCESQLSALLSKKD  289

Query  283  KLKEEAEQHKIVMETVPV--LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREY  340
            +L++E ++     ET+ +  LKA+ D+      AE+            +  +LE  QR  
Sbjct  290  ELQKEVDKLNEFAETIQISSLKAEEDVTNIMKLAEQA-----------VAFELEATQRVN  338

Query  341  SKLKASCQESARIEDMRKRHVEVSQAPL---PPAPAYLSSPLALPSQRRSPPEEPPDFCC  397
                A  +    +   +       Q          A + S        +   E P D   
Sbjct  339  DAEIALQRAEKSLSISQTPEETQGQLSDEETSQEDAMVLSGNVEDVTHQVEKESPKDGDL  398

Query  398  PKCQ---YQAPDM  407
            P  Q      PD+
Sbjct  399  PVVQITAELVPDI  411


>sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa OX=9823 GN=MYH1 PE=2 
SV=1
Length=1939

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 54/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  878   EEKMVALMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAT  1195


 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 61/332 (18%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   +   + 
Sbjct  1283  RLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHAVQSSRH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1403  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKILAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1463  KYEETHAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1523  GGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAE  1582

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ HV V ++      A + S   
Sbjct  1583  KDEEIDQLKRNHVRVVESMQSMLDAEIRSRND  1614


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 36/266 (14%), Positives = 104/266 (39%), Gaps = 14/266 (5%)

Query  51    LQRCLEENQELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             L   L   ++L++ +    +   +L+   EEL          ++    +  +A + V+ L
Sbjct  1661  LDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLL  1720

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRL  160
               +   L   K++   ++  ++   + + ++  + + +          +  EL++ Q   
Sbjct  1721  HTQNTSLINTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTS  1780

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                 +  + LE   +    +  + E       ++   Q+ +L  + + +E  +  E++  
Sbjct  1781  AHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVRELEGEVESEQKRN  1837

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
              E  + L + +    +L  + +   K+ +   +    +Q + +K   +QAEEA       
Sbjct  1838  VETVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNVN  1896

Query  281   IDKLKEEAEQHKIVMETVPVLKAQAD  306
             + K ++   + +   E   + ++Q +
Sbjct  1897  LSKFRKLQHELEEAEERADIAESQVN  1922


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 66/374 (18%), Positives = 145/374 (39%), Gaps = 34/374 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1004  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1063

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1064  KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKIKELQARIEELE  1123

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMER---  217
                +  +A   +A        R+LE   E L++       Q+ M  +      +M R   
Sbjct  1124  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLE  1183

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERKRGMQLEDLKQQLQQAE  271
             +A  + +   A L+  +     E    I      K  +   + +  M+++DL   ++   
Sbjct  1184  EATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVS  1243

Query  272   EALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA-  323
             +A    ++        + +LK + E+ + ++  +   +A+      ++  +   ++ L  
Sbjct  1244  KAKGNLEKMCRTLEDQLSELKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVS  1303

Query  324   ----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
                       ++ E L+ QLE+  +  S L  + Q S    D+ +   E  Q        
Sbjct  1304  QLSRGKQAFTQQIEELKRQLEEEIKAKSALAHAVQSSRHDCDLLREQYEEEQEAKAELQR  1363

Query  374   YLSSPLALPSQRRS  387
              +S   +  +Q R+
Sbjct  1364  AMSKANSEVAQWRT  1377


 Score = 36.0 bits (81),  Expect = 0.81, Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 102/278 (37%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  +    +EA   +E   
Sbjct  1500  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEE  1559

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQ----QQMAED--------------K  139
                      L   K ++ R+  +   E++ LKR      + M                 K
Sbjct  1560  GKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHVRVVESMQSMLDAEIRSRNDAIRLK  1619

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               ++  +  +  +L  +      A +  +  +G  +            +E L++Q ++  
Sbjct  1620  KKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVE  1679

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1680  RRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1738

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1739  SQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKE  1776


>sp|Q66HR5|CACO1_RAT Calcium-binding and coiled-coil domain-containing 
protein 1 OS=Rattus norvegicus OX=10116 GN=Calcoco1 
PE=2 SV=1
Length=691

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 63/323 (20%), Positives = 137/323 (42%), Gaps = 25/323 (8%)

Query  59   QELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
            QEL  A+   RQ +  L E+ + L        EE++ L  +  E    +  L  +   + 
Sbjct  182  QELEAALATARQEHSELTEQYKGLSRSHGELSEERDILSQQQGEHVARILELEDDIQTMS  241

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK-------ECQ  168
             +      E++ ++   + +  ++  +  Q+     + ++S++ L+   +       E Q
Sbjct  242  DKVLMKEVELDRVRDMVKALTREQEKLLGQLKEFQADKEQSEAELQTVREENCHLNTELQ  301

Query  169  ALEGRARAASEQARQLESEREALQ------QQHSVQVDQLRMQGQSVEAALRMERQAASE  222
              +GR      Q ++L+ +   ++      QQ   +++ L+ Q + V+      +Q A+ 
Sbjct  302  EAKGRQEEQGAQVQRLKDKVAHMKDTLGQTQQKVAELEPLKEQLRGVQELAASSQQKAAL  361

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA---LVAKQE  279
               +LA    A  +   E           + R   + L   +++ Q ++E    L + + 
Sbjct  362  LGEELASAAGARDRTIAELHRSRLEVAEVNGRLAELSLHMKEEKCQWSKERTGLLQSMEA  421

Query  280  VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKKELLQE---QLEQ  335
              DK+ + + +   + +TV   ++Q+ ++K +   E+  +  +L+E K  L E    L  
Sbjct  422  EKDKILKLSAEILRLEKTVQEERSQSHMFKTELAREKDSSLVQLSESKRELTELRSALRV  481

Query  336  LQREYSKLKASCQESARIEDMRK  358
            LQ+E  +L+   QE   +E MRK
Sbjct  482  LQKEKEQLQTEKQE--LLEYMRK  502


 Score = 36.7 bits (83),  Expect = 0.42, Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 89/227 (39%), Gaps = 24/227 (11%)

Query  79   LLHFQASQREEKEFLMC-------KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
            L +     ++E+  LM        +  E R  V+ L       +++  +   + + L R 
Sbjct  149  LQNQLDESQQERNDLMQLKLQLEDQVTELRSRVQELEAALATARQEHSELTEQYKGLSRS  208

Query  132  QQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREAL  191
              +++E++  +  Q         E  +R+     + Q +  +      +  ++    +AL
Sbjct  209  HGELSEERDILSQQQG-------EHVARILELEDDIQTMSDKVLMKEVELDRVRDMVKAL  261

Query  192  QQQHSVQVDQL-RMQGQSVEAALRMERQAAS--------EEKRKLAQLQVAYHQLFQEYD  242
             ++    + QL   Q    ++   ++             +E +   + Q A  Q  ++  
Sbjct  262  TREQEKLLGQLKEFQADKEQSEAELQTVREENCHLNTELQEAKGRQEEQGAQVQRLKDKV  321

Query  243  NHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
             H+K ++  ++ ++  +LE LK+QL+  +E   + Q+    L EE  
Sbjct  322  AHMKDTLGQTQ-QKVAELEPLKEQLRGVQELAASSQQKAALLGEELA  367


 Score = 35.6 bits (80),  Expect = 1.1, Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 100/247 (40%), Gaps = 14/247 (6%)

Query  126  EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
            E +   +     D   V  + T L  +L ESQ       +    LE +      + ++LE
Sbjct  126  ELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEDQVTELRSRVQELE  185

Query  186  SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI  245
            +     +Q+HS   +Q +   +S            SEE+  L+Q Q  +     E ++ I
Sbjct  186  AALATARQEHSELTEQYKGLSRSH--------GELSEERDILSQQQGEHVARILELEDDI  237

Query  246  KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV-IDKLKEEAEQHKIVMETVPVLKAQ  304
            ++ +      + ++L+ ++  +    +AL  +QE  + +LKE     +     +  ++ +
Sbjct  238  QT-MSDKVLMKEVELDRVRDMV----KALTREQEKLLGQLKEFQADKEQSEAELQTVREE  292

Query  305  ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVS  364
                  + Q  +  +E+   + + L++++  ++    + +    E   +++  +   E++
Sbjct  293  NCHLNTELQEAKGRQEEQGAQVQRLKDKVAHMKDTLGQTQQKVAELEPLKEQLRGVQELA  352

Query  365  QAPLPPA  371
             +    A
Sbjct  353  ASSQQKA  359


>sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus OX=10090 GN=Myh6 
PE=1 SV=2
Length=1938

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 59/326 (18%), Positives = 144/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  876   EEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMN  935

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  936   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  995

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  996   KEKKALQEAHQQALDDLQAEEDKVNTLTKSKV----KLEQQVDDLEGSLEQEKKVRMDLE  1051

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA--EEALVAK-QEVI  281
             R   +L+    +L QE    +++  +  E K   +  D+ QQ  +   E+AL  + Q+ +
Sbjct  1052  RAKRKLEGDL-KLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKL  1110

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              + +   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1111  KENQARIEELEEELEAERTARAKVEKLRSDLSRE---LEEISERLEEAGGATSVQIEMNK  1167

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1168  KREAEFQKMRRDLEEATLQHEATAAA  1193


 Score = 51.4 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 50/308 (16%), Positives = 118/308 (38%), Gaps = 2/308 (1%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
                ++  E    + +E  + +  L  EK DL+ Q +     +   +    Q+ ++K  ++
Sbjct  859   GRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLE  918

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
             A+V  +   L++ +      T + + LE       +    LE     ++++     ++++
Sbjct  919   AKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVK  978

Query  204   MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL  263
                + +     +  +   E+K      Q A   L  E D    +++  S+ K   Q++DL
Sbjct  979   NLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKV--NTLTKSKVKLEQQVDDL  1036

Query  264   KQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA  323
             +  L+Q ++  +  +    KL+ + +  +  +  +   K Q +      + +   +    
Sbjct  1037  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKI  1096

Query  324   EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPS  383
             E ++ L  QL++  +E        +E    E   +  VE  ++ L      +S  L    
Sbjct  1097  EDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAG  1156

Query  384   QRRSPPEE  391
                S   E
Sbjct  1157  GATSVQIE  1164


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 117/312 (38%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1281  KLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRH  1340

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E+E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1341  DCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1400

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + LA+ + 
Sbjct  1401  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQ  1460

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+  +
Sbjct  1461  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGE  1520

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q ++ K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1521  GGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1580

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1581  KDEEMEQAKRNH  1592


 Score = 42.1 bits (97),  Expect = 0.011, Method: Composition-based stats.
 Identities = 62/341 (18%), Positives = 127/341 (37%), Gaps = 47/341 (14%)

Query  41    LPSEQGAPETLQRCLEENQ---------------------ELRDAIRQSNQILRERCEEL  79
             +  EQ     LQ+ L+ENQ                     +LR  + +  + + ER EE 
Sbjct  1096  IEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA  1155

Query  80    LHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQ-KEQALREVEHLKRCQQQMAED  138
                 + Q E  +    +FQ+ R+ +E   L+        +++    V  L      +   
Sbjct  1156  GGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRV  1215

Query  139   KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH-SV  197
             K  ++ + +    EL +  S +E   K    LE  +R   +QA +   + E  Q+     
Sbjct  1216  KQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDF  1275

Query  198   QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE----  253
                + ++Q ++ E A ++E +       +L + +++Y Q  ++    ++           
Sbjct  1276  TTQRAKLQTENGELARQLEEK--EALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAH  1333

Query  254   --RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
               +      + L++Q ++  EA    Q V+ K   E  Q +   ET  + +         
Sbjct  1334  ALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRT--------  1385

Query  312   FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR  352
                     E+L E K+ L ++L+  +     + A C    +
Sbjct  1386  --------EELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEK  1418


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 46/276 (17%), Positives = 101/276 (37%), Gaps = 24/276 (9%)

Query  75    RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQ  134
             + ++ +H     +E    +  +    +  +E L       +R ++ A +E+       Q 
Sbjct  1658  QLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQL  1717

Query  135   MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESE-------  187
             +     S+  Q   +  +L + Q+ +E A +EC+  E +A+ A   A  +  E       
Sbjct  1718  LHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDT  1777

Query  188   ---REALQQQHSVQVDQLRMQGQSVE----AALRMERQAASEEKRKLAQLQVAYHQLFQE  240
                 E +++     +  L+ +    E       + + Q      R+L     A  +   E
Sbjct  1778  SAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAE  1837

Query  241   YDNHIKSSVV---------GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE-AEQ  290
                 ++ S             ++K  M+L+DL  +LQ   +A   + E  ++       +
Sbjct  1838  SVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSK  1897

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKK  326
              + V   +   + +ADI ++     R     +  KK
Sbjct  1898  FRKVQHELDEAEERADIAESQVNKLRAKSRDIGAKK  1933


 Score = 40.2 bits (92),  Expect = 0.038, Method: Composition-based stats.
 Identities = 46/249 (18%), Positives = 106/249 (43%), Gaps = 9/249 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  +E+ +  R    Q      ER + L     S   +K+ +     + +  V
Sbjct  1684  QAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEV  1743

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E    E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1744  EEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAE  1803

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E EA Q++++  V  +R      E  ++       E+
Sbjct  1804  QIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMR----KSERRIKELTYQTEED  1859

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ---QLQQAEEALVAKQEV  280
             K+ L +LQ    +L Q      K     +E +    L   ++   +L +AEE     +  
Sbjct  1860  KKNLMRLQDLVDKL-QLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQ  1918

Query  281   IDKLKEEAE  289
             ++KL+ ++ 
Sbjct  1919  VNKLRAKSR  1927


 Score = 38.3 bits (87),  Expect = 0.18, Method: Composition-based stats.
 Identities = 44/316 (14%), Positives = 119/316 (38%), Gaps = 20/316 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              +  ++   E  EL+ A+ ++   L     ++L  Q    + K  +  K  E     E +
Sbjct  1529  EKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKD---EEM  1585

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
                K +  R  +     ++   R + +    K  ++  +  +  +L ++      A K  
Sbjct  1586  EQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHL  1645

Query  168   QALEGRARAASEQARQLESEREALQQQ----------HSVQVDQLRMQGQSVEAALRMER  217
             +  +   +    Q        + L++              ++++LR   +  E + ++  
Sbjct  1646  KNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAE  1705

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             Q   E   ++  L      L  +    ++S +   + +    +++ +   ++A++A+   
Sbjct  1706  QELIETSERVQLLHSQNTSLINQK-KKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDA  1764

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK--KELLQEQLEQ  335
                   + EE ++ +     +  +K   +    D Q      E++A K  K+ LQ+   +
Sbjct  1765  AM----MAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEAR  1820

Query  336   LQREYSKLKASCQESA  351
             ++   ++L+A  + +A
Sbjct  1821  VRELENELEAEQKRNA  1836


 Score = 37.9 bits (86),  Expect = 0.21, Method: Composition-based stats.
 Identities = 58/349 (17%), Positives = 128/349 (37%), Gaps = 19/349 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEARKLV  104
               +L++  +   +L  A R+    L+   E ++  +  + + +E L  K     +    +
Sbjct  1037  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKI  1096

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E      L L+++ ++    +E L+   +     +A V+   + L  EL+E   RLE A 
Sbjct  1097  EDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAG  1156

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                       +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1157  GATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1216

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG------MQLEDLKQQLQQAEEALVAKQ  278
             +KL + +  +     +  ++++  +               Q  + + +L++A+ +L    
Sbjct  1217  QKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFT  1276

Query  279   EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
                 KL+ E  +    +E    L +Q            + +    ++ E L+ QLE+  +
Sbjct  1277  TQRAKLQTENGELARQLEEKEALISQLT----------RGKLSYTQQMEDLKRQLEEEGK  1326

Query  339   EYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + L  + Q S    D+ +   E            LS   +  +Q R+
Sbjct  1327  AKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRT  1375


 Score = 33.7 bits (75),  Expect = 4.2, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 92/229 (40%), Gaps = 23/229 (10%)

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH---S  196
             A  + ++ ++  E    +  LE +    + LE +  +  ++   L+ + +A Q       
Sbjct  845   AETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAE  904

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ-----------------  239
              + DQL      +EA ++   +   +E+   A+L     +L                   
Sbjct  905   ERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLA  964

Query  240   --EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV-AKQEVIDKLKEEAEQHKIVME  296
               E + H   + V +  +    L+++  +L + ++AL  A Q+ +D L+ E ++   + +
Sbjct  965   KVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTK  1024

Query  297   TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             +   L+ Q D  +   + E++ R  L   K  L+  L+  Q     L+ 
Sbjct  1025  SKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLEN  1073


>sp|A4IFI1|CC157_BOVIN Coiled-coil domain-containing protein 157 
OS=Bos taurus OX=9913 GN=CCDC157 PE=2 SV=2
Length=688

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 67/370 (18%), Positives = 140/370 (38%), Gaps = 48/370 (13%)

Query  71   ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKR  130
            +LR + EE    +   R +   L    QE          E+   +RQ ++A +     +R
Sbjct  292  LLRAQLEEAEGQKDRLRMQVGELEQALQE----------EQAARQRQAQEAEQHRAQWER  341

Query  131  CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREA  190
             +QQ+  + + +K +V +L GEL++ +   +A   + Q L+  A    E  RQ++   + 
Sbjct  342  ERQQLLAETSDLKTKVATLEGELKQQRESTQAVESKAQQLQAEAEHRLEAERQVQHLEQQ  401

Query  191  LQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYD------NH  244
            + +  + ++D    Q +     L  E+       R    LQ     L Q+ D        
Sbjct  402  V-ELLAGRLDGASQQIRWASTELDKEKARVDSMVRHQESLQAKQRALLQQLDSLDQEREE  460

Query  245  IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE---EAEQHKIVMETVPVL  301
            ++ S+  +E +R    E L+    + E+A    +  I +L+    E  + + ++   P L
Sbjct  461  LRGSLDEAEAQRAHVEEQLQSVQGEREQATTDLRLTISELERELVELRERERLLVAFPDL  520

Query  302  KAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIED------  355
               A+   A  Q+     + +  + +    ++  LQ E  +L++   +   +        
Sbjct  521  HRPAE---AQIQSSGNVTDDMERQVQANDIRIRVLQEENGRLRSMLSKIREVAQQGGLKL  577

Query  356  --------MRKRHVEVSQAPL--------PPAPAYLSSPLALPSQR---RSPPEEPPDFC  396
                    +R + ++ ++ PL         P   +L       + R     P   PP   
Sbjct  578  IPEDQLWALRSKGIQGAEPPLQTARTSPGAPGRRHLPGSRPASAGRTLPGQPQASPPLRP  637

Query  397  CPKCQYQAPD  406
              +    +P+
Sbjct  638  HRRPGESSPE  647


>sp|Q8IDX6|RH2A_PLAF7 Reticulocyte-binding protein homolog 2a 
OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 
SV=1
Length=3130

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 112/251 (45%), Gaps = 17/251 (7%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             +R   E QE      +  +  +ER E+    +A +R+E+E L  + +  R+  ERL  EK
Sbjct  2706  ERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLEREK  2765

Query  112   -------LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-LLGELQESQSRLEAA  163
                     +LKRQ+++ L++ E LKR +Q+  + +  +K Q    L  E QE   + E  
Sbjct  2766  QEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEEL  2825

Query  164   TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
              ++ Q    +  A   Q ++   + E L++Q   ++++ +++    E  ++         
Sbjct  2826  KRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHIK--------S  2877

Query  224   KRKLAQLQVAYHQLFQEYDNHIK-SSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
             K +   +++   +L +E D  IK   +          L+ L+  L    ++L+ K + + 
Sbjct  2878  KLESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLKHLQNILSLKIDSLLNKNDEVI  2937

Query  283   KLKEEAEQHKI  293
             K  E   +  I
Sbjct  2938  KDNETQLKTNI  2948


 Score = 39.4 bits (90),  Expect = 0.071, Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 66/152 (43%), Gaps = 14/152 (9%)

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
               E+E LQ++  ++  +     +  +  L+ E +   +E+ +L + +    Q  +     
Sbjct  2741  RQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKE  2800

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQ  304
              +      ER       + ++QLQ+ EE    +QE + K +    Q +  ++    LK Q
Sbjct  2801  EELKRQEQERLER----EKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ  2856

Query  305   ADIYKADFQAERQAREKL--AEKKELLQEQLE  334
                       ER  R+K+  AE+++ ++ +LE
Sbjct  2857  EQ--------ERLERKKIELAEREQHIKSKLE  2880


>sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae OX=6238 
GN=myo-3 PE=3 SV=1
Length=1969

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 54/294 (18%), Positives = 124/294 (42%), Gaps = 10/294 (3%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
             LEE +  + A++   Q L +  E L    ASQ + +  LM    +A+  VE+   +    
Sbjct  1396  LEEIEAAKKALQLKVQELSDTNEGLFAKIASQEKVRHKLMQDLDDAQSDVEKAAAQVAYY  1455

Query  115   KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRA  174
             ++ + Q  + VE  K+    +A +  + +     L  +L ++++  +   +   +     
Sbjct  1456  EKHRRQFEKIVEEWKKKTDDLASELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRREN  1515

Query  175   RAASEQARQLES---EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
             ++ +++ + L     E      +    V +L ++ + ++ AL     A   E+ K+ + Q
Sbjct  1516  KSLAQEVKDLTDQLGEGGRSVAELQKIVRRLEVEKEELQKALDEAEAALEAEEAKVLRAQ  1575

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
             +   Q+  E +  I+      E  R       ++ L+  +  L A+ +  ++     ++ 
Sbjct  1576  IEVSQIRSEIEKRIQEKEEEFENTRRNH----QRALESMQATLEAETKQKEEALRIKKKL  1631

Query  292   KIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             +  +  + +    A+   AD Q   +  +K  E    LQ Q+E+ QR+  +L+ 
Sbjct  1632  ESDINDLEIALDHANRANADAQ---KTIKKYMETVRELQVQIEEEQRQKDELRE  1682


 Score = 49.1 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 66/361 (18%), Positives = 136/361 (38%), Gaps = 30/361 (8%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E +    E+ Q+L +A+ Q  +I R + E  +       EEK  L    +  +  +   
Sbjct  859   QEAMGELAEKIQKLEEAV-QRGEIARSQLETQVA---DLVEEKNALFLSLETEKANLADA  914

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
                   L + K     ++  +    + M E    +  Q      EL +++  ++      
Sbjct  915   EERNEKLNQLKATLESKLTDITGQLEDMQERHEDLTRQKKKTEQELSDTKKHVQDLELTL  974

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             +  E   ++   Q R L+ E     +  +    + + Q +S     R   +    E+ K+
Sbjct  975   RKAEQEKQSRDHQIRSLQDEMANQDESVAKLNKEKKHQEES----NRKLNEDLQSEEDKV  1030

Query  228   AQLQVAYHQL------FQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
               L+   ++L       +E  +  K S    E+ +     DLK   +  +E    KQ+V 
Sbjct  1031  NHLEKIRNKLEQQMDELEETIDREKRSRSDIEKSKRKVEGDLKVAQENIDEITKQKQDVE  1090

Query  282   DKLK--------------EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
             + LK              EE      +   +  L+A+    + + ++ER +R+K    + 
Sbjct  1091  NTLKRKEDDLHHASTKLAEEQALAAKLQRQIKELQARIAELEEELESERNSRQKADRTRN  1150

Query  328   LLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
              LQ +LE++       +     +A++E  +KR  E+++         L+   A+ S R+ 
Sbjct  1151  ELQRELEEISERLE--QQGGFSAAQLEANKKREAEIAKLRREKEEDALNHETAVSSLRKR  1208

Query  388   P  388
              
Sbjct  1209  Q  1209


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 56/299 (19%), Positives = 110/299 (37%), Gaps = 17/299 (6%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             LQR LEE Q   D+  ++ Q + +  + +    +  + + +    + Q+   L  RL  E
Sbjct  1237  LQRDLEEAQHATDSEVRARQEVEKSYKTIEVQFSELQTKADEQSRQLQDFAALKNRLNNE  1296

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               DL R  E+   +V  L R +              ++L  +L E++   E  ++E QAL
Sbjct  1297  NGDLNRTLEEMDNQVNSLHRLK--------------STLQSQLDETRRNFEEESRERQAL  1342

Query  171   EGRARAASEQ---ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
                A+    +    R+   E    +   + Q+ +L  + Q  +A    E     EE    
Sbjct  1343  AATAKNLEHENEILREHLDEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAA  1402

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
              +      Q   + +  + + +   E+ R   ++DL       E+A           ++ 
Sbjct  1403  KKALQLKVQELSDTNEGLFAKIASQEKVRHKLMQDLDDAQSDVEKAAAQVAYYEKHRRQF  1462

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +  +   +    L ++ D  + D +       K     + L E L+  +RE   L   
Sbjct  1463  EKIVEEWKKKTDDLASELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQE  1521


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 43/295 (15%), Positives = 105/295 (36%), Gaps = 22/295 (7%)

Query  55    LEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDL  114
             L E Q L   +++  + L+ R  EL     S+R  ++       E ++ +E +       
Sbjct  1107  LAEEQALAAKLQRQIKELQARIAELEEELESERNSRQKADRTRNELQRELEEISERLEQQ  1166

Query  115   ----KRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
                   Q E   +    + + +++  ED  + +  V+SL     ++ + L    +  Q L
Sbjct  1167  GGFSAAQLEANKKREAEIAKLRREKEEDALNHETAVSSLRKRQVDAVAELTEQLETLQKL  1226

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
             + +  A   + ++   E +           ++    +++E      +  A E+ R+L   
Sbjct  1227  KAKGDAERAKLQRDLEEAQHATDSEVRARQEVEKSYKTIEVQFSELQTKADEQSRQLQDF  1286

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
                 ++L  E  +  ++            LE++  Q+          Q  +D+ +   E+
Sbjct  1287  AALKNRLNNENGDLNRT------------LEEMDNQVNSLHRLKSTLQSQLDETRRNFEE  1334

Query  291   HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
                  + +       +            RE L E+ E   +   Q+ +  ++++ 
Sbjct  1335  ESRERQALAATAKNLE------HENEILREHLDEEAESKADLTRQISKLNAEIQQ  1383


 Score = 40.6 bits (93),  Expect = 0.031, Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 124/274 (45%), Gaps = 14/274 (5%)

Query  43    SEQGAPETLQRCLEENQELRDAIRQSNQI---LRERCEELLHFQASQREEKEFLMCKFQE  99
             +   A +T+++ +E  +EL+  I +  +    LRE+           + EK+ L  + + 
Sbjct  1648  ANADAQKTIKKYMETVRELQVQIEEEQRQKDELREQFLASEKRNGILQAEKDELAQQAEA  1707

Query  100   ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
             A +       + ++L+ Q      +V  L   ++++  +  +V A++  L+ EL+ +Q +
Sbjct  1708  AERARRNAEADCIELREQNNDLSNQVSSLTGWRRKLEGELLAVHAELEELVTELKNAQEQ  1767

Query  160   LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE-AALRMERQ  218
              + A+ +   L    R    Q ++     E +++   +Q+ +++++    E AAL+  ++
Sbjct  1768  GQKASADAARLAEELR----QEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKK  1823

Query  219   AASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL--QQAEEALVA  276
               ++ + ++  ++       + + +  K+      R + ++ + ++++   ++  E +  
Sbjct  1824  IIAQLEARIRAIEQELDGEQRRHQDTEKNWRKAERRVKEVEFQVIEEKKNEERLTELVDK  1883

Query  277   KQEVIDKLKEEAEQHKIV----METVPVLKAQAD  306
              Q  +   K + E+ + V    +    VL+AQ +
Sbjct  1884  LQTKLKIFKRQVEEAEEVAASNLNKYKVLQAQFE  1917


>sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus OX=10090 GN=Myh4 
PE=1 SV=1
Length=1939

 Score = 53.7 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 62/332 (19%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1283  RLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1403  DAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKVLAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1463  KYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q D  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1523  GGKHIHELEKIKKQIDQEKSELQASLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1582

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1583  KDEEIDQLKRNHLRVVESMQSTLDAEIRSRND  1614


 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 146/326 (45%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + L  + ++  ++ 
Sbjct  878   EEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAA  1195


 Score = 43.7 bits (101),  Expect = 0.003, Method: Composition-based stats.
 Identities = 68/354 (19%), Positives = 140/354 (40%), Gaps = 11/354 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1004  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1063

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1064  KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELE  1123

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                +  +A   +A        R+LE   E L++       Q+ M  +  EA  +  R+  
Sbjct  1124  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM-NKKREAEFQKMRRDL  1182

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
              E   +      A  +   +    +   +   +R +  +LE  K +L+   + L +  E 
Sbjct  1183  EEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQ-KLEKEKSELKMEIDDLASNMET  1241

Query  281   IDKLKEEAEQHKIVME-TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + K K   E+    +E  +  +K + +  +         + +L  +      QL++    
Sbjct  1242  VSKAKGNLEKMCRTLEDQLSEVKTKEEEQQRLINELSTQKARLHTESGEFSRQLDEKDAM  1301

Query  340   YSKLKASCQE-SARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
              S+L    Q  + +IE+++++  E S+A    A A  S+       R    EE 
Sbjct  1302  VSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQ  1355


 Score = 41.7 bits (96),  Expect = 0.012, Method: Composition-based stats.
 Identities = 43/294 (15%), Positives = 109/294 (37%), Gaps = 17/294 (6%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL       + L+      ++L    R++N +  E  EEL          +    
Sbjct  1655  KDTQLHLDDALRGQDDLK------EQLAMVERRANLMQAE-IEELRASLEQTERSRRVAE  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +  +A + V+ L  +   L   K++   ++  ++   + + ++  + + +       + 
Sbjct  1708  QELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAK---KAIT  1764

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
             ++    E   KE        R      + ++  +  L +   + +   + Q Q +EA +R
Sbjct  1765  DAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVR  1824

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEE  272
                     E+++     +   +  ++++  +K     +E  R     L+DL  +LQ   +
Sbjct  1825  ELENEVENEQKR----NIEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQTKVK  1880

Query  273   ALVAKQEVIDKLKE-EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK  325
             A   + E  ++       + + +   +   + +ADI ++     R    ++  K
Sbjct  1881  AYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVNKLRVKSREVHTK  1934


>sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa OX=9823 GN=MYH4 PE=2 
SV=1
Length=1937

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 59/348 (17%), Positives = 132/348 (38%), Gaps = 15/348 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              E  QR + E    +  ++  +     + +E     +     K+    + +E ++ +E  
Sbjct  1265  EEEHQRLINELSAQKARLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEE  1324

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR--------  159
                K  L    + +  + + L+   ++  E KA ++  ++    E+ + +++        
Sbjct  1325  TKAKSALAHAVQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQR  1384

Query  160   ---LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME  216
                LE A K+       A    E      +  E  +Q+   +V+ L +  +   AA    
Sbjct  1385  TEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAAL  1444

Query  217   RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEAL  274
              +      + LA+ +  Y +   E +   K S   S     ++   E+   QL+  +   
Sbjct  1445  DKKQRNFDKILAEWKHKYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKREN  1504

Query  275   VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQ  332
                Q+ I  L E+  +    +  +  +K Q +  K++ QA  E        E+ ++L+ Q
Sbjct  1505  KNLQQEISDLTEQIAEGGKHIHELEKVKKQIEQEKSELQAALEEAEASLEHEEGKILRIQ  1564

Query  333   LEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             LE  Q +    +   ++   I+ M++ H+ V ++      A + S   
Sbjct  1565  LELNQVKSEIDRKIAEKDEEIDQMKRNHIRVVESMQSTLDAEIRSRND  1612


 Score = 51.4 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 146/326 (45%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  876   EEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  935

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  936   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLT  995

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  996   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1051

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1052  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1110

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1111  KELQARTEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1167

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1168  KREAEFQKMRRDLEEATLQHEATAAA  1193


 Score = 44.8 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 69/374 (18%), Positives = 146/374 (39%), Gaps = 34/374 (9%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1002  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1061

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1062  KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKIKELQARTEELE  1121

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMER---  217
                +  +A   +A        R+LE   E L++       Q+ M  +      +M R   
Sbjct  1122  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLE  1181

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERKRGMQLEDLKQQLQQAE  271
             +A  + +   A L+  +     E    I      K  +   + +  M+++DL   ++   
Sbjct  1182  EATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMETVS  1241

Query  272   EALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA-  323
             +A    ++        + ++K + E+H+ ++  +   KA+      +F  +   +E L  
Sbjct  1242  KAKGNLEKMCRTLEDQLSEVKTKEEEHQRLINELSAQKARLQTESGEFSRQLDEKEALVS  1301

Query  324   ----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
                       ++ E L+ QLE+  +  S L  + Q S    D+ +   E  Q        
Sbjct  1302  QLSRGKQAFTQQIEELKRQLEEETKAKSALAHAVQSSRHDCDLLREQYEEEQEAKAELQR  1361

Query  374   YLSSPLALPSQRRS  387
              +S   +  +Q R+
Sbjct  1362  AMSKANSEVAQWRT  1375


 Score = 41.0 bits (94),  Expect = 0.023, Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 107/250 (43%), Gaps = 9/250 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  +
Sbjct  1684  QAEIEELRASLEQTERSRRVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEM  1743

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E +  E  + + + ++A+ +   +    ++  +  A ++    ++   +++ Q RL+ A 
Sbjct  1744  EDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAE  1803

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E E  Q+++   V  LR      E  ++       E+
Sbjct  1804  QLALKGGKKQIQKLEARVRELENEVENEQKRNVEAVKGLR----KHERRVKELTYQTEED  1859

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL---EDLKQQLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     +E +  + L     L+ +L++AEE     +  
Sbjct  1860  RKNVLRLQDLVDKL-QSKVKAYKRQAEEAEEQSNVNLSKFRKLQHELEEAEERADIAESQ  1918

Query  281   IDKLKEEAEQ  290
             ++KL+ ++ +
Sbjct  1919  VNKLRVKSRE  1928


>sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa OX=9823 GN=MYH2 PE=2 
SV=1
Length=1939

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 147/326 (45%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  878   EEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALAIQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAA  1195


 Score = 51.0 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 59/332 (18%), Positives = 119/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + +   ++ +       +     E K  L  + +    L   L   + 
Sbjct  1283  RLQTESGEFSRQLDEKEALVSQLSRGKQAYTQQIEELKRQLEEEIKAKNALAHALQSSRH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++    V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1403  AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K +         M+   E+   QL+  +      Q+ I  L E+  +
Sbjct  1463  KYEETHAELEASQKEARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1523  GGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAE  1582

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ HV V ++      A + S   
Sbjct  1583  KDEEIDQLKRNHVRVVESMQSMLDAEIRSRND  1614


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 100/255 (39%), Gaps = 5/255 (2%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1669  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLLHTQNTSLI  1728

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
               K++   ++  ++   + + ++  + + +    + +       L+        LE   +
Sbjct  1729  NTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1788

Query  176   AASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                +  + L+   +  +Q        Q+ +L  + + +E  +  E++  +E  + L + +
Sbjct  1789  NMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHE  1848

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
                 +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++   + 
Sbjct  1849  RRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNTNLSKFRKLQHEL  1907

Query  292   KIVMETVPVLKAQAD  306
             +   E   + ++Q +
Sbjct  1908  EEAEERADIAESQVN  1922


 Score = 41.0 bits (94),  Expect = 0.021, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 132/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  ++
Sbjct  1039  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKI  1098

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A 
Sbjct  1099  EDEQALAIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1158

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                 A     +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1159  GATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1218

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
             +KL + +        +  +++++            LE + + L+     L +K+E   +L
Sbjct  1219  QKLEKEKSEMKMEIDDLASNMETVSKA-----KGNLEKMCRTLEDQLSELKSKEEEQQRL  1273

Query  285   KEEAEQHKIVMETVP-VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               +    +  ++T       Q D  +A      + ++   ++ E L+ QLE+  +  + L
Sbjct  1274  INDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAYTQQIEELKRQLEEEIKAKNAL  1333

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q S    D+ +   E  Q         LS      +Q R+
Sbjct  1334  AHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRT  1377


 Score = 36.4 bits (82),  Expect = 0.68, Method: Composition-based stats.
 Identities = 40/278 (14%), Positives = 102/278 (37%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  +    +EA   +E   
Sbjct  1500  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEE  1559

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQ----QQMAED--------------K  139
                      L   K ++ R+  +   E++ LKR      + M                 K
Sbjct  1560  GKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHVRVVESMQSMLDAEIRSRNDAIRLK  1619

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               ++  +  +  +L  +      A +  +  +G  +            +E L++Q ++  
Sbjct  1620  KKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQEDLKEQLAMVE  1679

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1680  RRANLLQAEIEELRATLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1738

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    L++ +   ++A++A+     + ++LK+E
Sbjct  1739  SQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKE  1776


>sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus OX=10116 GN=Myh4 
PE=1 SV=1
Length=1939

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 62/332 (19%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1283  RLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1403  DAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSNAACAALDKKQRNFDKVLAEWKQ  1462

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1463  KYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1522

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q D  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1523  GGKHIHELEKIKKQIDQEKSELQASLEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1582

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1583  KDEEIDQLKRNHLRVVESMQSTLDAEIRSRND  1614


 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 56/326 (17%), Positives = 146/326 (45%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + L  + ++  ++ 
Sbjct  878   EEKMVALMQEKNDLQLQVQAEADGLADAEERCDQLIKTKIQLEAKIKELTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIVKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAA  1195


 Score = 44.8 bits (104),  Expect = 0.002, Method: Composition-based stats.
 Identities = 68/354 (19%), Positives = 140/354 (40%), Gaps = 11/354 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1004  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1063

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1064  KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELE  1123

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                +  +A   +A        R+LE   E L++       Q+ M  +  EA  +  R+  
Sbjct  1124  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM-NKKREAEFQKMRRDL  1182

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
              E   +      A  +   +    +   +   +R +  +LE  K +L+   + L +  E 
Sbjct  1183  EEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQ-KLEKEKSELKMEIDDLASNMET  1241

Query  281   IDKLKEEAEQHKIVME-TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + K K   E+    +E  +  +K + +  +         + +L  +      QL++    
Sbjct  1242  VSKAKGNLEKMCRTLEDQLSEVKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAM  1301

Query  340   YSKLKASCQE-SARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
              S+L    Q  + +IE+++++  E S+A    A A  S+       R    EE 
Sbjct  1302  VSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQ  1355


 Score = 41.7 bits (96),  Expect = 0.013, Method: Composition-based stats.
 Identities = 43/294 (15%), Positives = 109/294 (37%), Gaps = 17/294 (6%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL       + L+      ++L    R++N +  E  EEL          +    
Sbjct  1655  KDTQLHLDDALRGQDDLK------EQLAMVERRANLMQAE-IEELRASLEQTERSRRVAE  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +  +A + V+ L  +   L   K++   ++  ++   + + ++  + + +       + 
Sbjct  1708  QELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAK---KAIT  1764

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALR  214
             ++    E   KE        R      + ++  +  L +   + +   + Q Q +EA +R
Sbjct  1765  DAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVR  1824

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEE  272
                     E+++     +   +  ++++  +K     +E  R     L+DL  +LQ   +
Sbjct  1825  ELENEVENEQKR----NIEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQTKVK  1880

Query  273   ALVAKQEVIDKLKE-EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK  325
             A   + E  ++       + + +   +   + +ADI ++     R    ++  K
Sbjct  1881  AYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVNKLRVKSREVHTK  1934


 Score = 35.6 bits (80),  Expect = 1.1, Method: Composition-based stats.
 Identities = 58/311 (19%), Positives = 119/311 (38%), Gaps = 29/311 (9%)

Query  88    EEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVT  147
             ++KEF M   Q   +  + LG++   L+++ ++    +E L+   +     +A  + Q +
Sbjct  1085  KKKEFEMSNLQSKIEDEQALGMQ---LQKKIKELQARIEELEEEIEAERASRAKAEKQRS  1141

Query  148   SLLGELQESQSRLEAA-----------TKECQALEGRARAASEQARQLESEREALQQQHS  196
              L  EL+E   RLE A            K     +   R   E   Q E+   AL+++H+
Sbjct  1142  DLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHA  1201

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
               V +L  Q  +++      +Q   +EK +L               + + S++    + +
Sbjct  1202  DSVAELGEQIDNLQRV----KQKLEKEKSELKM-----------EIDDLASNMETVSKAK  1246

Query  257   GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER  316
             G   +  +    Q  E    ++E    + E + Q   +         Q D   A      
Sbjct  1247  GNLEKMCRTLEDQLSEVKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAMVSQLS  1306

Query  317   QAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLS  376
             + ++   ++ E L+ QLE+  +  + L  + Q +    D+ +   E  Q         +S
Sbjct  1307  RGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRAMS  1366

Query  377   SPLALPSQRRS  387
                +  +Q R+
Sbjct  1367  KANSEVAQWRT  1377


>sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus 
OX=10116 GN=Tbc1d2 PE=2 SV=1
Length=924

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 95/259 (37%), Gaps = 19/259 (7%)

Query  136  AEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLES-EREALQQQ  194
             E   +++ QV  L  EL+  +  +    K  +A +   RA+S      E  +R  L + 
Sbjct  307  QEKVVALEQQVLMLTKELKSQKELVIILHKALEAAQQEKRASSAYLAATEDRDRLELVRH  366

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
               Q+ +L  + +++E     +R+    E    A L+    Q  Q++   +       ++
Sbjct  367  KVRQIAELNQRVEALE----QDRERLVHE----AGLREQQVQALQQHVQLLMDKNQAKQQ  418

Query  255  KRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQA  314
                  + L + L Q + A     + + + +      + + + +   + Q     ++   
Sbjct  419  VICKLSQKLTEDLAQPQPADATNGDFLSQQERL----EHLKDDMEAYRTQNRFLNSEIHQ  474

Query  315  ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK-RHVEVSQAPLPPAPA  373
              +   K+AEK++ L  +   LQ    +++     S  +  +R+ +    ++    P   
Sbjct  475  VTKIWRKVAEKEKALLTKCAYLQARNCQVE-----SKYLAGLRRLQEAAGAEPGDFPELL  529

Query  374  YLSSPLALPSQRRSPPEEP  392
                  AL  +     +  
Sbjct  530  QQLVQEALQWEAGEASDSV  548


>sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus OX=9796 GN=MYH1 
PE=2 SV=1
Length=1938

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + +    + ++  ++ 
Sbjct  877   EEKMVALMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEATERAEDEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  997   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1052

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1053  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1111

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1112  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1168

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1169  KREAEFQKMRRDLEEATLQHEATAAA  1194


 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 61/332 (18%), Positives = 120/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E  E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1282  RLQTEAGEYSRQLDEKDSLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSARH  1341

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1342  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1401

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + L++ + 
Sbjct  1402  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILSEWKH  1461

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1462  KYEETHAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1521

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1522  GGKRIHELEKVKKQIEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1581

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ HV V +       A + S   
Sbjct  1582  KDEEIDQLKRNHVRVVETMQTMLDAEIRSRND  1613


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 46/277 (17%), Positives = 119/277 (43%), Gaps = 13/277 (5%)

Query  84    ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK  143
             A   +E   +  +F++ ++ + +   ++ +L+ +    ++E   L+   Q  A+  A  +
Sbjct  846   AETEKEMANMKEEFEKTKESLAKAEAKRKELEEKMVALMQEKNDLQLQVQAEADSLADAE  905

Query  144   AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
              +   L+    + +++++ AT+  +  E      + + R+LE E   L+      +D L 
Sbjct  906   ERCDQLIKTKIQLEAKIKEATERAEDEEEINAELTAKKRKLEDECSELK----KDIDDLE  961

Query  204   MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL  263
             +    VE               ++A L     +L +E     K ++  + ++    L+  
Sbjct  962   LTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKE-----KKALQEAHQQTLDDLQAE  1016

Query  264   KQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA  323
             + ++    +A    ++ +D L+   EQ K +   +   K + +    D +  +++   + 
Sbjct  1017  EDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLE---GDLKLAQESTMDIE  1073

Query  324   EKKELLQEQLEQLQREYSKLKASCQ-ESARIEDMRKR  359
               K+ L E+L++ + E S L++  + E A    ++K+
Sbjct  1074  NDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKK  1110


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 41/279 (15%), Positives = 104/279 (37%), Gaps = 18/279 (6%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL       E L+  L         + +   +L+   EEL          ++   
Sbjct  1654  KDTQLHLDDALRGQEDLKEQLA-------MVERRANLLQAEIEELRATLEQTERSRKIAE  1706

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS------  148
              +  +A + V+ L  +   L   K++   ++  L+   + + ++  + + +         
Sbjct  1707  QELLDASERVQLLHTQNTSLINTKKKLETDISQLQGEMEDIVQEAHNAEEKAKKAITDAA  1766

Query  149   -LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              +  EL++ Q       +  + LE   +    +  + E       ++   Q+ +L  + +
Sbjct  1767  MMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVR  1823

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              +E  +  E++   E  + L + +    +L  + +   K+ +   +    +Q   +K   
Sbjct  1824  DLEGEVESEQKRNVEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQ-SKVKAYK  1882

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             +QAEEA       + K ++   + +   E   + ++Q +
Sbjct  1883  RQAEEAEEQSNVNLSKFRKIQHELEEAEERADIAESQVN  1921


 Score = 37.9 bits (86),  Expect = 0.21, Method: Composition-based stats.
 Identities = 65/357 (18%), Positives = 143/357 (40%), Gaps = 33/357 (9%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + L+  LE+ ++LR  + ++ + L    +           +K+ L  K ++    +  L 
Sbjct  1035  DDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQ  1094

Query  109   LEKLD---LKRQKEQALREVEHLKRCQQQMAED----KASVKAQVTSLLGELQESQSRLE  161
              +  D   L  Q ++ ++E++      ++  E     +A  + Q + L  EL+E   RLE
Sbjct  1095  SKIEDEQALAMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLE  1154

Query  162   AA-----------TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              A            K     +   R   E   Q E+   AL+++H+  V +L  Q  +++
Sbjct  1155  EAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQ  1214

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
                   +Q   +EK ++ ++++       E  +  K ++    R    QL +LK + ++ 
Sbjct  1215  RV----KQKLEKEKSEM-KMEIDDLASNMETVSKAKGNLEKMCRTLEDQLSELKSKEEEQ  1269

Query  271   EEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQ  330
             +  +        +L+ EA ++   ++    L +Q            + ++   ++ E L+
Sbjct  1270  QRLVNDLTGQRARLQTEAGEYSRQLDEKDSLVSQLS----------RGKQAFTQQIEELK  1319

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
              QLE+  +  S L  + Q +    D+ +   E  Q         +S   +  +Q R+
Sbjct  1320  RQLEEEIKAKSALAHALQSARHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRT  1376


 Score = 34.4 bits (77),  Expect = 2.5, Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 102/278 (37%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  +    +EA   +E   
Sbjct  1499  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKVKKQIEQEKSEIQAALEEAEASLEHEE  1558

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQQQMAED------------------K  139
                      L   K ++ R+  +   E++ LKR   ++ E                   K
Sbjct  1559  GKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVETMQTMLDAEIRSRNDAIRIK  1618

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               ++  +  +  +L  +      A +  +  +G  +            +E L++Q ++  
Sbjct  1619  KKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQEDLKEQLAMVE  1678

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1679  RRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1737

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    +++     ++A++A+     + ++LK+E
Sbjct  1738  SQLQGEMEDIVQEAHNAEEKAKKAITDAAMMAEELKKE  1775


>sp|Q076A7|MYH2_CANLF Myosin-2 OS=Canis lupus familiaris OX=9615 
GN=MYH2 PE=3 SV=1
Length=1940

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  879   EEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  938

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  939   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  998

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  999   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKI----KLEQQVDDLEGSLEQEKKLRMDLE  1054

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1055  RAKRKLEGDL-KLAQESIMDIENEKQQLDEKLKKKEFEMSNLQSKIEDEQALGIQLQKKI  1113

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1114  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1170

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1171  KREAEFQKMRRDLEEATLQHEATAAT  1196


 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 60/332 (18%), Positives = 121/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + +   ++ +     L F     E K  L  + +    L   L   + 
Sbjct  1284  RLQTESGEFSRQLDEKEALVSQLSRGKLAFTQQIEELKRQLEEEIKAKNALAHALQSSRH  1343

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1344  DCDLLREQYEEEQESKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1403

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1404  AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQ  1463

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K +         M+   E+   QL+  +      Q+ I  L E+  +
Sbjct  1464  KYEETHAELEASQKEARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1523

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1524  GGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1583

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1584  KDEEIDQLKRNHIRVVESMQTMLDAEIRSRND  1615


 Score = 46.0 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 70/390 (18%), Positives = 147/390 (38%), Gaps = 48/390 (12%)

Query  46    GAPETLQRCLEENQELRDAIRQSN---QILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             G  ET+ +  +E + L++A +Q+    Q   ++   L   +    ++ + L    ++ +K
Sbjct  989   GLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKK  1048

Query  103   LVERLGLEKLDL-----------------KRQKEQALREVEHLKRCQQQMAEDKASVKAQ  145
             L   L   K  L                 K+Q ++ L++ E      Q   ED+ ++  Q
Sbjct  1049  LRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEMSNLQSKIEDEQALGIQ  1108

Query  146   VTSLLGELQESQSRLEAATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRM  204
             +   + ELQ     LE   +  +A   +A        R+LE   E L++       Q+ M
Sbjct  1109  LQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM  1168

Query  205   QGQSVEAALRMER---QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERK  255
               +      +M R   +A  + +   A L+  +     E    I      K  +   + +
Sbjct  1169  NKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSE  1228

Query  256   RGMQLEDLKQQLQQAEEALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIY  308
               M+++DL   ++   +A    ++        + +LK + E+ + ++  +   + +    
Sbjct  1229  MKMEIDDLASNVETVSKAKGNLEKMCRTLEDQVSELKSKEEEQQRLINDLTTQRGRLQTE  1288

Query  309   KADFQAERQAREKLA-----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
               +F  +   +E L            ++ E L+ QLE+  +  + L  + Q S    D+ 
Sbjct  1289  SGEFSRQLDEKEALVSQLSRGKLAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLL  1348

Query  358   KRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +   E  Q         LS   +  +Q R+
Sbjct  1349  REQYEEEQESKAELQRALSKANSEVAQWRT  1378


 Score = 43.7 bits (101),  Expect = 0.003, Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 100/255 (39%), Gaps = 5/255 (2%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1670  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLI  1729

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
               K++   ++  ++   + + ++  + + +    + +       L+        LE   +
Sbjct  1730  NTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1789

Query  176   AASEQARQLESEREALQQQH----SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                +  + L+   +  +Q        Q+ +L  + + +E  +  E++  +E  + L + +
Sbjct  1790  NMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHE  1849

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
                 +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++   + 
Sbjct  1850  RRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNTNLSKFRKLQHEL  1908

Query  292   KIVMETVPVLKAQAD  306
             +   E   + ++Q +
Sbjct  1909  EEAEERADIAESQVN  1923


 Score = 36.0 bits (81),  Expect = 0.84, Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 103/278 (37%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  +    +EA   +E   
Sbjct  1501  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEE  1560

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQQQMAE------------------DK  139
                      L   K ++ R+  +   E++ LKR   ++ E                   K
Sbjct  1561  GKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRVVESMQTMLDAEIRSRNDAIRLK  1620

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               ++  +  +  +L  +      A +  +  +G  +            +E L++Q ++  
Sbjct  1621  KKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQEDLKEQLAMVE  1680

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1681  RRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1739

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1740  SQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKE  1777


>sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus OX=10090 GN=Myh1 
PE=1 SV=1
Length=1942

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 53/326 (16%), Positives = 144/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  881   EEKMVALMQEKNDLQLQVQSEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  940

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  941   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  1000

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  1001  KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKI----KLEQQVDDLEGSLEQEKKIRMDLE  1056

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1057  RAKRKLEGDL-KLAQESTMDVENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKI  1115

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1116  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1172

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1173  KREAEFQKMRRDLEEATLQHEATAAT  1198


 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 60/332 (18%), Positives = 121/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1286  RLQTESGEYSRQLDEKDSLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRH  1345

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1346  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1405

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1406  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQ  1465

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+    L+  +      Q+ I  L E+  +
Sbjct  1466  KYEETHAELEASQKESRSLSTELFKIKNAYEESLDHLETLKRENKNLQQEISDLTEQIAE  1525

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1526  GGKRIHELEKIKKQIEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1585

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ V ++      A + S   
Sbjct  1586  KDEEIDQLKRNHIRVVESMQSTLDAEIRSRND  1617


 Score = 43.3 bits (100),  Expect = 0.004, Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 104/279 (37%), Gaps = 18/279 (6%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL       E L+  L         + +   +L+   EEL          ++   
Sbjct  1658  KDTQLHLDDALRGQEDLKEQLA-------MVERRANLLQAEIEELRATLEQTERSRKIAE  1710

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS------  148
              +  +A + V+ L  +   L   K++   ++  ++   + + ++  + + +         
Sbjct  1711  QELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAA  1770

Query  149   -LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              +  EL++ Q       +  + LE   +    +  + E       ++   Q+ +L  + +
Sbjct  1771  MMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVR  1827

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              +E  +  E++   E  + L + +    +L  + +   K+ +   +    +Q   +K   
Sbjct  1828  ELEGEVENEQKRNVEAIKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQ-SKVKAYK  1886

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             +QAEEA       + K ++   + +   E   + ++Q +
Sbjct  1887  RQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQVN  1925


 Score = 39.8 bits (91),  Expect = 0.049, Method: Composition-based stats.
 Identities = 43/279 (15%), Positives = 109/279 (39%), Gaps = 43/279 (15%)

Query  51    LQRCLEENQELRDAIRQSNQILRE---RCEELLHFQASQREEKEFLMCKFQEARKLVER-  106
             L+    EN+ L+  I    + + E   R  EL   +    +EK  L    +EA   +E  
Sbjct  1502  LETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQIEQEKSELQAALEEAEASLEHE  1561

Query  107   ----------LGLEKLDLKRQKEQALREVEHLKRCQ-QQMAEDKASVKAQV---------  146
                       L   K ++ R+  +   E++ LKR   + +   ++++ A++         
Sbjct  1562  EGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRVVESMQSTLDAEIRSRNDAIRL  1621

Query  147   -TSLLGELQESQSRLE-------AATKECQALEGRARAASEQARQLESEREALQQQHSV-  197
                + G+L E + +L         A +  +  +G  +            +E L++Q ++ 
Sbjct  1622  KKKMEGDLNEMEIQLNHSNRMAAEALRNYRNTQGILKDTQLHLDDALRGQEDLKEQLAMV  1681

Query  198   ---------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSS  248
                      ++++LR   +  E + ++  Q   +   ++  L      L       +++ 
Sbjct  1682  ERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTK-KKLETD  1740

Query  249   VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             +   + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1741  ISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKE  1779


 Score = 37.5 bits (85),  Expect = 0.30, Method: Composition-based stats.
 Identities = 58/311 (19%), Positives = 127/311 (41%), Gaps = 29/311 (9%)

Query  88    EEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVT  147
             ++KEF M   Q   +  + LG++   L+++ ++    +E L+   +     +A  + Q +
Sbjct  1088  KKKEFEMSNLQSKIEDEQALGMQ---LQKKIKELQARIEELEEEIEAERASRAKAEKQRS  1144

Query  148   SLLGELQESQSRLEAA-----------TKECQALEGRARAASEQARQLESEREALQQQHS  196
              L  EL+E   RLE A            K     +   R   E   Q E+    L+++H+
Sbjct  1145  DLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHA  1204

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
               V +L  Q  +++      +Q   +EK ++ ++++       E  +  K ++    R  
Sbjct  1205  DSVAELGEQIDNLQRV----KQKLEKEKSEM-KMEIDDLASNMEVISKSKGNLEKMCRTL  1259

Query  257   GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER  316
               Q+ +LK + ++ +  +        +L+ E+ ++   ++    L +Q            
Sbjct  1260  EDQVSELKTKEEEQQRLINELTAQRGRLQTESGEYSRQLDEKDSLVSQLS----------  1309

Query  317   QAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLS  376
             + ++   ++ E L+ QLE+  +  S L  + Q S    D+ +   E  Q         +S
Sbjct  1310  RGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMS  1369

Query  377   SPLALPSQRRS  387
                +  +Q R+
Sbjct  1370  KANSEVAQWRT  1380


>sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens 
OX=9606 GN=CIT PE=1 SV=2
Length=2027

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 60/322 (19%), Positives = 132/322 (41%), Gaps = 20/322 (6%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            EQ   E  Q   +  Q L D   QS ++   + +E        R     L      AR+ 
Sbjct  522  EQARMEVSQEDDKALQLLHDIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARR-  580

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
              R  L + +L+  +  A         CQ ++ + K   K +V     +L++  +  +  
Sbjct  581  --RSDLYESELRESRLAAEEFKRKATECQHKLLKAKDQGKPEVGE-YAKLEKINAEQQLK  637

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEA-ALRMERQAASE  222
             +E Q    +A  AS +A +L       +++   ++++L+ +  S E    ++      E
Sbjct  638  IQELQEKLEKAVKASTEATELLQNIRQAKERAERELEKLQNREDSSEGIRKKLVEAEELE  697

Query  223  EKRKLAQLQVAYHQL-FQEYDNHIKSSVVGSERKRGMQLED---LKQQLQQAEEALVAKQ  278
            EK + AQ+   + ++  ++ + H +  +   + +    L D   L+  +Q+ EE    K 
Sbjct  698  EKHREAQVSAQHLEVHLKQKEQHYEEKIKVLDNQIKKDLADKETLENMMQRHEEEAHEKG  757

Query  279  EVIDKLK----------EEAEQHKIVMETVPVLKAQADIYKA-DFQAERQAREKLAEKKE  327
            +++ + K             EQ  + +     L A + ++   + +A+ +   +L ++K 
Sbjct  758  KILSEQKAMINAMDSKIRSLEQRIVELSEANKLAANSSLFTQRNMKAQEEMISELRQQKF  817

Query  328  LLQEQLEQLQREYSKLKASCQE  349
             L+ Q  +L+ +  KL+   ++
Sbjct  818  YLETQAGKLEAQNRKLEEQLEK  839


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 59/379 (16%), Positives = 135/379 (36%), Gaps = 19/379 (5%)

Query  41    LPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEA  100
             L + + + E +++ L E +EL +  R++            H +   +++++    K +  
Sbjct  676   LQNREDSSEGIRKKLVEAEELEEKHREAQVSA-------QHLEVHLKQKEQHYEEKIKVL  728

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
                +++   +K  L+   ++   E     +   +      ++ +++ SL    ++    L
Sbjct  729   DNQIKKDLADKETLENMMQRHEEEAHEKGKILSEQKAMINAMDSKIRSL----EQRIVEL  784

Query  161   EAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
               A K         +   +   ++ SE    +     Q  +L  Q + +E  L       
Sbjct  785   SEANKLAANSSLFTQRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKISHQD  844

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
               +K +L +L+    ++  E++   K  +     +  + L++ + QL   + A  A +  
Sbjct  845   HSDKNRLLELETRLREVSLEHEEQ-KLELKRQLTELQLSLQERESQLTALQAARAALESQ  903

Query  281   IDKLK-EEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + + K E  E      E +  L A  D  +  F A R +   + +    L+EQL QL  +
Sbjct  904   LRQAKTELEETTAEAEEEIQALTAHRDEIQRKFDALRNSCTVITD----LEEQLNQLTED  959

Query  340   YSKLKASC--QESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCC  397
              ++L            E        V             +   +    +    E     C
Sbjct  960   NAELNNQNFYLSKQLDEASGANDEIVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTC  1019

Query  398   PKCQYQAPDMDTLQIHVME  416
                + Q  D++ L   ++E
Sbjct  1020  TMLEEQVMDLEALNDELLE  1038


 Score = 46.0 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 66/357 (18%), Positives = 139/357 (39%), Gaps = 35/357 (10%)

Query  39    LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQ  98
             + L S++   E L+      +E    +   N  L E+  +   +++   +EK    C+ +
Sbjct  1003  MQLTSQKQTMEALKTTCTMLEEQVMDLEALNDELLEKERQWEAWRSVLGDEKSQFECRVR  1062

Query  99    EARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQS  158
             E +++++     +    ++  ++ + VE   +            KA++ +L   L+E + 
Sbjct  1063  ELQRMLDTEKQSRARADQRITESRQVVELAVKEH----------KAEILALQQALKEQKL  1112

Query  159   RLEAATKECQALEGRARAASEQARQLESERE---ALQQQHSVQVDQLRMQGQSVEAALRM  215
             + E+ + +   LE +       AR L+ + E    L+Q+   +  +L+ Q    +  +  
Sbjct  1113  KAESLSDKLNDLEKKHAMLEMNARSLQQKLETERELKQRLLEEQAKLQQQMDLQKNHIFR  1172

Query  216   ERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
               Q   E   +   L+     L  EY       +   E+ +       + +L    +A +
Sbjct  1173  LTQGLQEALDRADLLKTERSDL--EYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKM  1230

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQ  335
              +     K K    + K      P L  Q  +    +   + A EK   +K    E  E 
Sbjct  1231  DQPAK--KKKGLFSRRKED----PALPTQVPL---QYNELKLALEK---EKARCAELEEA  1278

Query  336   LQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             LQ+   +L+++ +E+A        H + +  P P  PA     +A+ +  RSP  +P
Sbjct  1279  LQKTRIELRSAREEAA--------HRKATDHPHPSTPATARQQIAMSAIVRSPEHQP  1327


 Score = 38.3 bits (87),  Expect = 0.16, Method: Composition-based stats.
 Identities = 31/234 (13%), Positives = 101/234 (43%), Gaps = 16/234 (7%)

Query  166  ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
            +  ++E +    S++ +  + +   ++Q+ + ++ +   + ++V +   +E +A+  ++ 
Sbjct  443  KTSSMEKKLLIKSKELQDSQDKCHKMEQEMT-RLHRRVSEVEAVLSQKEVELKASETQRS  501

Query  226  KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK----QEVI  281
             L Q    Y          ++ + +   ++    L+ L    +Q+ +    K    Q  +
Sbjct  502  LLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLHDIREQSRKLQEIKEQEYQAQV  561

Query  282  DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR---  338
            ++++    Q +  + +    + ++D+Y+++ +  R A E+   K    Q +L + +    
Sbjct  562  EEMRLMMNQLEEDLVSA---RRRSDLYESELRESRLAAEEFKRKATECQHKLLKAKDQGK  618

Query  339  ----EYSKLKA-SCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
                EY+KL+  + ++  +I++++++  +  +A         +   A     R 
Sbjct  619  PEVGEYAKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQNIRQAKERAERE  672


>sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur 
macaco macaco OX=30603 GN=CTTNBP2 PE=3 SV=1
Length=1653

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/201 (20%), Positives = 84/201 (42%), Gaps = 25/201 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K+  
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKQVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E  ++LE   K+   LE    A  
Sbjct  172  ------LMLVKECKQ--------LSGKVIEEAQKLEEVMAKLEEEKKKTNELEEELSAEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLNREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQ  259
            +  D+    S+    + R   
Sbjct  271  RGSDSKPSLSLPRKTKDRRSV  291


 Score = 51.4 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 46/275 (17%), Positives = 105/275 (38%), Gaps = 35/275 (13%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            RK  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   RKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +      E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
            ++E   +       EE+ K  Q+ +                V   ++  G  +E+  Q+L
Sbjct  148  ALEQEHKKLAARLEEERGKNKQVVLML--------------VKECKQLSGKVIEE-AQKL  192

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKK  326
            ++    L  +++  ++L+EE    K     +    AQ +   ++F  ER Q R KL  ++
Sbjct  193  EEVMAKLEEEKKKTNELEEELSAEKRRSTEME---AQMEKQLSEFDTEREQLRAKLNREE  249

Query  327  EL---LQEQLEQLQREYSKLKASCQESARIEDMRK  358
                 L+E+++++++   +LK        +   RK
Sbjct  250  AHTTDLKEEIDKMKKMIEQLKRGSDSKPSLSLPRK  284


>sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens OX=9606 GN=MYH2 
PE=1 SV=1
Length=1941

 Score = 53.3 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  880   EEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  939

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  940   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  999

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  1000  KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKI----KLEQQVDDLEGSLEQEKKLRMDLE  1055

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1056  RAKRKLEGDL-KLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKI  1114

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1115  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1171

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1172  KREAEFQKMRRDLEEATLQHEATAAT  1197


 Score = 48.3 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 57/336 (17%), Positives = 120/336 (36%), Gaps = 12/336 (4%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + +   ++ +       F     E K  L  + +    L   L   + 
Sbjct  1285  RLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRH  1344

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++    V    T    +  +    LE A K+      
Sbjct  1345  DCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1404

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA      A  +++R   ++  
Sbjct  1405  AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAAC----AALDKKQRNFDKILA  1460

Query  233   AYHQLFQEYDNHIKSSVVGSERKR------GMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
              + Q  +E    +++S   +              E+   QL+  +      Q+ I  L E
Sbjct  1461  EWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTE  1520

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
             +  +    +  +  +K Q +  K + QA  E        E+ ++L+ QLE  Q +    +
Sbjct  1521  QIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDR  1580

Query  345   ASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
                ++   I+ +++ H+ + ++      A + S   
Sbjct  1581  KIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRND  1616


 Score = 42.5 bits (98),  Expect = 0.007, Method: Composition-based stats.
 Identities = 38/265 (14%), Positives = 101/265 (38%), Gaps = 13/265 (5%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   +HL     + E L+  L         + +   +L+   EEL          ++   
Sbjct  1657  KDTQIHLDDALRSQEDLKEQLA-------MVERRANLLQAEIEELRATLEQTERSRKIAE  1709

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQ  154
              +  +A + V+ L  +   L   K++   ++  ++   + + ++  + + +    + +  
Sbjct  1710  QELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAA  1769

Query  155   ESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH----SVQVDQLRMQGQSVE  210
                  L+        LE   +   +  + L+   +  +Q        Q+ +L  + + +E
Sbjct  1770  MMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELE  1829

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQ  268
               +  E++  +E  + L + +    +L  + +   K+ +   +    +Q  ++  K+Q +
Sbjct  1830  GEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAE  1889

Query  269   QAEEALVAKQEVIDKLKEEAEQHKI  293
             +AEE          KL+ E E+ + 
Sbjct  1890  EAEEQSNTNLAKFRKLQHELEEAEE  1914


 Score = 41.4 bits (95),  Expect = 0.016, Method: Composition-based stats.
 Identities = 58/333 (17%), Positives = 136/333 (41%), Gaps = 30/333 (9%)

Query  48    PETLQRCLEENQELRDAIRQSN-------QILRERCEELLHFQASQREEKEFLMCKFQEA  100
              +T QR   E ++L   + ++N       +  R   + L  ++    E    L    +EA
Sbjct  1421  EKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEA  1480

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQV--------------  146
             R L    G E   +K   E++L ++E LKR  + + ++ + +  Q+              
Sbjct  1481  RSL----GTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIK  1536

Query  147   TSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ-  205
               +  E  E Q+ LE A    +  EG+      +  Q++SE +    +   ++DQL+   
Sbjct  1537  KQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNH  1596

Query  206   ---GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
                 +S+++ L  E ++ ++  R   +++   +++  + ++  + +   + R        
Sbjct  1597  IRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMA-AEALRNYRNTQGI  1655

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
             LK      ++AL +++++ ++L     +  ++   +  L+A  +  +   +   Q     
Sbjct  1656  LKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDA  1715

Query  323   AEKKELLQEQLEQLQREYSKLKASCQESARIED  355
             +E+ +LL  Q   L     KL+    +     +
Sbjct  1716  SERVQLLHTQNTSLINTKKKLETDISQMQGEME  1748


 Score = 41.4 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 132/344 (38%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  ++
Sbjct  1041  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKI  1100

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A 
Sbjct  1101  EDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1160

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                 A     +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1161  GATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVK  1220

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
             +KL + +        +  +++++            LE + + L+     L +K+E   +L
Sbjct  1221  QKLEKEKSEMKMEIDDLASNVETVSKA-----KGNLEKMCRTLEDQLSELKSKEEEQQRL  1275

Query  285   KEEAEQHKIVMETVP-VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               +    +  ++T       Q D  +A      + ++   ++ E L+ QLE+  +  + L
Sbjct  1276  INDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNAL  1335

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q S    D+ +   E  Q         LS      +Q R+
Sbjct  1336  AHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRT  1379


 Score = 36.7 bits (83),  Expect = 0.47, Method: Composition-based stats.
 Identities = 62/365 (17%), Positives = 140/365 (38%), Gaps = 42/365 (12%)

Query  44    EQGAPETLQRCL-EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             EQ +   LQR L + N E+     +      +R EEL   +    +  +      +    
Sbjct  1356  EQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNA  1415

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                 L   K  L+ + E  + +VE        + + + +    +     + +E+ + LEA
Sbjct  1416  KCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEA  1475

Query  163   ATKECQAL-------EGRARAASEQARQLESEREALQQ-------------QHSVQVDQL  202
             + KE ++L       +     + +Q   L+ E + LQQ             +   +++++
Sbjct  1476  SQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKI  1535

Query  203   RMQGQS----VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
             + Q +     ++AAL     +   E+ K+ ++Q+  +Q+  E D  I       ++ +  
Sbjct  1536  KKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRN  1595

Query  259   QLE-------DLKQQLQQAEEAL-VAKQEVIDKLKEEAEQHKIVMETVPVLK----AQAD  306
              +         L  +++   +A+ + K+   D  + E + +         L+     Q  
Sbjct  1596  HIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGI  1655

Query  307   IYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQA  366
             +       +   R +     E L+EQL  ++R  + L+A  +E     +  +R  ++++ 
Sbjct  1656  LKDTQIHLDDALRSQ-----EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQ  1710

Query  367   PLPPA  371
              L  A
Sbjct  1711  ELLDA  1715


>sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus 
norvegicus OX=10116 GN=Rock2 PE=1 SV=2
Length=1388

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 130/320 (41%), Gaps = 15/320 (5%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            ++ Q   E+  +L+  + ++N +LR   +     + +Q E  + +       R L ++  
Sbjct  548  QSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNC  607

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
            L    L+  K +  +E  +L+   +    D+      +  L G +   +  L+       
Sbjct  608  L----LETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKTLLA  663

Query  169  ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
             +E   R   E+   LE E+  ++   + Q+  ++   +  EA  +  +   +++ +   
Sbjct  664  KVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNKIYE  723

Query  229  QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE----------DLKQQLQQAEEALVAKQ  278
             ++ A  +  +E +  +       ++   + LE          DLKQ  Q+  E L  K 
Sbjct  724  SIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLKQKD  783

Query  279  EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
             + + ++    + +   +   +++    +        + + +++ ++   L E    L++
Sbjct  784  VLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMNLEK  843

Query  339  EYSKLKASCQES-ARIEDMR  357
            + ++L+   Q++  ++++++
Sbjct  844  QNAELRKERQDADGQMKELQ  863


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 58/338 (17%), Positives = 139/338 (41%), Gaps = 30/338 (9%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
            QG    L+  L+  + L   +    + L+E+  +L   +++   +  + +   Q++    
Sbjct  645  QGRISGLEEDLKTGKTLLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQS----  700

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              L  E+ + K  K +   + +  +  ++  +E    ++ ++       Q+ ++ L  A 
Sbjct  701  --LEQEEAEHKTTKARLADKNKIYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAE  758

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS---VEAALRMERQAAS  221
            K C  L+   + + ++  +L  +++ L +       ++  + Q    ++  L+M+ Q  +
Sbjct  759  KRCSILDCDLKQSQQKLNELLKQKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVN  818

Query  222  EEKRKLAQLQVAYHQLFQEYDNHIKSSVV-GSERKRGM-QLEDLKQQLQQAEEALVAKQE  279
              K    Q++   + L +   N  K +     ER+    Q+++L+ QL+  +      + 
Sbjct  819  TLKMSEKQIKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKT  878

Query  280  VIDKLKEEAE-----------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAE----  324
             + +LKEE E           + + + +    L AQ +I      +E+ AR    E    
Sbjct  879  QVRELKEENEEKTKLCKELQQKKQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSD  938

Query  325  -KKELLQEQLEQ---LQREYSKLKASCQESARIEDMRK  358
             +KE + ++LE    + R   +L       A +E+  +
Sbjct  939  LEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNR  976


 Score = 41.4 bits (95),  Expect = 0.020, Method: Composition-based stats.
 Identities = 48/289 (17%), Positives = 116/289 (40%), Gaps = 14/289 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             I+Q N  L E    L    A  R+E++    + +E +  +E         K Q  +   E
Sbjct  827   IKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEE  886

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
              E   +  +++ + K  ++ +  SL  +L+ + ++ +       + +     A EQ   L
Sbjct  887   NEEKTKLCKELQQKKQDLQDERDSLAAQLEITLTKAD-------SEQLARSIAEEQYSDL  939

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E+   + +    + + + +    +A +     +  E  R L           +E +N 
Sbjct  940   EKEKIMKELEIKEMMARHKQELTEKDATI----ASLEETNRTLTSDVANLANEKEELNNK  995

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQ  304
             +K +     + +  ++     + Q  ++ L  +      + + A   +I+    PV +  
Sbjct  996   LKDTQEQLSKLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLA---EIMNRKEPVKRGS  1052

Query  305   ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
                 +   +  R+   +L  ++E L +Q+ + Q+E ++++A   E ++I
Sbjct  1053  DTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQI  1101


 Score = 38.3 bits (87),  Expect = 0.14, Method: Composition-based stats.
 Identities = 56/331 (17%), Positives = 128/331 (39%), Gaps = 24/331 (7%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E   + LEE    R  +  + + L      L H  A  + + +    K +     V  L 
Sbjct  478  EKTAKELEEEITFRKNVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLK  537

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ---VTSLLGELQESQSRLEAATK  165
             +  DLK++ + +    E + + Q+Q+ E  A ++ +      L     ES  +++    
Sbjct  538  DQLEDLKKRNQSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLES  597

Query  166  ECQALEGRARAASEQARQLESEREALQQQHSVQ----------VDQLRMQGQSVEAALRM  215
              + L+ +         +LE E   LQ     +          ++ L+ +   +E  L+ 
Sbjct  598  NNRDLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKT  657

Query  216  ERQAASEEKRKLAQLQVAYHQLFQEYDNH----------IKSSVVGSERKRGMQLEDLKQ  265
             +   ++ + +  QLQ     L +E  N           I+ S+   E +       L  
Sbjct  658  GKTLLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLAD  717

Query  266  QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAE  324
            + +  E    AK E + +++++  + + + + V  L  +A+   +    + +Q+++KL E
Sbjct  718  KNKIYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNE  777

Query  325  KKELLQEQLEQLQREYSKLKASCQESARIED  355
              +      E ++    K++   Q+   +++
Sbjct  778  LLKQKDVLNEDVRNLTLKIEQETQKRCLMQN  808


>sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus 
musculus OX=10090 GN=Rock2 PE=1 SV=1
Length=1388

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 130/320 (41%), Gaps = 15/320 (5%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            ++ Q   E+  +L+  + ++N +LR   +     + +Q E  + +       R L ++  
Sbjct  548  QSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNC  607

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
            L    L+  K +  +E  +L+   +    D+      +  L G +   +  L+       
Sbjct  608  L----LETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKALLA  663

Query  169  ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
             +E   R   E+   LE E+  ++   + Q+  ++   +  EA  +  +   +++ +   
Sbjct  664  KVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNKIYE  723

Query  229  QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE----------DLKQQLQQAEEALVAKQ  278
             ++ A  +  +E +  +       ++   + LE          DLKQ  Q+  E L  K 
Sbjct  724  SIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLKQKD  783

Query  279  EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
             + + ++    + +   +   +++    +        + + +++ ++   L E    L++
Sbjct  784  VLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMNLEK  843

Query  339  EYSKLKASCQES-ARIEDMR  357
            + ++L+   Q++  ++++++
Sbjct  844  QNTELRKERQDADGQMKELQ  863


 Score = 46.4 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 58/338 (17%), Positives = 139/338 (41%), Gaps = 30/338 (9%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
            QG    L+  L+  + L   +    + L+E+  +L   +++   +  + +   Q++    
Sbjct  645  QGRISGLEEDLKTGKALLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQS----  700

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
              L  E+ + K  K +   + +  +  ++  +E    ++ ++       Q+ ++ L  A 
Sbjct  701  --LEQEEAEHKTTKARLADKNKIYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAE  758

Query  165  KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS---VEAALRMERQAAS  221
            K C  L+   + + ++  +L  +++ L +       ++  + Q    ++  L+M+ Q  +
Sbjct  759  KRCSILDCDLKQSQQKLNELLKQKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVN  818

Query  222  EEKRKLAQLQVAYHQLFQEYDNHIKSSVV-GSERKRGM-QLEDLKQQLQQAEEALVAKQE  279
              K    Q++   + L +   N  K +     ER+    Q+++L+ QL+  +      + 
Sbjct  819  TLKMSEKQIKQENNHLMEMKMNLEKQNTELRKERQDADGQMKELQDQLEAEQYFSTLYKT  878

Query  280  VIDKLKEEAE-----------QHKIVMETVPVLKAQADIYKADFQAERQAREKLAE----  324
             + +LKEE E           + + + +    L AQ +I      +E+ AR    E    
Sbjct  879  QVRELKEENEEKTKLCKELQQKKQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSD  938

Query  325  -KKELLQEQLEQ---LQREYSKLKASCQESARIEDMRK  358
             +KE + ++LE    + R   +L       A +E+  +
Sbjct  939  LEKEKIMKELEIKEMMARHKQELTEKDTTIASLEETNR  976


 Score = 41.0 bits (94),  Expect = 0.020, Method: Composition-based stats.
 Identities = 57/331 (17%), Positives = 130/331 (39%), Gaps = 24/331 (7%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E   + LEE   LR ++  + + L      L H  A  + + +    K +     V  L 
Sbjct  478  EKTAKELEEEITLRKSVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLK  537

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ---VTSLLGELQESQSRLEAATK  165
             +  DLK++ + +    E + + Q+Q+ E  A ++ +      L     ES  +++    
Sbjct  538  DQLEDLKKRNQSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLES  597

Query  166  ECQALEGRARAASEQARQLESEREALQQQHSVQ----------VDQLRMQGQSVEAALRM  215
              + L+ +         +LE E   LQ     +          ++ L+ +   +E  L+ 
Sbjct  598  NNRDLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKT  657

Query  216  ERQAASEEKRKLAQLQVAYHQLFQEYDNH----------IKSSVVGSERKRGMQLEDLKQ  265
             +   ++ + +  QLQ     L +E  N           I+ S+   E +       L  
Sbjct  658  GKALLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLAD  717

Query  266  QLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAE  324
            + +  E    AK E + +++++  + + + + V  L  +A+   +    + +Q+++KL E
Sbjct  718  KNKIYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNE  777

Query  325  KKELLQEQLEQLQREYSKLKASCQESARIED  355
              +      E ++    K++   Q+   +++
Sbjct  778  LLKQKDVLNEDVRNLTLKIEQETQKRCLMQN  808


 Score = 40.2 bits (92),  Expect = 0.041, Method: Composition-based stats.
 Identities = 44/289 (15%), Positives = 115/289 (40%), Gaps = 14/289 (5%)

Query  65    IRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE  124
             I+Q N  L E    L       R+E++    + +E +  +E         K Q  +   E
Sbjct  827   IKQENNHLMEMKMNLEKQNTELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEE  886

Query  125   VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
              E   +  +++ + K  ++ +  SL  +L+ + ++ ++        E +     ++    
Sbjct  887   NEEKTKLCKELQQKKQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMK  946

Query  185   ESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNH  244
             E E + +  +H  ++ +      S+E   R      +    +  +L     +  QE  + 
Sbjct  947   ELEIKEMMARHKQELTEKDTTIASLEETNRTLTSDVANLANEKEELNNKL-KDSQEQLSK  1005

Query  245   IKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQ  304
             +K   + +   +    + L  +     +A+    E+++  ++E  +     +   V + +
Sbjct  1006  LKDEEMSAAAIKAQFEKQLLNERTLKTQAVNKLAEIMN--RKEPVKRGSDTD---VRRKE  1060

Query  305   ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARI  353
              +         R+   +L  ++E L +Q+ + Q+E ++++A   E ++I
Sbjct  1061  KE--------NRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQI  1101


>sp|P12882|MYH1_HUMAN Myosin-1 OS=Homo sapiens OX=9606 GN=MYH1 
PE=1 SV=3
Length=1939

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 54/326 (17%), Positives = 143/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  878   EEKMVTLMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +       +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKI----KLEQQVDDLEGSLEQEKKIRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++  L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSGLQSKIEDEQALGMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAT  1195


 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 60/336 (18%), Positives = 123/336 (37%), Gaps = 12/336 (4%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1283  RLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRH  1342

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1343  DCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1402

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA      A  +++R   ++  
Sbjct  1403  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAAC----AALDKKQRNFDKILA  1458

Query  233   AYHQLFQEYDNHIKSSVVGSERKR------GMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
              + Q  +E    +++S   S              E+   QL+  +      Q+ I  L E
Sbjct  1459  EWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTE  1518

Query  287   EAEQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLK  344
             +  +    +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +
Sbjct  1519  QIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDR  1578

Query  345   ASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
                ++   I+ M++ H+ + ++      A + S   
Sbjct  1579  KIAEKDEEIDQMKRNHIRIVESMQSTLDAEIRSRND  1614


 Score = 45.2 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 105/279 (38%), Gaps = 18/279 (6%)

Query  35    KPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM  94
             K   LHL     + E L+  L         + +   +L+   EEL          ++   
Sbjct  1655  KDTQLHLDDALRSQEDLKEQLA-------MVERRANLLQAEIEELRATLEQTERSRKIAE  1707

Query  95    CKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS------  148
              +  +A + V+ L  +   L   K++   ++  ++   + + ++  + + +         
Sbjct  1708  QELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAA  1767

Query  149   -LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              +  EL++ Q       +  + LE   +    +  + E       ++   Q+ +L  + +
Sbjct  1768  MMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVR  1824

Query  208   SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
              +E  +  E++   E  + L + +    +L  + +   K+ +   +    +Q + +K   
Sbjct  1825  ELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYK  1883

Query  268   QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
             +QAEEA       + K +    + +   E   + ++Q +
Sbjct  1884  RQAEEAEEQSNVNLSKFRRIQHELEEAEERADIAESQVN  1922


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 68/390 (17%), Positives = 148/390 (38%), Gaps = 48/390 (12%)

Query  46    GAPETLQRCLEENQELRDAIRQSNQILR--------------------ERCEELLHFQAS  85
             G  ET+ +  +E + L++A +Q+   L+                    +  E  L  +  
Sbjct  988   GLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKK  1047

Query  86    QREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQ  145
              R + E    K +   KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q
Sbjct  1048  IRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSGLQSKIEDEQALGMQ  1107

Query  146   VTSLLGELQESQSRLEAATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRM  204
             +   + ELQ     LE   +  +A   +A        R+LE   E L++       Q+ M
Sbjct  1108  LQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM  1167

Query  205   QGQSVEAALRMER---QAASEEKRKLAQLQVAYHQLFQEYDNHI------KSSVVGSERK  255
               +      +M R   +A  + +   A L+  +     E    I      K  +   + +
Sbjct  1168  NKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSE  1227

Query  256   RGMQLEDLKQQLQQAEEALVAKQE-------VIDKLKEEAEQHKIVMETVPVLKAQADIY  308
               M+++DL   ++   +A    ++        + ++K + E+ + ++  +   +A+    
Sbjct  1228  MKMEIDDLASNMETVSKAKGNLEKMCRALEDQLSEIKTKEEEQQRLINDLTAQRARLQTE  1287

Query  309   KADFQAERQAREKLA-----------EKKELLQEQLEQLQREYSKLKASCQESARIEDMR  357
               ++  +   ++ L            ++ E L+ QLE+  +  S L  + Q S    D+ 
Sbjct  1288  SGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCDLL  1347

Query  358   KRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +   E  Q         +S   +  +Q R+
Sbjct  1348  REQYEEEQEAKAELQRAMSKANSEVAQWRT  1377


 Score = 37.9 bits (86),  Expect = 0.21, Method: Composition-based stats.
 Identities = 63/365 (17%), Positives = 139/365 (38%), Gaps = 42/365 (12%)

Query  44    EQGAPETLQRCL-EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK  102
             EQ A   LQR + + N E+     +      +R EEL   +    +  +      +    
Sbjct  1354  EQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNA  1413

Query  103   LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
                 L   K  L+ + E  + +VE        + + + +    +     + +E+ + LEA
Sbjct  1414  KCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEA  1473

Query  163   ATKECQALEGRARAAS-------EQARQLESEREALQQ-------------QHSVQVDQL  202
             + KE ++L               +Q   L+ E + LQQ             +   +++++
Sbjct  1474  SQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKI  1533

Query  203   RMQGQS----VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGM  258
             + Q +     ++AAL     +   E+ K+ ++Q+  +Q+  E D  I       ++ +  
Sbjct  1534  KKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRN  1593

Query  259   QLE-------DLKQQLQQAEEAL-VAKQEVIDKLKEEAEQHKIVMETVPVLK----AQAD  306
              +         L  +++   +A+ + K+   D  + E + +         L+     QA 
Sbjct  1594  HIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAI  1653

Query  307   IYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQA  366
             +       +   R +     E L+EQL  ++R  + L+A  +E     +  +R  ++++ 
Sbjct  1654  LKDTQLHLDDALRSQ-----EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQ  1708

Query  367   PLPPA  371
              L  A
Sbjct  1709  ELLDA  1713


>sp|Q1LWB0|TXB1A_DANRE Tax1-binding protein 1 homolog A OS=Danio 
rerio OX=7955 GN=tax1bp1a PE=2 SV=2
Length=781

 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 58/310 (19%), Positives = 129/310 (42%), Gaps = 18/310 (6%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            + G  + L R  E  QE ++  +    + +ER +     +   +E ++ L+ + +EA+  
Sbjct  145  DDGNSDILVRVEEVQQECKELQKALRLLTQERDQLQEKQRQQNQELQKSLIEEKEEAQSR  204

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
            V +L  + L + ++      E++ L+   Q++  ++ S++ Q+ +   E +  +S + +A
Sbjct  205  VRQLEQDLLKITQKAVLKETELDCLRDKLQKVISERDSLQTQLKNERDERELYKSHVRSA  264

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
              E   L     A  +  + +E  RE    Q+  ++ +LR +  +  A   ++ Q    E
Sbjct  265  ELENTKL----SAELQMLKAVELNREVTIAQYQEELHRLRTERDTHPAETGLKEQLRQAE  320

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR-GMQLEDLKQQLQQAEEALVAKQEVID  282
            ++  A  Q A     +  D         +E  R   + E+L+  L +A+E     Q+ +D
Sbjct  321  EQLQATRQQAAMLGSELRDASGGRDRTMTELYRVRQEAEELRAHLAEAQEECRHAQDQLD  380

Query  283  KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
            ++K +  Q          + ++ +              +L ++ E L+ +L      Y +
Sbjct  381  RMKNQTSQEMGRAGGGVGVASELEA-------------ELQKEVEELKLRLNMAAEHYKE  427

Query  343  LKASCQESAR  352
                CQ   R
Sbjct  428  KYRECQRLRR  437


>sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus OX=9796 GN=MYH2 
PE=2 SV=1
Length=1937

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 53/325 (16%), Positives = 141/325 (43%), Gaps = 13/325 (4%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++   + L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  876   EEKMVSLLKEKNDLQLQVQSEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  935

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  936   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  995

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  996   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1051

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE--DLKQQLQQAEEALVAKQEVID  282
             R   +L+       +   +         E+ +  + E  +L+ +++  +   +  Q+ I 
Sbjct  1052  RAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEIGNLQSKIEDEQALGIQLQKKIK  1111

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
             +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              K
Sbjct  1112  ELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNKK  1168

Query  343   LKASCQESAR-IEDMRKRHVEVSQA  366
              +A  Q+  R +E+   +H   + A
Sbjct  1169  REAEFQKMRRDLEEATLQHEATAAA  1193


 Score = 51.4 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 60/332 (18%), Positives = 118/332 (36%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E  E    + +   ++ +       F     E K  L  + +    L   L   + 
Sbjct  1281  RLQTEAGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRH  1340

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1341  DCDLLREQYEEEQESKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1400

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + LA+ + 
Sbjct  1401  AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQ  1460

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K +         M+   E+   QL+  +      Q+ I  L E+  +
Sbjct  1461  KYEETHAELEASQKEARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1520

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1521  GGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1580

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ HV V +       A + S   
Sbjct  1581  KDEEIDQLKRNHVRVVETMQTMLDAEIRSRND  1612


 Score = 45.6 bits (106),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 36/258 (14%), Positives = 104/258 (40%), Gaps = 11/258 (4%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1667  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLI  1726

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRLEAATKECQ  168
               K++   ++  L+   + + ++  + + +          +  EL++ Q       +  +
Sbjct  1727  NTKKKLETDISQLQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1786

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              LE   +   ++  + E       ++   Q+ +L  + + +E  +  E++ ++E  + L 
Sbjct  1787  NLEQTVKDLQQRLDEAEQLALKGGKK---QIQKLEARVRELEGEVESEQKRSAEAIKGLR  1843

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             + +    +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++  
Sbjct  1844  KHERRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNTNLSKFRKLQ  1902

Query  289   EQHKIVMETVPVLKAQAD  306
              + +   E   + ++Q +
Sbjct  1903  HELEEAEERADIAESQVN  1920


 Score = 41.4 bits (95),  Expect = 0.018, Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 133/344 (39%), Gaps = 9/344 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E ++  +  +++  E L  K  E   L  ++
Sbjct  1037  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEIGNLQSKI  1096

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L+   +     +A  + Q + L  EL+E   RLE A 
Sbjct  1097  EDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1156

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                 A     +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1157  GATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1216

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
             +KL + +        +  +++++            LE + + L+     L +K+E   +L
Sbjct  1217  QKLEKEKSEMKMEIDDLASNVETVSKA-----KGNLEKMCRTLEDQVSELKSKEEEQQRL  1271

Query  285   KEEAEQHKIVMETVP-VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
               +    +  ++T       Q D  +A      + ++   ++ E L+ QLE+  +  + L
Sbjct  1272  INDLTAQRGRLQTEAGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNAL  1331

Query  344   KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + Q S    D+ +   E  Q         LS   +  +Q R+
Sbjct  1332  AHALQSSRHDCDLLREQYEEEQESKAELQRALSKANSEVAQWRT  1375


 Score = 41.0 bits (94),  Expect = 0.021, Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 107/249 (43%), Gaps = 7/249 (3%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  +
Sbjct  1684  QAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQLQGEM  1743

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E +  E  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1744  EDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQQRLDEAE  1803

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE E E+ Q++ +  +  LR      E  ++       E+
Sbjct  1804  QLALKGGKKQIQKLEARVRELEGEVESEQKRSAEAIKGLR----KHERRVKELTYQTEED  1859

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVI  281
             ++ + +LQ    +L  +  ++ + +    E+          L+ +L++AEE     +  +
Sbjct  1860  RKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLSKFRKLQHELEEAEERADIAESQV  1919

Query  282   DKLKEEAEQ  290
             +KL+ ++ +
Sbjct  1920  NKLRVKSRE  1928


 Score = 40.2 bits (92),  Expect = 0.037, Method: Composition-based stats.
 Identities = 45/301 (15%), Positives = 110/301 (37%), Gaps = 43/301 (14%)

Query  29    EESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRE---RCEELLHFQAS  85
             E   LG        + + + + L+    EN+ L+  I    + + E   R  EL   +  
Sbjct  1475  EARSLGTELFKMKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQ  1534

Query  86    QREEKEFLMCKFQEARKLVER-----------LGLEKLDLKRQKEQALREVEHLKRCQQQ  134
               +EK  L    +EA   +E            L   K ++ R+  +   E++ LKR   +
Sbjct  1535  VEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVR  1594

Query  135   MAED------------------KASVKAQVTSLLGELQESQSRLEAATKECQALEGRARA  176
             + E                   K  ++  +  +  +L  +      A +  +  +G  + 
Sbjct  1595  VVETMQTMLDAEIRSRNDAIRIKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKD  1654

Query  177   ASEQARQLESEREALQQQHSV----------QVDQLRMQGQSVEAALRMERQAASEEKRK  226
                        +E L++Q ++          ++++LR   +  E + ++  Q   +   +
Sbjct  1655  TQLHLDDALRGQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASER  1714

Query  227   LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
             +  L      L       +++ +   + +    L++ +   ++A++A+     + ++LK+
Sbjct  1715  VQLLHTQNTSLINTK-KKLETDISQLQGEMEDILQEARNAEEKAKKAITDAAMMAEELKK  1773

Query  287   E  287
             E
Sbjct  1774  E  1774


>sp|Q6AW69|CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus 
OX=10090 GN=Cgnl1 PE=1 SV=3
Length=1297

 Score = 53.3 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 62/313 (20%), Positives = 133/313 (42%), Gaps = 6/313 (2%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
            LQ+ L+   + +  I++  + +RE  EEL     SQ EE   L  + +E+   + +   E
Sbjct  622  LQQQLQLEMKNQQNIKEERERMREDLEELRVRHQSQVEETATLQRRLEESEGELRKSLEE  681

Query  111  KLDLKRQKEQALREV----EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
               +K ++EQ   E+    + L     ++   K S   +  +L+ EL +++  L+     
Sbjct  682  LFQVKMEREQHQTEIRDLQDQLSEMHDELDSTKRSEDREKGALIEELLQAKQDLQDLLIA  741

Query  167  CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
             +  E   R    +   L+   +     H  ++D+L+ Q  +   ALR   + A++    
Sbjct  742  KEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEEATKNVEV  801

Query  227  LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
            LA    +  Q   E D   K     +E+ +G ++ +L+++  Q +  +   +    + KE
Sbjct  802  LASRSNSSEQSQAEADLREKVLKEENEKLQG-RIAELERRAAQLQRQMEDVKGDEAQAKE  860

Query  287  EAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE-YSKLKA  345
               + +  ++ +      A   + +    R+A EK  E+      Q+ Q Q+E   KL+ 
Sbjct  861  TLRKCESEVQQLEEALVHARKEEKEATCARRALEKELEQARRELSQVSQEQKELLEKLRD  920

Query  346  SCQESARIEDMRK  358
              ++  ++  ++ 
Sbjct  921  EAEQKEQLRKLKN  933


 Score = 50.6 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 59/304 (19%), Positives = 125/304 (41%), Gaps = 13/304 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L +  ++ Q+L  A  +   +LR+R  EL   + + +EE   +    QE  KL E+  
Sbjct  726   EELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEE---VSSHDQEMDKLKEQYD  782

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E   L+   E+A + VE L        + +A    +   L  E ++ Q R+    +   
Sbjct  783   AELQALRESVEEATKNVEVLASRSNSSEQSQAEADLREKVLKEENEKLQGRIAELERRAA  842

Query  169   ALEGRARAASEQARQLES---EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
              L+ +         Q +    + E+  QQ    +   R + +    A R   +   + +R
Sbjct  843   QLQRQMEDVKGDEAQAKETLRKCESEVQQLEEALVHARKEEKEATCARRALEKELEQARR  902

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ-----LEDLKQQLQQ--AEEALVAKQ  278
             +L+Q+     +L ++  +  +      + K  M+     L+   ++LQ+  A+ A  ++ 
Sbjct  903   ELSQVSQEQKELLEKLRDEAEQKEQLRKLKNEMESERWHLDKTIEKLQKEMADIAEASRT  962

Query  279   EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
               ++  K+  E  +     +  ++ Q      + +  R A  K+ ++  L +E+L+  QR
Sbjct  963   SSLELQKQLGEYKEKNRRELAEMQTQLKEKCLEVEKARLAASKMQDELRLKEEELQDYQR  1022

Query  339   EYSK  342
                +
Sbjct  1023  AEEE  1026


 Score = 49.8 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 54/329 (16%), Positives = 129/329 (39%), Gaps = 15/329 (5%)

Query  44    EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
             E  A ETL++C  E Q+L +A+  + +  +E        +    + +  L    QE ++L
Sbjct  855   EAQAKETLRKCESEVQQLEEALVHARKEEKEATCARRALEKELEQARRELSQVSQEQKEL  914

Query  104   VERL---GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL  160
             +E+L     +K  L++ K +   E  HL +  +++ ++ A +     +   ELQ+     
Sbjct  915   LEKLRDEAEQKEQLRKLKNEMESERWHLDKTIEKLQKEMADIAEASRTSSLELQKQLGEY  974

Query  161   EAATKECQALEGRARAASEQARQLESEREAL-QQQHSVQVDQLRMQGQSVEAALRMERQA  219
             +   K  + L        E+  ++E  R A  + Q  +++ +  +Q         + ++ 
Sbjct  975   KE--KNRRELAEMQTQLKEKCLEVEKARLAASKMQDELRLKEEELQDYQRAEEEALTKRQ  1032

Query  220   ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
               E+  K  + ++      ++  + +   +     +  ++LE+ +       E +   +E
Sbjct  1033  LLEQSLKDLEYELEAKSHLKDDRSRLIKQMEDKVSQLEIELEEERTNADLLSERITWSRE  1092

Query  280   VIDKLKEE-----AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
              +++++ E     A +  +  + + + +   D+       E   R      KE L  Q+E
Sbjct  1093  QMEQMRSELLQEKAAKQDLECDKISLERQNKDLKSRIIHLEGSYR----SSKEGLVVQME  1148

Query  335   QLQREYSKLKASCQESARIEDMRKRHVEV  363
                 E      + +       +  R +E 
Sbjct  1149  ARIAELEDRLENEERDRANLQLSNRRLER  1177


 Score = 46.8 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 47/296 (16%), Positives = 129/296 (44%), Gaps = 13/296 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             +T+++  +E  ++ +A R S+  L++   +L  ++   R E   +  + +E    VE+  
Sbjct  944   KTIEKLQKEMADIAEASRTSSLELQK---QLGEYKEKNRRELAEMQTQLKEKCLEVEKAR  1000

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             L    ++ +      E++  +R +++    +  ++  +  L  EL+      +  ++  +
Sbjct  1001  LAASKMQDELRLKEEELQDYQRAEEEALTKRQLLEQSLKDLEYELEAKSHLKDDRSRLIK  1060

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              +E +      +  +  +  + L ++ +      R Q + + + L  E+ A  + +    
Sbjct  1061  QMEDKVSQLEIELEEERTNADLLSERITWS----REQMEQMRSELLQEKAAKQDLECDKI  1116

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE----DLKQQLQQAEEALVAKQEVIDKL  284
              L+   ++  +    H++ S   S+    +Q+E    +L+ +L+  E      Q    +L
Sbjct  1117  SLE-RQNKDLKSRIIHLEGSYRSSKEGLVVQMEARIAELEDRLENEERDRANLQLSNRRL  1175

Query  285   KEEAEQHKIVMETVPV-LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + + ++  + ++   + L  Q D      +A ++  E+  E+ + L+   ++LQRE
Sbjct  1176  ERKVKELVMQVDDEHLSLTDQKDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRE  1231


 Score = 46.0 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 43/258 (17%), Positives = 101/258 (39%), Gaps = 11/258 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + L+  +EE  +  + +   +    +   E    +   +EE E L  +  E  +   +L 
Sbjct  786   QALRESVEEATKNVEVLASRSNSSEQSQAEADLREKVLKEENEKLQGRIAELERRAAQLQ  845

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRLE  161
              +  D+K  + QA   +   +   QQ+ E     + +          L  EL++++  L 
Sbjct  846   RQMEDVKGDEAQAKETLRKCESEVQQLEEALVHARKEEKEATCARRALEKELEQARRELS  905

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAAS  221
               ++E + L  + R  +EQ  QL   +  ++ +       +    + +       R ++ 
Sbjct  906   QVSQEQKELLEKLRDEAEQKEQLRKLKNEMESERWHLDKTIEKLQKEMADIAEASRTSSL  965

Query  222   EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             E +++L + +    +   E    +K   +  E+ R +    ++ +L+  EE L   Q   
Sbjct  966   ELQKQLGEYKEKNRRELAEMQTQLKEKCLEVEKAR-LAASKMQDELRLKEEELQDYQRAE  1024

Query  282   DKL---KEEAEQHKIVME  296
             ++    ++  EQ    +E
Sbjct  1025  EEALTKRQLLEQSLKDLE  1042


 Score = 45.6 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 53/254 (21%), Positives = 109/254 (43%), Gaps = 14/254 (6%)

Query  48   PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
             E  Q  +E  Q   + IR     L E  +EL   + S+  EK  L+ +  +A++ ++ L
Sbjct  680  EELFQVKMEREQHQTE-IRDLQDQLSEMHDELDSTKRSEDREKGALIEELLQAKQDLQDL  738

Query  108  GLEKLDLKRQKEQALREV--------EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSR  159
             + K + +    +  RE+        E +    Q+M + K    A++ +L   ++E+   
Sbjct  739  LIAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALRESVEEATKN  798

Query  160  LEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQA  219
            +E       + E     A  + + L+ E E L Q    ++++   Q Q     ++ +   
Sbjct  799  VEVLASRSNSSEQSQAEADLREKVLKEENEKL-QGRIAELERRAAQLQRQMEDVKGDEAQ  857

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
            A E  RK      +  Q  +E   H +     +   R    ++L+Q  ++  +    ++E
Sbjct  858  AKETLRKC----ESEVQQLEEALVHARKEEKEATCARRALEKELEQARRELSQVSQEQKE  913

Query  280  VIDKLKEEAEQHKI  293
            +++KL++EAEQ + 
Sbjct  914  LLEKLRDEAEQKEQ  927


>sp|Q9Z136|TSC1_RAT Hamartin OS=Rattus norvegicus OX=10116 GN=Tsc1 
PE=1 SV=1
Length=1163

 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 61/315 (19%), Positives = 124/315 (39%), Gaps = 36/315 (11%)

Query  7    KSQLCEMVQPSGGPAADQDVLGEESPLGKP---AMLHLPSEQ-------GAPETLQRCLE  56
            K    E   PS  P    D L E+         + L LPS+        G+P +     +
Sbjct  632  KGNPEEDCVPSTSPMEVLDRLLEQGAGAHSKELSRLSLPSKSVDWTHFGGSPPS-----D  686

Query  57   ENQELRDAIRQSNQILR-ERCEELLHFQASQREEKEFLMCKFQEARK--LVERLGLEKLD  113
            E + LRD +   +  L  ER +   H   ++R  ++ +     E     + ++L L++ D
Sbjct  687  EIRTLRDQLLLLHNQLLYERFKRQQHALRNRRLLRKVIRAAALEEHNAAMKDQLKLQEKD  746

Query  114  LKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL-------GELQESQSRLEAATKE  166
            ++  K    +E     + QQQ       + +Q+  L         + QE Q++LE     
Sbjct  747  IQMWKVSLQKEQARYSQLQQQRDTMVTQLHSQIRQLQHDREEFYNQSQELQTKLEDCRSM  806

Query  167  CQALEGRARAASEQARQLE----------SEREALQQQHSVQVDQLRMQGQSVEAALRME  216
               L    + A+ +    E          S  E++QQQ      QL + G+  E  L   
Sbjct  807  IAELRVELKKANSKVCHTELLLSQVSQKLSNSESVQQQMEFLNRQLLVLGEVNELYLEQL  866

Query  217  RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVA  276
            +    +  +++  ++ AY +  ++  +H+       +  +   L +L+  L + +  L+ 
Sbjct  867  QSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQRLDASQRRVL-ELESLLAKKDHLLLE  925

Query  277  KQEVIDKLKEEAEQH  291
            +++ ++ +K +A   
Sbjct  926  QKKYLEDVKSQASGQ  940


>sp|Q076A5|MYH4_CANLF Myosin-4 OS=Canis lupus familiaris OX=9615 
GN=MYH4 PE=3 SV=1
Length=1939

 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 65/334 (19%), Positives = 123/334 (37%), Gaps = 14/334 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
               R L+E + L   + +  Q   ++ EEL      + + K  L    Q AR         
Sbjct  1291  FSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARH--------  1342

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+    
Sbjct  1343  --DCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR  1400

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                A    E      S  E  +Q+   +V+ L +  +   AA     +      + LA+ 
Sbjct  1401  LQEAEEHVEAVNSKCSSLEKTKQRLQSEVEDLMIDVERSNAACAALDKKQRNFDKVLAEW  1460

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E +   K +   S     ++   E+    L+  +      Q+ I  L E+ 
Sbjct  1461  KQKYEETQAELEASQKEARALSTELFKVKNAYEESLDHLETLKRENKNLQQEISDLTEQI  1520

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  +K Q D  K++ QA  E        E+ ++L+ QLE  Q +    +  
Sbjct  1521  AEGGKHIHELEKVKKQIDQEKSELQAALEEAEGSLEHEEGKILRIQLELNQVKSEIDRKI  1580

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              ++   I+ +++ H+ V ++      A + S   
Sbjct  1581  AEKDEEIDQLKRNHLRVVESMQSTLDAEIRSRND  1614


 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 53/326 (16%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   ++E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  878   EEKMVALMQEKNDLQLQVQSEADGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  937

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  938   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  997

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  998   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1053

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1054  RAKRKLEGDL-KLAQESTMDVENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1112

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1113  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1169

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   +  
Sbjct  1170  KREAEFQKMRRDLEEATLQHEATAAT  1195


 Score = 45.6 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 67/354 (19%), Positives = 140/354 (40%), Gaps = 11/354 (3%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLM------CKFQEAR  101
              E  Q+ L++ Q   D +    +   +  +++   + S  +EK+  M       K +   
Sbjct  1004  QEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDL  1063

Query  102   KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
             KL +   ++  + K+Q ++ L++ E      Q   ED+ ++  Q+   + ELQ     LE
Sbjct  1064  KLAQESTMDVENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKIKELQARIEELE  1123

Query  162   AATKECQALEGRARAASEQA-RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA  220
                +  +A   +A        R+LE   E L++       Q+ M  +  EA  +  R+  
Sbjct  1124  EEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEM-NKKREAEFQKMRRDL  1182

Query  221   SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV  280
              E   +         +   +    +   +   +R +  +LE  K +L+   + L +  E 
Sbjct  1183  EEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQ-KLEKEKSELKMEIDDLASNMET  1241

Query  281   IDKLKEEAEQHKIVME-TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + K K   E+    +E  +  +K + +  +         + +L  +      QL++ +  
Sbjct  1242  VSKAKGNLEKTCRTLEDQLSEVKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKEAL  1301

Query  340   YSKLKASCQE-SARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
              S+L    Q  + +IE+++++  E S+A    A A  S+       R    EE 
Sbjct  1302  VSQLSRGKQAFTQQIEELKRQLEEESKAKNALAHALQSARHDCDLLREQYEEEQ  1355


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 98/248 (40%), Gaps = 12/248 (5%)

Query  66    RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREV  125
             R++N +  E  EEL          ++    +  +A + V+ L  +   L   K++   ++
Sbjct  1680  RRANLMQAET-EELRALLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTKKKLETDI  1738

Query  126   EHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRLEAATKECQALEGRARAAS  178
               ++   + + ++  + + +          +  EL++ Q       +  + LE   +   
Sbjct  1739  SQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQ  1798

Query  179   EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
              +  + E       ++   Q+ +L  + + +E  +  E++   E  + L + +    +L 
Sbjct  1799  HRLDEAEQLALKGGKK---QIQKLEARVRELENEVENEQKRNVEAVKGLRKHERRVKELT  1855

Query  239   QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
              + +   K+ +   +    +Q + +K   +QAEEA       + K ++   + +   E  
Sbjct  1856  YQTEEDRKNVLRLQDLVDKLQTK-VKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERA  1914

Query  299   PVLKAQAD  306
              + ++Q +
Sbjct  1915  DIAESQVN  1922


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 46/250 (18%), Positives = 107/250 (43%), Gaps = 9/250 (4%)

Query  45    QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             Q   E L+  LE+ +  R    Q      ER + L     S    K+ L     + +  +
Sbjct  1686  QAETEELRALLEQTERSRKVAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEM  1745

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E +  E  + + + ++A+ +   +    ++  +  A ++    +L   +++ Q RL+ A 
Sbjct  1746  EDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAE  1805

Query  165   K-ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +   +  + + +    + R+LE+E E  Q+++   V  LR      E  ++       E+
Sbjct  1806  QLALKGGKKQIQKLEARVRELENEVENEQKRNVEAVKGLR----KHERRVKELTYQTEED  1861

Query  224   KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL---EDLKQQLQQAEEALVAKQEV  280
             ++ + +LQ    +L Q      K     +E +  + L     ++ +L++AEE     +  
Sbjct  1862  RKNVLRLQDLVDKL-QTKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIAESQ  1920

Query  281   IDKLKEEAEQ  290
             ++KL+ ++ +
Sbjct  1921  VNKLRVKSRE  1930


 Score = 36.7 bits (83),  Expect = 0.49, Method: Composition-based stats.
 Identities = 60/353 (17%), Positives = 137/353 (39%), Gaps = 25/353 (7%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + L+  LE+ ++LR  + ++ + L    +           +K+ L  K ++    +  L 
Sbjct  1036  DDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDVENDKQQLDEKLKKKEFEMSNLQ  1095

Query  109   LEKLD---LKRQKEQALREVEHLKRCQQQMAED----KASVKAQVTSLLGELQESQSRLE  161
              +  D   L  Q ++ ++E++      ++  E     +A  + Q + L  EL+E   RLE
Sbjct  1096  SKIEDEQALAMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLE  1155

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME-----  216
              A     A     +    + +++  + E    QH      LR +     A L  +     
Sbjct  1156  EAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQ  1215

Query  217   --RQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEAL  274
               +Q   +EK +L ++++       E  +  K ++  + R    QL ++K + ++ +  +
Sbjct  1216  RVKQKLEKEKSEL-KMEIDDLASNMETVSKAKGNLEKTCRTLEDQLSEVKTKEEEQQRLI  1274

Query  275   VAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLE  334
                     +L  E+ +    ++    L +Q            + ++   ++ E L+ QLE
Sbjct  1275  NELSAQKARLHTESGEFSRQLDEKEALVSQLS----------RGKQAFTQQIEELKRQLE  1324

Query  335   QLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +  +  + L  + Q +    D+ +   E  Q         +S   +  +Q R+
Sbjct  1325  EESKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRT  1377


>sp|Q54G21|FKBP5_DICDI FK506-binding protein 5 OS=Dictyostelium 
discoideum OX=44689 GN=fkbp5 PE=1 SV=1
Length=1622

 Score = 52.9 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 52/282 (18%), Positives = 114/282 (40%), Gaps = 42/282 (15%)

Query  37   AMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQ---ASQREEKEFL  93
            A LH  +EQ   E  +     N+ + D + Q    +R +  +L   +        +K+ L
Sbjct  640  ATLHKKNEQFLEENTKMMESRNEAITDNVAQ----MRRQIIDLQKQKTLVEDDLADKQML  695

Query  94   MCKFQEARKLV----ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVK------  143
              K Q     +      L  E    K + ++++++ E LK+ ++  A    + K      
Sbjct  696  HTKSQSVINQLKRDYNTLQEELNSAKEENQKSIQDQEALKQAEKDYALKIRAFKKSLLDE  755

Query  144  --------AQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH  195
                     ++ SL  EL+++Q  L  A K          +  E  ++L+ +   +++++
Sbjct  756  KNARKSDIEKINSLEDELKDAQDSLTQAEK----------SNEESLKRLKLDMVRIKKRN  805

Query  196  SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF-------QEYDNHIKSS  248
              +V QL ++  +++  L  ER A S  +  +   ++     F       +E     + S
Sbjct  806  DDKVSQLTLEITTLKDTLETERSALSSVQTLVENTRLETESKFNLLLIKKEEAIAAAELS  865

Query  249  VVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
            +   + K    ++   QQ+ Q ++ +   ++ +D  KEE  +
Sbjct  866  LSEEQSKYNKLVQSNNQQIDQLQKLIDDAKKKLDHEKEEVIK  907


>sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus 
OX=10090 GN=Kif15 PE=1 SV=1
Length=1387

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 56/288 (19%), Positives = 118/288 (41%), Gaps = 10/288 (3%)

Query  59    QELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
             ++L  A  Q N +L E  ++      S +EE        QE +  + +   E    K + 
Sbjct  1063  EDLAHATEQLN-MLTEASKKHSGLLQSAQEELTRKEALIQELQHKLNQEKEEVEQKKNEF  1121

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                +R++EH+     +  +   +       L   L+  +  +E       +L+      +
Sbjct  1122  SLKMRQLEHVMGSATEYPQSPKTPPHFQAHLAKLLETQEQEIEDGRASKTSLQHLVTKLN  1181

Query  179   EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY---H  235
             E      +E   ++ Q   +++ LR++ Q +     + ++   + KR+      ++    
Sbjct  1182  EDREVKNAEILRMKDQLC-EMENLRLESQQLREKNWLLQRQLDDVKRQQESGDQSHPDSQ  1240

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
             QL  E++  IK  +  ++    M    +K  L++ + AL +K++   ++ EE E+ + + 
Sbjct  1241  QLKNEHEEIIKERLAKNKLIEEML--KMKTNLEEVQSALHSKEKACHRMSEEIERTRTLE  1298

Query  296   ETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL  343
                   K Q      +   E   RE+   + E+L++QLE L  E  KL
Sbjct  1299  SRAFQEKEQLRSKLEEMYEE---RERTFLEMEMLKKQLEFLAEENGKL  1343


 Score = 44.4 bits (103),  Expect = 0.002, Method: Composition-based stats.
 Identities = 50/316 (16%), Positives = 126/316 (40%), Gaps = 18/316 (6%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQRE---EKEFLMCKFQEARKLVE  105
             E  ++ L+  Q +      S Q+      E   +   Q+E   +   L  + Q+A+   E
Sbjct  735   EEERKNLKLQQNVDKLEHHSTQMQELFSSERSDWTKQQQEHVTQLSDLEKQLQDAQTKNE  794

Query  106   RLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATK  165
              L  E  DL+     A +E+  +K    + +  K + + +++ L     + Q +L+ A  
Sbjct  795   FLKCEVHDLRIVLNSADKELSLVKL---EYSTFKENHEKELSQLSERHVQVQLQLDNARL  851

Query  166   ECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKR  225
             E + L        +    L+   +    Q S  +   + + +++++ L    +    EK 
Sbjct  852   ENEKLLESQACLQDSYDNLQEVMKFEIDQLSKNLQNCKQENETLKSDLHNLVELFEAEKE  911

Query  226   KLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
             +        ++L  +++   ++S     +      ++ ++++ + E+ +      I KL+
Sbjct  912   R-------NNKLSLQFEEDKENSSKEILKVLETVRQEKQKEMAKCEKQMA----KIQKLE  960

Query  286   EEAEQHKIVMETVPVLK-AQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
             E     + V+ ++   + +  ++        ++ R  + EK E +    ++LQ    K  
Sbjct  961   ESLLATENVISSLEKSRESDKELVTNLMNQIQELRISIGEKSETIATLKQELQDINCKYN  1020

Query  345   ASCQESARIEDMRKRH  360
             AS  +    +++ +R 
Sbjct  1021  ASLADKEESKELIRRQ  1036


 Score = 41.0 bits (94),  Expect = 0.022, Method: Composition-based stats.
 Identities = 70/364 (19%), Positives = 137/364 (38%), Gaps = 30/364 (8%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEE--------LLHFQASQREEKEFLMCKFQEA  100
             ETL+  L    EL +A ++ N  L  + EE        +L    + R+EK+  M K ++ 
Sbjct  893   ETLKSDLHNLVELFEAEKERNNKLSLQFEEDKENSSKEILKVLETVRQEKQKEMAKCEKQ  952

Query  101   RKLVERLGLEKLDLKRQKEQALR----EVEHLKRCQQQMAEDKASVKAQ---VTSLLGEL  153
                +++L    L  +       +    + E +     Q+ E + S+  +   + +L  EL
Sbjct  953   MAKIQKLEESLLATENVISSLEKSRESDKELVTNLMNQIQELRISIGEKSETIATLKQEL  1012

Query  154   QESQSRLEAATKECQALEGRARAASEQARQLES-----------EREALQQQHSVQVDQL  202
             Q+   +  A+  + +  +   R       +L+            ER+ L +  +   +QL
Sbjct  1013  QDINCKYNASLADKEESKELIRRQEVDILELKETLRLRILSEDIERDMLCEDLAHATEQL  1072

Query  203   RMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
              M  ++ +    + + A  E  RK A +Q   H+L QE +   +     S + R  QLE 
Sbjct  1073  NMLTEASKKHSGLLQSAQEELTRKEALIQELQHKLNQEKEEVEQKKNEFSLKMR--QLEH  1130

Query  263   LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQARE-K  321
             +     +  ++          L +  E  +  +E     K            +R+ +  +
Sbjct  1131  VMGSATEYPQSPKTPPHFQAHLAKLLETQEQEIEDGRASKTSLQHLVTKLNEDREVKNAE  1190

Query  322   LAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLAL  381
             +   K+ L E +E L+ E  +L+       R  D  KR  E      P +    +    +
Sbjct  1191  ILRMKDQLCE-MENLRLESQQLREKNWLLQRQLDDVKRQQESGDQSHPDSQQLKNEHEEI  1249

Query  382   PSQR  385
               +R
Sbjct  1250  IKER  1253


>sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis 
nebulosa OX=61452 GN=CTTNBP2 PE=3 SV=1
Length=1658

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 83/201 (41%), Gaps = 25/201 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQAVEQEHQKLAARLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E   +LE    +  ALE    A  
Sbjct  172  ------LMLVKECKQ--------LSGKVIEEAQKLEEVMVKLEEEKTKTSALEEELSAEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQ  259
            +  D+    S+    + R M 
Sbjct  271  RGNDSKPSLSLPRKTKDRRMV  291


 Score = 47.9 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/255 (15%), Positives = 94/255 (37%), Gaps = 20/255 (8%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            +K  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +      E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
            +VE   +       EE+ K   + +   +  ++    +       E    ++LE+ K + 
Sbjct  148  AVEQEHQKLAARLEEERGKNKHVVLMLVKECKQLSGKVIEEAQKLEEV-MVKLEEEKTKT  206

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
               EE L A++    +++ + E+     +T      + +  +A    E      L E+ +
Sbjct  207  SALEEELSAEKRRSTEMEAQMEKQLSEFDT------EREQLRAKLHREEAHTTDLKEEID  260

Query  328  LLQEQLEQLQREYSK  342
             +++ +EQL+R    
Sbjct  261  KMKKMIEQLKRGNDS  275


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 90/237 (38%), Gaps = 15/237 (6%)

Query  79   LLHFQASQREEKEFLMCKFQEARKLV---ERLGLEKLDLKRQKEQALREVEHLKRCQQQM  135
            LL     + E ++ ++   +  RK V   ER G   L+      Q   E     + ++ +
Sbjct  44   LLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLALQRDYEAGAGDKEKKPV  103

Query  136  AEDKASVKAQVTSLLGELQE-SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ  194
              +  S+   V +   ++QE   ++L AA    + LE          ++ +     L+++
Sbjct  104  CTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQAVEQEHQKLAARLEEE  163

Query  195  HSVQ---VDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVG  251
                   V  L  + + +   +  E Q   E   KL + +       +E  +  K     
Sbjct  164  RGKNKHVVLMLVKECKQLSGKVIEEAQKLEEVMVKLEE-EKTKTSALEEELSAEKRRSTE  222

Query  252  SERKRGMQL-------EDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVL  301
             E +   QL       E L+ +L + E      +E IDK+K+  EQ K   ++ P L
Sbjct  223  MEAQMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLKRGNDSKPSL  279


>sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 
PE=1 SV=5
Length=1939

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 53/326 (16%), Positives = 142/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  876   EEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMN  935

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  936   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLT  995

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   + A +  +  E +  +L +       +L  Q   +E +L  E++   + +
Sbjct  996   KEKKALQEAHQQALDDLQVEEDKVNSLSKSKV----KLEQQVDDLEGSLEQEKKVRMDLE  1051

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++  +  E   +K+   +     +++  +   +  Q+ +
Sbjct  1052  RAKRKLEGDL-KLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKL  1110

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              + +   E+ +  +E     +A+ +  ++D   E    E+++E+ E              
Sbjct  1111  KENQARIEELEEELEAERTARAKVEKLRSDLSRE---LEEISERLEEAGGATSVQIEMNK  1167

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1168  KREAEFQKMRRDLEEATLQHEATAAA  1193


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 116/312 (37%), Gaps = 4/312 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             +   EN EL   + +   ++ +     L +     + K  L  + +    L   L   + 
Sbjct  1281  KLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARH  1340

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+      
Sbjct  1341  DCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1400

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A  A E      S  E  + +   +++ L +  +   AA     +      + LA+ + 
Sbjct  1401  DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQ  1460

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E ++  K +   S     ++   E+  + L+  +      QE I  L E+  +
Sbjct  1461  KYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGE  1520

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  ++ Q ++ K + Q+  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1521  GGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAE  1580

Query  349   ESARIEDMRKRH  360
             +   +E  ++ H
Sbjct  1581  KDEEMEQAKRNH  1592


 Score = 41.4 bits (95),  Expect = 0.021, Method: Composition-based stats.
 Identities = 55/308 (18%), Positives = 117/308 (38%), Gaps = 44/308 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ++LQ  L++ Q   D   ++N  L+E    +             L  + +E R +VE+  
Sbjct  1646  KSLQSLLKDTQIQLDDAVRANDDLKENIAIVER-------RNNLLQAELEELRAVVEQTE  1698

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
                    R ++ A +E+       Q +     S+  Q   +  +L + QS +E A +EC+
Sbjct  1699  -------RSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECR  1751

Query  169   ALEGRARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVE----AALR  214
               E +A+ A   A  +  E           E +++     +  L+ +    E       +
Sbjct  1752  NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGK  1811

Query  215   MERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV---------GSERKRGMQLEDLKQ  265
              + Q      R+L     A  +   E    ++ S             ++K  ++L+DL  
Sbjct  1812  KQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVD  1871

Query  266   QLQQAEEALVAKQEVIDKLKEE-AEQHKIVMETVPVLKAQADIYKADFQAERQ------A  318
             +LQ   +A   + E  ++       + + V   +   + +ADI ++     R       A
Sbjct  1872  KLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGA  1931

Query  319   REKLAEKK  326
             ++K+ +++
Sbjct  1932  KQKMHDEE  1939


 Score = 39.4 bits (90),  Expect = 0.072, Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 122/316 (39%), Gaps = 20/316 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
              +  ++   E  EL+ A+ ++   L     ++L  Q    + K  +  K  E     E +
Sbjct  1529  EKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKD---EEM  1585

Query  108   GLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
                K + +R  +     ++   R + ++   K  ++  +  +  +L  +      A K+ 
Sbjct  1586  EQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQV  1645

Query  168   QALEGRARAASEQARQLESEREALQQQ----------HSVQVDQLRMQGQSVEAALRMER  217
             ++L+   +    Q        + L++              ++++LR   +  E + ++  
Sbjct  1646  KSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAE  1705

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             Q   E   ++  L      L  +    ++S +   + +    +++ +   ++A++A+   
Sbjct  1706  QELIETSERVQLLHSQNTSLINQK-KKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDA  1764

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEK--KELLQEQLEQ  335
                   + EE ++ +     +  +K   +    D Q      E++A K  K+ LQ+   +
Sbjct  1765  AM----MAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEAR  1820

Query  336   LQREYSKLKASCQESA  351
             ++    +L+A  + +A
Sbjct  1821  VRELEGELEAEQKRNA  1836


 Score = 37.9 bits (86),  Expect = 0.21, Method: Composition-based stats.
 Identities = 57/349 (16%), Positives = 129/349 (37%), Gaps = 19/349 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCK---FQEARKLV  104
               +L++  +   +L  A R+    L+   E ++  +  + + +E L  K     +    +
Sbjct  1037  EGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKI  1096

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
             E   +  L L+++ ++    +E L+   +     +A V+   + L  EL+E   RLE A 
Sbjct  1097  EDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAG  1156

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
                       +    + +++  + E    QH      LR +     A L  +       K
Sbjct  1157  GATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVK  1216

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG------MQLEDLKQQLQQAEEALVAKQ  278
             +KL + +  +     +  ++++  +               Q  + + +L++A+ +L    
Sbjct  1217  QKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFT  1276

Query  279   EVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
                 KL+ E  +    +E    L +Q            + +    ++ E L+ QLE+  +
Sbjct  1277  TQRAKLQTENGELARQLEEKEALISQLT----------RGKLSYTQQMEDLKRQLEEEGK  1326

Query  339   EYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
               + L  + Q +    D+ +   E            LS   +  +Q R+
Sbjct  1327  AKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRT  1375


 Score = 33.3 bits (74),  Expect = 6.5, Method: Composition-based stats.
 Identities = 41/229 (18%), Positives = 92/229 (40%), Gaps = 23/229 (10%)

Query  140   ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH---S  196
             A  + ++ ++  E    +  LE +    + LE +  +  ++   L+ + +A Q       
Sbjct  845   AETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAE  904

Query  197   VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQ-----------------  239
              + DQL      +EA ++   +   +E+   A+L     +L                   
Sbjct  905   ERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLA  964

Query  240   --EYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV-AKQEVIDKLKEEAEQHKIVME  296
               E + H   + V +  +    L+++  +L + ++AL  A Q+ +D L+ E ++   + +
Sbjct  965   KVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVNSLSK  1024

Query  297   TVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKA  345
             +   L+ Q D  +   + E++ R  L   K  L+  L+  Q     L+ 
Sbjct  1025  SKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLEN  1073


>sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila 
melanogaster OX=7227 GN=Mhc PE=1 SV=4
Length=1962

 Score = 52.9 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 107/255 (42%), Gaps = 16/255 (6%)

Query  56    EENQELRDAIRQSNQILRE---RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             + N E +  I++  Q L++     EE    +   RE+      +    +  +E       
Sbjct  1633  KANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLE  1692

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
                R + QA +E+        +++   AS+ A    L  ELQ   S L+    E +  E 
Sbjct  1693  QADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEE  1752

Query  173   RARAASEQARQLESE----------REALQQQHSVQVDQLRMQGQSVEA-ALRMERQAAS  221
             +A+ A   A +L  E          +E L++    Q+ +L+++    EA AL+  ++A  
Sbjct  1753  KAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQ  1812

Query  222   EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL--EDLKQQLQQAEEALVAKQE  279
             + ++++ +L+       + + +  K+      R + +    E+ ++  ++ ++ +   Q+
Sbjct  1813  KLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQ  1872

Query  280   VIDKLKEEAEQHKIV  294
              I   K + E+ + +
Sbjct  1873  KIKTYKRQIEEAEEI  1887


 Score = 49.1 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 54/284 (19%), Positives = 123/284 (43%), Gaps = 19/284 (7%)

Query  77    EELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMA  136
             +EL++    +++ +     K  E  +  E        +K + EQ L E+E     ++++ 
Sbjct  985   DELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVR  1044

Query  137   EDKASVKAQVTSLLGELQESQSRLEAATKEC-QALEGRARAASEQARQLESEREALQQQH  195
              D    K +V   L   QE+ + LE   KE  Q ++ + +  S    +LE E+  + +  
Sbjct  1045  GDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQ  1104

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSE--  253
               Q+ +L+ + + +E  +  ERQA ++ +++ A L     +L +  +    ++    E  
Sbjct  1105  R-QIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELN  1163

Query  254   RKRGMQLEDLKQQLQQA---------------EEALVAKQEVIDKLKEEAEQHKIVMETV  298
             +KR  +L  L++ L++A                +A+    E +D+L +   + +   +T 
Sbjct  1164  KKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTC  1223

Query  299   PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
                  Q          ++ A+EK+A++ +    +++    E ++
Sbjct  1224  HNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNR  1267


 Score = 41.7 bits (96),  Expect = 0.015, Method: Composition-based stats.
 Identities = 57/324 (18%), Positives = 135/324 (42%), Gaps = 23/324 (7%)

Query  55    LEENQELRDAIRQSNQILRE--RCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
              ++ QE R A++   + LR+  +      ++  Q+ +    + + ++    +E    +  
Sbjct  800   FKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAE  859

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             +L   + +  +E+E L     ++  +K ++   ++   G LQ+ Q R    T +   LE 
Sbjct  860   ELHAAEVKVRKELEALNA---KLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLEN  916

Query  173   RARAASEQARQLESEREALQQQ----------HSVQVDQLRMQGQSVEAALRMERQAASE  222
             + R   E+  Q E  R  L QQ              ++ L +  Q  E     + +A  +
Sbjct  917   QLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAE-----QDKATKD  971

Query  223   EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
              + +    ++A+        N  K     + +K G +L+  + ++    +     ++ +D
Sbjct  972   HQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLD  1031

Query  283   KLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSK  342
             +L++  E+ K V   V   K + +    D +  ++A   L   K+ L++ +++  +E S 
Sbjct  1032  ELEDSLEREKKVRGDVEKSKRKVE---GDLKLTQEAVADLERNKKELEQTIQRKDKELSS  1088

Query  343   LKASCQESARIEDMRKRHVEVSQA  366
             + A  ++   +    +R ++  QA
Sbjct  1089  ITAKLEDEQVVVLKHQRQIKELQA  1112


 Score = 37.1 bits (84),  Expect = 0.36, Method: Composition-based stats.
 Identities = 44/235 (19%), Positives = 93/235 (40%), Gaps = 13/235 (6%)

Query  78    ELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAE  137
             +L   Q    +E++     FQ+ +K       E   LK       +++E L+   Q+  +
Sbjct  917   QLRDIQERLTQEEDARNQLFQQKKK----ADQEISGLK-------KDIEDLELNVQKAEQ  965

Query  138   DKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSV  197
             DKA+   Q+ +L  E+      +    KE +      +   E+ +  E +   L +  + 
Sbjct  966   DKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAK  1025

Query  198   QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG  257
                 L     S+E   +  R    + KRK+        +   + + + K      +RK  
Sbjct  1026  LEQTLDELEDSLERE-KKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDK  1084

Query  258   MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
              +L  +  +L+  +  ++  Q  I +L+   E+ +  +E     +A+A+  +AD 
Sbjct  1085  -ELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADL  1138


 Score = 36.7 bits (83),  Expect = 0.49, Method: Composition-based stats.
 Identities = 43/258 (17%), Positives = 92/258 (36%), Gaps = 12/258 (5%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
             L R LEE +     + +    L  + E+       +  E+  L+ KF+            
Sbjct  1286  LLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNL----------  1335

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
             + DL   +EQ   E E     Q+Q+++  A  +   +    +       LE A ++ QA 
Sbjct  1336  EHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQAR  1395

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                A    E   Q     E  +Q+ S +V+ L+++     A      +      + + + 
Sbjct  1396  LAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEW  1455

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             ++    L  E D   K     S     ++   E+ ++QL+          + +  L ++ 
Sbjct  1456  KLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQI  1515

Query  289   EQHKIVMETVPVLKAQAD  306
              +    +  +   + + +
Sbjct  1516  GEGGRNIHEIEKARKRLE  1533


 Score = 36.4 bits (82),  Expect = 0.63, Method: Composition-based stats.
 Identities = 49/250 (20%), Positives = 101/250 (40%), Gaps = 13/250 (5%)

Query  24    QDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAI----RQSNQIL---RERC  76
             Q  L EE      A   L   +     LQ  LEE++ L +      RQ+ Q L    E+ 
Sbjct  1653  QTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQL  1712

Query  77    EELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMA  136
              E+    AS    K  L  + Q     ++ L  E  + + + ++A+ +   L    +   
Sbjct  1713  NEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQ  1772

Query  137   EDKASVKAQVTSLLGELQESQSRLEAATKE-CQALEGRARAASEQARQLESEREALQQQH  195
             +   + +    +L  +++E Q RL+ A     +  +   +   ++ R+LE+E +  Q++H
Sbjct  1773  DHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRH  1832

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERK  255
             +     LR      E  ++     + E+++   ++Q    +L Q+     K  +  +E  
Sbjct  1833  ADAQKNLR----KSERRVKELSFQSEEDRKNHERMQDLVDKL-QQKIKTYKRQIEEAEEI  1887

Query  256   RGMQLEDLKQ  265
               + L   ++
Sbjct  1888  AALNLAKFRK  1897


 Score = 36.0 bits (81),  Expect = 0.89, Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 99/283 (35%), Gaps = 29/283 (10%)

Query  113   DLKRQKEQALREVEH-LKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
             +L +++E  L ++   L+    Q     A+++ +    + E+ E   +L     + +   
Sbjct  1161  ELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDR  1220

Query  172   GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
                     Q R    +    +        QL+     V++          E  R L    
Sbjct  1221  QTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQS-------KLDETNRTLNDFD  1273

Query  232   VAYHQLFQEYDNHIKS------SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK  285
              +  +L  E  + ++        V    + +      L+   + A+E    +  ++ K +
Sbjct  1274  ASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFR  1333

Query  286   --------------EEAEQHKIVMETVPVLKAQADIYKADFQAERQAR-EKLAEKKELLQ  330
                           EEAE    +   +    A+A ++++ ++++  AR E+L E K  LQ
Sbjct  1334  NLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQ  1393

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPA  373
              +L + +     L   C    + +      VE  Q  +  A A
Sbjct  1394  ARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANA  1436


>sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda 
melanoleuca OX=9646 GN=TBC1D2 PE=3 SV=1
Length=923

 Score = 52.5 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 44/259 (17%), Positives = 98/259 (38%), Gaps = 20/259 (8%)

Query  136  AEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESE-REALQQQ  194
             E   +++ QV  L  EL+  +  +    K  +A +   RA+S      E + R  L + 
Sbjct  311  QEKILALEQQVLMLTKELKSQKELVRILHKALEAAQQEKRASSAYLAAAEDKDRLELVRH  370

Query  195  HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSER  254
               Q+ +L  + +++E       Q A   ++++ +LQ    QL ++     +     SE+
Sbjct  371  KVRQIAELGKRVEALERERESLAQTAGLREQQVQELQRHVQQLLEKNQAKQQVICKLSEK  430

Query  255  KRGMQLEDLKQQ---LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKAD  311
                      Q    L  A+   +++QE ++ LK          + +   + Q     ++
Sbjct  431  VTWDFTHPPTQPPVPLGAADRDFLSQQEKMEHLK----------DDMEAYRTQNRFLNSE  480

Query  312  FQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRK-RHVEVSQAPLPP  370
                 +   ++AEK++ L  +   LQ +  +++     S  +  +R+ +     +A    
Sbjct  481  IHQVTKIWRRVAEKEKALLMKCAYLQAKNCQVE-----SKYLAGLRRLQEAAGGEATESS  535

Query  371  APAYLSSPLALPSQRRSPP  389
                  +  AL  +     
Sbjct  536  ELLRQLTQEALQWEAGEAS  554


>sp|Q92574|TSC1_HUMAN Hamartin OS=Homo sapiens OX=9606 GN=TSC1 
PE=1 SV=2
Length=1164

 Score = 52.5 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 100/255 (39%), Gaps = 28/255 (11%)

Query  52   QRCLEENQELRD-----AIRQSNQILRERCE----ELLHFQASQREEKEFLMCKFQEARK  102
            Q  L   + LR      A+ + N  ++++ +    ++  ++ S ++E+       QE R 
Sbjct  711  QHALRNRRLLRKVIKAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYNQ-LQEQRD  769

Query  103  LVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEA  162
             +         L  Q  Q   + E      Q++       +  +  L  EL+++ +++  
Sbjct  770  TMVT------KLHSQIRQLQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANNKVCH  823

Query  163  ATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE  222
                             Q  Q  S  E++QQQ      QL + G+  E  L   +   S+
Sbjct  824  TE-----------LLLSQVSQKLSNSESVQQQMEFLNRQLLVLGEVNELYLEQLQNKHSD  872

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVID  282
              +++  ++ AY +  ++  +H+       +  +   L +L+  L + +  L+ +++ ++
Sbjct  873  TTKEVEMMKAAYRKELEKNRSHVLQQTQRLDTSQKRIL-ELESHLAKKDHLLLEQKKYLE  931

Query  283  KLKEEAEQHKIVMET  297
             +K +A       E+
Sbjct  932  DVKLQARGQLQAAES  946


>sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus 
OX=9913 GN=TBC1D2 PE=2 SV=1
Length=925

 Score = 52.5 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 105/268 (39%), Gaps = 21/268 (8%)

Query  83   QASQREEKEFLMCKFQEARKLVERL--GLEKLDLKRQKEQALREVEHLKRC---QQQMAE  137
            + +QREE+          +     L   L    +++ K Q+              +   E
Sbjct  250  EETQREEQPSPPGPGAPGKDPANSLKSSLTTSLIRKAKSQS-NTFPLFSEGLMRNRTAQE  308

Query  138  DKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESE-REALQQQHS  196
               +++ QV  L  EL+  +  ++   K  +A +   R +S      + + R  L +   
Sbjct  309  KVLALEQQVLMLTKELKAQKELVKILHKALEAAQQEKRVSSAYLAAAQDKDRLELVRHKV  368

Query  197  VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
             Q+ +L  + +++E       Q AS +++++ +LQ     L  +     +     SE+  
Sbjct  369  RQIAELGRRVEALERERESLAQTASLQEQEIRELQQHVQLLLDKNQAKQQVICKLSEKVT  428

Query  257  GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER  316
               ++  ++    A+   +++QE ++ LK          + +   + Q     ++     
Sbjct  429  QDFMKAPEE----ADRDFLSQQEKMEHLK----------DDMEAYRTQNRFLNSEIHQVT  474

Query  317  QAREKLAEKKELLQEQLEQLQREYSKLK  344
            +   K+AEK++ L  +   LQ +  +++
Sbjct  475  KIWRKVAEKEKALLMKCAYLQAQNCQVE  502


>sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus OX=9913 GN=MYH1 PE=2 
SV=2
Length=1938

 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 55/326 (17%), Positives = 145/326 (44%), Gaps = 15/326 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +    +E  +L+  ++     L    ERC++L+  +     + + +  + ++  ++ 
Sbjct  877   EEKMVTLTQEKNDLQLQVQSEADALADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   T
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLT  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  997   KEKKALQEAHQQTLDDLQAEEDKVNTLTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1052

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    I++     +   +K+  ++ +L+ +++  +   +  Q+ I
Sbjct  1053  RAKRKLEGDL-KLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALAMQLQKKI  1111

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
              +L+   E+ +  +E     +A+A+  ++D   E    E+++E+ E              
Sbjct  1112  KELQARIEELEEEIEAERASRAKAEKQRSDLSRE---LEEISERLEEAGGATSAQIEMNK  1168

Query  342   KLKASCQESAR-IEDMRKRHVEVSQA  366
             K +A  Q+  R +E+   +H   + A
Sbjct  1169  KREAEFQKMRRDLEEATLQHEATAAA  1194


 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 59/332 (18%), Positives = 122/332 (37%), Gaps = 4/332 (1%)

Query  53    RCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKL  112
             R   E+ E    + + + ++ +       F     E K  L  + +    L   L   + 
Sbjct  1282  RLQTESGEFSRQLDEKDALVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSARH  1341

Query  113   DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEG  172
             D    +EQ   E E     Q+ M++  + V    T    +  +    LE A K+      
Sbjct  1342  DCDLLREQYEEEQEGKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ  1401

Query  173   RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV  232
              A    E      +  E  +Q+   +V+ L +  +   AA     +      + L++ + 
Sbjct  1402  DAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILSEWKQ  1461

Query  233   AYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
              Y +   E +   K S   S     ++   E+   QL+  +      Q+ I  L E+  +
Sbjct  1462  KYEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAE  1521

Query  291   HKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKASCQ  348
                 +  +  +K Q +  K++ QA  E        E+ ++L+ QLE  Q +    +   +
Sbjct  1522  GGKRIHELEKVKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAE  1581

Query  349   ESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
             +   I+ +++ H+ + ++      A + S   
Sbjct  1582  KDEEIDQLKRNHIRIVESMQSTLDAEIRSRND  1613


 Score = 44.1 bits (102),  Expect = 0.003, Method: Composition-based stats.
 Identities = 35/258 (14%), Positives = 101/258 (39%), Gaps = 11/258 (4%)

Query  56    EENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
             E+ +E    + +   +L+   EEL          ++    +  +A + V+ L  +   L 
Sbjct  1668  EDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLI  1727

Query  116   RQKEQALREVEHLKRCQQQMAEDKASVKAQVTS-------LLGELQESQSRLEAATKECQ  168
               K++   ++  ++   + + ++  + + +          +  EL++ Q       +  +
Sbjct  1728  NTKKKLETDITQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK  1787

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              LE   +    +  + E       ++   Q+ +L  + + +E  +  E++   E  + L 
Sbjct  1788  NLEQTVKDLQHRLDEAEQLALKGGKK---QIQKLEARVRELEGEVESEQKRNVEAVKGLR  1844

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             + +    +L  + +   K+ +   +    +Q + +K   +QAEEA       + K ++  
Sbjct  1845  KHERRVKELTYQTEEDRKNILRLQDLVDKLQAK-VKSYKRQAEEAEEQSNVNLSKFRKLQ  1903

Query  289   EQHKIVMETVPVLKAQAD  306
              + +   E   + ++Q +
Sbjct  1904  HELEEAEERADIAESQVN  1921


 Score = 36.7 bits (83),  Expect = 0.49, Method: Composition-based stats.
 Identities = 41/278 (15%), Positives = 109/278 (39%), Gaps = 40/278 (14%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVER--  106
             ETL+R  +  Q+    + +      +R  EL   +    +EK  +    +EA   +E   
Sbjct  1499  ETLKRENKNLQQEISDLTEQIAEGGKRIHELEKVKKQVEQEKSEIQAALEEAEASLEHEE  1558

Query  107   ---------LGLEKLDLKRQKEQALREVEHLKRCQ-QQMAEDKASVKAQV----------  146
                      L   K ++ R+  +   E++ LKR   + +   ++++ A++          
Sbjct  1559  GKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLK  1618

Query  147   TSLLGELQESQSRLE-------AATKECQALEGRARAASEQARQLESEREALQQQHSV--  197
               + G+L E + +L         A K  ++ +   +            +E L++Q ++  
Sbjct  1619  KKMEGDLNEMEIQLNHANRMAAEALKNYRSTQAILKDTQIHLDDALRGQEDLKEQLAMVE  1678

Query  198   --------QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSV  249
                     ++++LR   +  E + ++  Q   +   ++  L      L       +++ +
Sbjct  1679  RRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTK-KKLETDI  1737

Query  250   VGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                + +    +++ +   ++A++A+     + ++LK+E
Sbjct  1738  TQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKE  1775


 Score = 36.7 bits (83),  Expect = 0.52, Method: Composition-based stats.
 Identities = 64/357 (18%), Positives = 141/357 (39%), Gaps = 33/357 (9%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + L+  LE+ ++LR  + ++ + L    +           +K+ L  K ++    +  L 
Sbjct  1035  DDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQ  1094

Query  109   LEKLD---LKRQKEQALREVEHLKRCQQQMAED----KASVKAQVTSLLGELQESQSRLE  161
              +  D   L  Q ++ ++E++      ++  E     +A  + Q + L  EL+E   RLE
Sbjct  1095  SKIEDEQALAMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLE  1154

Query  162   AA-----------TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              A            K     +   R   E   Q E+   AL+++H+  V +L  Q  +++
Sbjct  1155  EAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQ  1214

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
                   +Q   +EK ++ ++++       E  +  K ++    R    QL +LK +  + 
Sbjct  1215  RV----KQKLEKEKSEM-KMEIDDLASNMETVSKAKGNLEKMCRALEDQLSELKTKEDEQ  1269

Query  271   EEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQ  330
             +  +        +L+ E+ +    ++    L +Q            + ++   ++ E L+
Sbjct  1270  QRLINDLTTQRARLQTESGEFSRQLDEKDALVSQLS----------RGKQAFTQQIEELK  1319

Query  331   EQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
              QLE+  +  S L  + Q +    D+ +   E  Q         +S   +  +Q R+
Sbjct  1320  RQLEEEIKAKSALAHALQSARHDCDLLREQYEEEQEGKAELQRAMSKANSEVAQWRT  1376


>sp|Q2QLB3|CTTB2_PLEMO Cortactin-binding protein 2 OS=Plecturocebus 
moloch OX=9523 GN=CTTNBP2 PE=3 SV=1
Length=1663

 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 45/275 (16%), Positives = 104/275 (38%), Gaps = 35/275 (13%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            +K  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +      E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSAQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
            ++E   +       EE+ K  Q+ +                V   ++  G  +E+  Q+L
Sbjct  148  ALEQEHKKLAARLEEERGKNKQVVLML--------------VKECKQLSGRVIEE-AQKL  192

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKK  326
            +     L  +++  ++L+EE    K     +    AQ +   ++F  ER Q R KL  ++
Sbjct  193  KDVMAKLEEEKKKTNELEEELSAEKQRSTEME---AQMEKQLSEFDTEREQLRAKLNREE  249

Query  327  EL---LQEQLEQLQREYSKLKASCQESARIEDMRK  358
                 L+E+++++++   +LK        +   RK
Sbjct  250  AHTTDLKEEIDKMKKMIEQLKKGGDSKPSLSLPRK  284


 Score = 36.4 bits (82),  Expect = 0.60, Method: Composition-based stats.
 Identities = 27/118 (23%), Positives = 46/118 (39%), Gaps = 12/118 (10%)

Query  27   LGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDA---IRQSNQILRERCEELLHFQ  83
            L EE    K  +L L  E    +   R +EE Q+L+D    + +  +   E  EEL   +
Sbjct  160  LEEERGKNKQVVLMLVKE--CKQLSGRVIEEAQKLKDVMAKLEEEKKKTNELEEELSAEK  217

Query  84   ASQREEKEFLMCKFQE-------ARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQ  134
                E +  +  +  E        R  + R      DLK + ++  + +E LK+    
Sbjct  218  QRSTEMEAQMEKQLSEFDTEREQLRAKLNREEAHTTDLKEEIDKMKKMIEQLKKGGDS  275


>sp|Q9BY12|SCAPE_HUMAN S phase cyclin A-associated protein in 
the endoplasmic reticulum OS=Homo sapiens OX=9606 GN=SCAPER 
PE=1 SV=2
Length=1400

 Score = 52.5 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 48/260 (18%), Positives = 110/260 (42%), Gaps = 21/260 (8%)

Query  25   DVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQA  84
            D++ EE        +H+  +  +P + +R + E+++  +  +   Q LRE+  E    + 
Sbjct  511  DIVEEEPARPPGHGIHMHEKLSSP-SRKRTIAESKKKHEEKQMKAQQLREKLREEKTLKL  569

Query  85   SQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKA  144
             +  E+E  + K++E      R  +E+  L  + ++ ++    +K+ Q++ A+       
Sbjct  570  QKLLEREKDVRKWKEELLDQRRRMMEEKLLHAEFKREVQLQAIVKKAQEEEAKVNEIAFI  629

Query  145  QVTSLLGELQESQSRLEAATKECQALEGRARAA----SEQARQLESEREALQQQHSVQVD  200
                   +  +  S+L+   +    L+   +        +   ++  + AL+ +   +V+
Sbjct  630  NTLEAQNKRHDVLSKLKEYEQRLNELQEERQRRQEEKQARDEAVQERKRALEAERQARVE  689

Query  201  QLRMQGQSVEAALRMERQAASEEK--------------RKLAQLQVAYHQLFQEYDNHIK  246
            +L M+ +  EA  R+E+Q   +EK               +LA L  A  +  +E    I+
Sbjct  690  ELLMKRKEQEA--RIEQQRQEKEKAREDAARERARDREERLAALTAAQQEAMEELQKKIQ  747

Query  247  SSVVGSERKRGMQLEDLKQQ  266
                 S R+   Q+E  K++
Sbjct  748  LKHDESIRRHMEQIEQRKEK  767


>sp|Q6DD09|CAO1B_XENLA Calcium-binding and coiled-coil domain-containing 
protein 1-B OS=Xenopus laevis OX=8355 GN=calcoco1-b 
PE=2 SV=1
Length=547

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 47/278 (17%), Positives = 119/278 (43%), Gaps = 6/278 (2%)

Query  63   DAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL  122
            +   +S   L+E+C++L+  +    EE+  L C+  E R+ + +L  E   + ++ ++  
Sbjct  187  ETSEKSCFSLKEQCQDLVMREQLAIEEQSLLSCQEAELRERILQLQGEIKIMNKKMQEKD  246

Query  123  REVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQAR  182
            RE+E     +  +   K  +K  +     E++  Q ++++  ++ ++ +    A+ ++A 
Sbjct  247  RELEGTVAIKLSLENKKVVLKQHLAETTVEIKRYQLQVDSLREKLRSTQDMLSASQQKAL  306

Query  183  QLESEREALQQQHSVQVDQL-RMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEY  241
             +  E  A+       +  L + + ++ + A+++        K K    Q    +    +
Sbjct  307  LMGEELAAISSIRDRTISDLHKSRLETADLAIKVSD---LSVKYKEGMGQWWQEKTALNH  363

Query  242  DNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVL  301
                K   + + +   + LE+  Q  +   +AL  K       ++   Q       +  L
Sbjct  364  SMEAKRDQIVNLKAEKLSLENSLQAERSQRQALQCKLNQETDARQV--QLSENRRQLSEL  421

Query  302  KAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
            K+   + + + Q  R+ R+ + +    L+E+L++L  E
Sbjct  422  KSALKVAQMEKQQLREERQGILQYARSLEERLDKLADE  459


>sp|P15215|LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster 
OX=7227 GN=LanB2 PE=2 SV=2
Length=1639

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 54/316 (17%), Positives = 128/316 (41%), Gaps = 37/316 (12%)

Query  55    LEENQELRDAI-RQSNQILRERCEELLHFQASQREEKEFLMC---KFQEARKLVERLGLE  110
              E  QEL +A+ +++ Q   E  E L   +A+  +  + +       +EA    E+L   
Sbjct  1344  FETEQELTEALLKRAEQQQLEDIELLERAKAAHDKATKAVEQGDNTLKEANNTYEKLAGF  1403

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
             + D++R  E A + +                    V ++  E+Q ++S +  A +   AL
Sbjct  1404  QSDVQRSSESAEKAL------------------QTVPNIEKEIQNAESLISQAEE---AL  1442

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS--VEAALRMERQAASEEKRKLA  228
             +G  + A+E  +  +  +    +Q S   + +R +     V A    E       + KL 
Sbjct  1443  DGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLREEADQLNHRVKLT  1502

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE--  286
             ++ +   +     D+++         +     ++ ++Q+++A   L A ++ ++ LK+  
Sbjct  1503  EMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANADLTAIKDELENLKDIN  1562

Query  287   --EAEQHKIVMETVP------VLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
               + ++ +  + TV        L  + + Y+     ++   +K   +   L+++++ +  
Sbjct  1563  TGDLDRLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVQNIGL  1622

Query  339   EYSKLKASCQESARIE  354
                 L  SC    R+E
Sbjct  1623  ISKALPDSCFSRNRLE  1638


>sp|P25386|USO1_YEAST Intracellular protein transport protein 
USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
OX=559292 GN=USO1 PE=1 SV=2
Length=1790

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 60/342 (18%), Positives = 139/342 (41%), Gaps = 7/342 (2%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             Q   +E + L +      Q   E+   L       + E E    +    R  +E++ L  
Sbjct  1363  QAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNENELKAKEIDNTRSELEKVSLSN  1422

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
              +L    E+    ++ L+       +       ++ S+  + +     L+   +  Q  +
Sbjct  1423  DEL---LEEKQNTIKSLQDEILSYKDKITRNDEKLLSIERDNKRDLESLKEQLRAAQESK  1479

Query  172   GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ  231
              +     ++  +  S+ +A  ++    + +L    +S E  L+   +   +   KL Q +
Sbjct  1480  AKVEEGLKKLEEESSKEKAELEKSKEMMKKLESTIESNETELKSSMETIRKSDEKLEQSK  1539

Query  232   VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQH  291
              +  +  +    H KS ++    +    +E+LK +L+   ++    + V  +L    E+ 
Sbjct  1540  KSAEEDIKNLQ-HEKSDLISRINESEKDIEELKSKLRIEAKSGSELETVKQELNNAQEKI  1598

Query  292   KIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES-  350
             +I  E   VLK++ +  + + + ++   +   E+KELL  +L++L++E    +   Q+S 
Sbjct  1599  RINAEENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSE  1658

Query  351   -ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
               R  ++RK  VE SQ     A    +    L ++ ++   +
Sbjct  1659  EERRAEVRKFQVEKSQL-DEKAMLLETKYNDLVNKEQAWKRD  1699


 Score = 49.5 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 50/307 (16%), Positives = 127/307 (41%), Gaps = 22/307 (7%)

Query  70    QILRERCEELLHFQASQREEKEFLMC-------KFQEARKLVERLGLEKLDLKRQKEQAL  122
             + + E  EE+     +  +EKE +         +FQ    LV +L  +   L    +   
Sbjct  916   KAINENLEEMKIQCNNLSKEKEHISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYKDMQ  975

Query  123   REVEHLKRCQQQMAEDK----ASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
              E E L +  ++   +     ++++ ++ S+  E +  Q    +  K  + L+       
Sbjct  976   AENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKKTISDLE  1035

Query  179   EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQ---VAYH  235
             +   ++ S+ ++ + ++  Q+  L+ + ++   A        SE  +   +L+    AY 
Sbjct  1036  QTKEEIISKSDSSKDEYESQISLLKEKLETATTANDENVNKISELTKTREELEAELAAYK  1095

Query  236   QLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVM  295
              L  E +  +++S    +  +  +    ++++Q  +EA   KQ  ++ L+   E  +   
Sbjct  1096  NLKNELETKLETSEKALKEVKENEEHLKEEKIQLEKEATETKQ-QLNSLRANLESLEKEH  1154

Query  296   ETVPVLKAQADIYKADF-QAERQAREKLAEKKELL---QEQLEQLQREYSKLKASCQESA  351
             E +    AQ   Y+      ERQ  E++++  + +   Q++ E ++++  +L+   +   
Sbjct  1155  EDLA---AQLKKYEEQIANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGEVKAMK  1211

Query  352   RIEDMRK  358
                + + 
Sbjct  1212  STSEEQS  1218


 Score = 42.9 bits (99),  Expect = 0.005, Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 105/295 (36%), Gaps = 15/295 (5%)

Query  76    CEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQM  135
              EE+   Q    + K  +     E     E L  + + L  + ++   + + L       
Sbjct  729   FEEVEKLQRQCTKLKGEITSLQTETESTHENLTEKLIALTNEHKELDEKYQILNSSH---  785

Query  136   AEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQH  195
                 +S+K   + L  EL+  +  L+  T+    LE + +       + +S       + 
Sbjct  786   ----SSLKENFSILETELKNVRDSLDEMTQLRDVLETKDKENQTALLEYKSTI----HKQ  837

Query  196   SVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERK  255
                +  L    +++ +  +      ++  + L  L     Q  +E   +++     S   
Sbjct  838   EDSIKTLEKGLETILSQKKKAEDGINKMGKDLFALSREM-QAVEENCKNLQKEKDKSNVN  896

Query  256   RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE  315
                + + LK+ +      + A  E ++++K +        E +     +   YK+ FQ+ 
Sbjct  897   HQKETKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEHIS---KELVEYKSRFQSH  953

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPP  370
                  KL EK + L    + +Q E   L  + +ES     ++  +++     +  
Sbjct  954   DNLVAKLTEKLKSLANNYKDMQAENESLIKAVEESKNESSIQLSNLQNKIDSMSQ  1008


 Score = 42.9 bits (99),  Expect = 0.006, Method: Composition-based stats.
 Identities = 40/270 (15%), Positives = 108/270 (40%), Gaps = 8/270 (3%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             ET ++ L+E +E  + +++    L +   E      S R   E L  + ++    +++  
Sbjct  1106  ETSEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHEDLAAQLKKYE  1165

Query  109   LEKLDLKRQKEQALREV-EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEC  167
              +  + +RQ  + + ++ + +   QQ+      S+K +   L GE++  +S  E  +   
Sbjct  1166  EQIANKERQYNEEISQLNDEITSTQQE----NESIKKKNDELEGEVKAMKSTSEEQSNLK  1221

Query  168   QALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKL  227
             ++         ++ ++     EA   +    V+   ++ + ++     + +  SE + KL
Sbjct  1222  KSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKL  1281

Query  228   AQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
                +    +  +         +      +  +L+   +++    +A    +  + +LK+ 
Sbjct  1282  KASEDKNSKYLELQKES--EKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKT  1339

Query  288   AEQHKIVM-ETVPVLKAQADIYKADFQAER  316
             + + +    E +  LK +  I    F+ ER
Sbjct  1340  SSEERKNAEEQLEKLKNEIQIKNQAFEKER  1369


 Score = 42.1 bits (97),  Expect = 0.010, Method: Composition-based stats.
 Identities = 31/259 (12%), Positives = 93/259 (36%), Gaps = 14/259 (5%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             ++   + ++  + I Q N  +    +E    +    E +  +      + +       E 
Sbjct  1166  EQIANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGEVKAMKSTSEEQSNLKKSEI  1225

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
               L  Q ++  ++ E  +    +  +   S   ++  L  E    +  +     + +A E
Sbjct  1226  DALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKLKASE  1285

Query  172   GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSV----------EAALRMERQAAS  221
              +      +  +L+ E E ++++   +  +L++Q + +          E+ L   ++ +S
Sbjct  1286  DKNS----KYLELQKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKTSS  1341

Query  222   EEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             EE++   +         Q  +   +              ++  +++   E+ L+  Q   
Sbjct  1342  EERKNAEEQLEKLKNEIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNEN  1401

Query  282   DKLKEEAEQHKIVMETVPV  300
             +   +E +  +  +E V +
Sbjct  1402  ELKAKEIDNTRSELEKVSL  1420


 Score = 40.2 bits (92),  Expect = 0.043, Method: Composition-based stats.
 Identities = 44/254 (17%), Positives = 108/254 (43%), Gaps = 16/254 (6%)

Query  35    KPAMLHLPSEQGAPET-LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFL  93
             K  M  L S   + ET L+  +E  ++  + + QS +   E  + L H       EK  L
Sbjct  1504  KEMMKKLESTIESNETELKSSMETIRKSDEKLEQSKKSAEEDIKNLQH-------EKSDL  1556

Query  94    MCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQM---AEDKASVKAQVTSLL  150
             + +  E+ K +E L  +     +   +     + L   Q+++   AE+   +K+++  + 
Sbjct  1557  ISRINESEKDIEELKSKLRIEAKSGSELETVKQELNNAQEKIRINAEENTVLKSKLEDIE  1616

Query  151   GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              EL++ Q+ +++  +E + L  R +   ++    + + +  +++   +V + +++   ++
Sbjct  1617  RELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEEERRAEVRKFQVEKSQLD  1676

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQA  270
                  E+    E K      +    +  ++       S      K   +L++LK +  + 
Sbjct  1677  -----EKAMLLETKYNDLVNKEQAWKRDEDTVKKTTDSQRQEIEKLAKELDNLKAENSKL  1731

Query  271   EEALVAKQEVIDKL  284
             +EA   + E+ D +
Sbjct  1732  KEANEDRSEIDDLM  1745


>sp|Q2KN93|CYTSA_DANRE Cytospin-A OS=Danio rerio OX=7955 GN=specc1la 
PE=2 SV=2
Length=1132

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 49/281 (17%), Positives = 103/281 (37%), Gaps = 31/281 (11%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            +Q    TL+   ++N E ++ I      L+ER   +      +R+E+  +    +E +  
Sbjct  504  QQHLSNTLKMAEQDNAEAQNVI----AALKERNHHMERLLDVERQERASMAAVLEECKAA  559

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQ------------QQMAEDKASVKAQVTSLLG  151
            V     E    +   EQ  ++V  L                + +  DK   +A+ + L  
Sbjct  560  VNNDQAELSRCRVLLEQERQKVAELYSIHNAGDKSDIHQLLEGVRLDKEEAEAKASKLQD  619

Query  152  ELQESQSRLEAATKECQALEGRARA--------ASEQARQLESEREALQQQ------HSV  197
            +L  ++S +         L+   R          +EQ R +E +RE LQ++         
Sbjct  620  DLGHARSEVACLQDTLNKLDAEYRDFQSVVQKELAEQKRAIEKQREDLQEKETEIGDMKE  679

Query  198  QVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRG  257
             + +L  + +   A    +    S+ +  + +LQ   H + +E    +   +     +  
Sbjct  680  TIFELEDEVEQHRAVKLHDNLIISDLENSMKKLQDQKHDMERE-IKILHRRLREESAEWR  738

Query  258  MQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETV  298
                DL+  +  A +     QE I  L+   ++ +   E +
Sbjct  739  QFQADLQTAVVIANDIKSEAQEEIGDLRRRLQEAQEKNEKL  779


 Score = 36.4 bits (82),  Expect = 0.54, Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 68/170 (40%), Gaps = 8/170 (5%)

Query  143  KAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQL  202
            +  V  L   + + +    + ++E QA         +  ++L  E E L ++  + +D L
Sbjct  381  EVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNGENERLGEEKVLLMDSL  440

Query  203  RMQGQSVEAALR-MERQAASEEKRKLAQLQVA------YHQLFQEYDNHIKSSVVGSERK  255
              Q   +E   R +E   +  ++  +A           Y +L Q Y    +++    E+ 
Sbjct  441  CQQSDKLEHCGRQIEYFRSLLDEHGVAYSVDEDIKSGRYMELEQRYVELAENARFEREQL  500

Query  256  RGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
             G+Q + L   L+ AE+     Q VI  LKE     + +++     +A  
Sbjct  501  LGVQ-QHLSNTLKMAEQDNAEAQNVIAALKERNHHMERLLDVERQERASM  549


>sp|Q5AMN3|ATG11_CANAL Autophagy-related protein 11 OS=Candida 
albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG11 
PE=3 SV=1
Length=1165

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 82/208 (39%), Gaps = 29/208 (14%)

Query  57   ENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKR  116
            +N EL + I   N+ + ++ +E+ H +    +  + LM K QE          E   LK+
Sbjct  684  KNTELTNQINSKNETITQQQKEMEHMKLKTEKRVDELMKKLQEK-------DEECQSLKQ  736

Query  117  QKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARA  176
            + +    EVE+L +  +        ++A++T                 +  Q    + + 
Sbjct  737  ENKIKCDEVENLTKKLELSDNHNKELEAKIT-----------------EYTQKATSKTKE  779

Query  177  ASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQ  236
             ++  + + + R  L     ++ D L     S EA    ER         L  LQ+   +
Sbjct  780  IADLNKTVSNLRSELGDAMHMKNDLLS-NLSSKEAEFTKERNQF---NNDLKALQLKLDE  835

Query  237  LFQEYDNHIKSSVVGSERKRGMQLEDLK  264
            + ++Y+N ++ +    ++   + + DL 
Sbjct  836  INEDYENLMELTQAKQKKHD-LIINDLN  862


>sp|Q5RD60|CACO1_PONAB Calcium-binding and coiled-coil domain-containing 
protein 1 OS=Pongo abelii OX=9601 GN=CALCOCO1 PE=2 
SV=1
Length=691

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 59/323 (18%), Positives = 133/323 (41%), Gaps = 25/323 (8%)

Query  59   QELRDAI---RQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK  115
            QEL  A+   RQ +  L E+ + +        EE++ L  +  +    +  L  +   + 
Sbjct  182  QELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTIS  241

Query  116  RQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRAR  175
             +      E++ L+   + +  ++  +  Q+  +  + ++S++ L+ A +E   L    +
Sbjct  242  EKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHRLNLDLK  301

Query  176  AASEQARQLESEREALQ-------------QQHSVQVDQLRMQGQSVEAALRMERQAASE  222
             A    ++  ++ + L+             QQ   +++ L+ Q +  +      +Q A+ 
Sbjct  302  EAKSWQKEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELATSSQQKATL  361

Query  223  EKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA---LVAKQE  279
               +LA    A  +   E           + R   + L   +++ Q ++E    L + + 
Sbjct  362  LGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEA  421

Query  280  VIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKKELLQE---QLEQ  335
              DK+ + + +   + + V   + Q  ++K +   E+  +  +L+E K  L E    L  
Sbjct  422  EKDKILKLSAEILRLEKAVQEERTQNHVFKTELAREKDSSLVQLSESKRELTELRSALRV  481

Query  336  LQREYSKLKASCQESARIEDMRK  358
            LQ+E  +L+   QE   +E MRK
Sbjct  482  LQKEKEQLQEEKQE--LLEYMRK  502


 Score = 37.9 bits (86),  Expect = 0.20, Method: Composition-based stats.
 Identities = 38/226 (17%), Positives = 94/226 (42%), Gaps = 22/226 (10%)

Query  79   LLHFQASQREEKEFLMC-------KFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRC  131
            L +     ++E+  LM        +  E R  V+ L       +++  + + + + + R 
Sbjct  149  LQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRS  208

Query  132  QQQMAEDKASVKAQ-------VTSLLGELQESQSRLEAATKECQALEGRARAASEQARQL  184
              ++ E++  +  Q       +  L  ++Q    ++     E   L    +A + +  +L
Sbjct  209  HGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKL  268

Query  185  ESEREALQQQHSVQVDQLRM-QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDN  243
              + + +Q        +L++ Q ++    L ++   + +++      Q A  Q  ++   
Sbjct  269  LGQLKEVQADKEQSEAELQVAQQENHRLNLDLKEAKSWQKE------QSAQAQRLKDKVA  322

Query  244  HIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
             +K ++  ++ +R  +LE LK+QL+ A+E   + Q+    L EE  
Sbjct  323  QMKDTLGQAQ-QRVAELEPLKEQLRGAQELATSSQQKATLLGEELA  367


 Score = 37.5 bits (85),  Expect = 0.22, Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 90/256 (35%), Gaps = 14/256 (5%)

Query  45   QGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLV  104
             G  + +Q   E+++      +Q N  L    +E   +Q  Q  + + L  K  + +  +
Sbjct  269  LGQLKEVQADKEQSEAELQVAQQENHRLNLDLKEAKSWQKEQSAQAQRLKDKVAQMKDTL  328

Query  105  ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQ-SRLEAA  163
             +      +L+  KEQ     E     QQ+       + +   +    + E   SRLE A
Sbjct  329  GQAQQRVAELEPLKEQLRGAQELATSSQQKATLLGEELASAAAARDRTIAELHRSRLEVA  388

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
                +  E       E+ +  +     LQ   + +   L++  + +     ++ +     
Sbjct  389  EVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQN-  447

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
                    V   +L +E D+ +             +L +L+  L+  ++     QE   +
Sbjct  448  -------HVFKTELAREKDSSLVQLSESKR-----ELTELRSALRVLQKEKEQLQEEKQE  495

Query  284  LKEEAEQHKIVMETVP  299
            L E   + +  +E V 
Sbjct  496  LLEYMRKLEARLEKVA  511


 Score = 34.4 bits (77),  Expect = 2.0, Method: Composition-based stats.
 Identities = 39/247 (16%), Positives = 103/247 (42%), Gaps = 14/247 (6%)

Query  126  EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLE  185
            E +   +   + D   V  + T L  +L ESQ       +    LEG+      + ++LE
Sbjct  126  ELVTLEEADGSSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELE  185

Query  186  SEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHI  245
                  +Q+H+  ++Q +         +       +EE+  L++ Q  +     E ++ I
Sbjct  186  RALATARQEHTELMEQYK--------GISRSHGEITEERDILSRQQGDHVARILELEDDI  237

Query  246  KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV-IDKLKEEAEQHKIVMETVPVLKAQ  304
            ++ +      + ++L+ L+  +    +AL  +QE  + +LKE     +     + V + +
Sbjct  238  QT-ISEKVLTKEVELDRLRDTV----KALTREQEKLLGQLKEVQADKEQSEAELQVAQQE  292

Query  305  ADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVS  364
                  D +  +  +++ + + + L++++ Q++    + +    E   +++  +   E++
Sbjct  293  NHRLNLDLKEAKSWQKEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELA  352

Query  365  QAPLPPA  371
             +    A
Sbjct  353  TSSQQKA  359


>sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus 
OX=10090 GN=Kif21b PE=1 SV=2
Length=1668

 Score = 52.1 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/164 (13%), Positives = 69/164 (42%), Gaps = 5/164 (3%)

Query  148  SLLGELQESQSRLE----AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLR  203
             L+ EL+ SQ RL+       ++   L+ + R    +  ++      ++     + ++++
Sbjct  649  KLIDELENSQRRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIK  708

Query  204  MQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDL  263
               +     +  + Q     +++ A+L     +  +E    +++ V   ++ +   ++ +
Sbjct  709  ADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYEREL-KKLQAEVAEMKKAKVALMKQM  767

Query  264  KQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADI  307
            +++ Q+       +   I +LK+E  + +  +  +   K Q +I
Sbjct  768  REEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQEI  811


 Score = 32.5 bits (72),  Expect = 9.6, Method: Composition-based stats.
 Identities = 54/418 (13%), Positives = 140/418 (33%), Gaps = 75/418 (18%)

Query  26   VLGEESPLGKPAMLHLPSEQGAPETLQRC-LEENQELRDAIR-QSNQILRERCEELLHFQ  83
            V+GE+   G   +    +         R  ++  QE  DAI  +  Q++ +    LL   
Sbjct  409  VIGEDGTEGYSDLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKA  468

Query  84   ASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALRE-------------------  124
                E    L+  +    + +    LE   +     ++L                     
Sbjct  469  GDGNEAIGALIQNYIREIEELRTKLLESEAMNESLRRSLSRASARNPYSLGASPAGPAFG  528

Query  125  ------VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +E      ++  +D   +K +        Q  +S  + A K+   L+      +
Sbjct  529  GSPATSMEDASEVIRKAKQDLERLKKKEVR-----QRRKSPEKEAFKKRAKLQAENSEET  583

Query  179  EQARQLE------------------------SEREALQQQHSVQVDQLRMQGQ--SVEAA  212
            ++    E                        SE   +      +  ++  Q     +   
Sbjct  584  DENEAEEEEEERDESGCEEEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCE  643

Query  213  LRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQ----QLQ  268
            + ++++   E +    +LQ   HQ ++E    +++ +  ++ +R   L++L        +
Sbjct  644  IEIKQKLIDELENSQRRLQTLKHQ-YEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEE  702

Query  269  QAEEALVAKQEVIDKLKEEAEQ-HKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKE  327
            +A +     ++ + ++  + ++      E   +LK Q+       + ER+ ++  AE  E
Sbjct  703  KANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQS-------RYERELKKLQAEVAE  755

Query  328  LLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
            + + ++  +++    ++   Q    +E  R R +   +         + +  +   Q+
Sbjct  756  MKKAKVALMKQ----MREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQ  809


>sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus 
OX=9031 GN=MYO5A PE=1 SV=1
Length=1829

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 52/333 (16%), Positives = 126/333 (38%), Gaps = 39/333 (12%)

Query  29    EESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQRE  88
             E   + +   LH+  E    +  ++  E+N+E +  + + N +      E        R 
Sbjct  912   EARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLEITYSTE----TEKLRS  967

Query  89    EKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTS  148
             + E L    +EA+    R+    L L+ +  +  +E+   +  ++ + E     K +   
Sbjct  968   DVERLRMSEEEAKNATNRV----LSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQ  1023

Query  149   LLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQS  208
             L+ EL+E  + L+   +E          A E    +E +     +Q  + ++  R++ Q+
Sbjct  1024  LVSELKEQNTLLKTEKEELN--RRIHDQAKEITETMEKKLVEETKQLELDLNDERLRYQN  1081

Query  209   VEAALRMERQAASEEKRKLAQL-----------QVAYHQLFQEYDNH------------I  245
             +        +   + K ++  +              +     EY               +
Sbjct  1082  LLNEFSRLEERYDDLKDEMNLMVSIPKPGHKRTDSTHSSNESEYTFSSEITEAEDLPLRM  1141

Query  246   KSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQA  305
             +                L++++ + E+   + Q+ +D+ +E+A + K   E  P ++   
Sbjct  1142  EEPSEKKAPLDMSLFLKLQKRVTELEQEKQSLQDELDRKEEQALRAKAKEEERPPIRG--  1199

Query  306   DIYKADFQAERQAREKLAEKKELLQEQLEQLQR  338
                 A+ + E   R++L  + + L+ +L +LQ+
Sbjct  1200  ----AELEYESLKRQELESENKKLKNELNELQK  1228


>sp|Q6IFX3|K1C40_MOUSE Keratin, type I cytoskeletal 40 OS=Mus 
musculus OX=10090 GN=Krt40 PE=2 SV=1
Length=439

 Score = 51.8 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 50/305 (16%), Positives = 110/305 (36%), Gaps = 27/305 (9%)

Query  76   CEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLK-RQKEQALREVEHLKRCQQQ  134
            CEE   F ++++E  +FL  +     + V  L     +L+ R +EQ       +    Q+
Sbjct  80   CEE-GSFNSNEKETMQFLNDRLASYLERVRSLEENNAELECRIREQCEPNAPLVCPDYQR  138

Query  135  MAEDKASVKAQVTSLLGE--------------LQESQSRLEAATKECQALEGRARAASEQ  180
              +    ++ ++     E                + +S+ E+     Q +E         
Sbjct  139  YFDTIEELQQKILCTKAENSRLAVQVDNCKLAADDFRSKYESELSLRQLVENDITGLRGI  198

Query  181  ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASE------EKRKLAQLQVAY  234
              +L   +  L+       D L    +  E  + + R+   +      +      L    
Sbjct  199  LGELTLCKSDLEAHVESMKDDLICLKKGHEEEVNLLREQLGDRLSVELDTAPTVDLNKVL  258

Query  235  HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
             ++  +Y+  + ++   +E     Q E+L QQ + + E L   Q  + +LK +A   +I 
Sbjct  259  DEMRCQYERVLANNRRDAEEWFAAQTEELNQQQKSSAEQLEGCQTEMLELKRKANTLEIE  318

Query  295  METVPVLKAQADIYKADFQAERQAREK-----LAEKKELLQEQLEQLQREYSKLKASCQE  349
            ++    L    +   A+ +A+   +       +   +  L E    L+R+  + +     
Sbjct  319  LQAQQTLTESLECTVAETEAQYSTQLAQMQCLIDSVEHQLAEIRCDLERQNQEYQVLLDT  378

Query  350  SARIE  354
             AR+E
Sbjct  379  KARLE  383


>sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries 
OX=9940 GN=CTTNBP2 PE=3 SV=1
Length=1641

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 66/349 (19%), Positives = 128/349 (37%), Gaps = 46/349 (13%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E  ++LE   K+  ALE       
Sbjct  172  ------LMLVKECKQ--------LSGKVLEEAQKLEEVMAKLEEEKKKTSALE-------  210

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
            E+    +     ++ Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  211  EELATEKRRSAEMEAQMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE--VIDKLKEEAEQHKIVME  296
            +  D+    S+    + R +        +  A E  + +      D + E AE  K +  
Sbjct  271  RGNDSKPSLSLPRKTKDRRLV------SISVATEGPMTRSVACQTDLVTETAEPLKKLPL  324

Query  297  TVPVLKAQADIY---------KADFQAERQAREKLAEKKELLQEQLEQL-QREYSKLKAS  346
            TVPV  A               A   + R   E+     +L+   L  +      +++ +
Sbjct  325  TVPVKPAAGSPLVSASAKGNACASAASVRPGIERQVSHGDLIGSSLPTVPPPSTDRIEEN  384

Query  347  CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDF  395
               +    D+       +  P   +PA   +P   P    SP    P  
Sbjct  385  GPSTGSTPDLTS---SPTALPSTVSPASGHTPTPPPHSLHSPCANAPLH  430


>sp|Q0VF96|CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens 
OX=9606 GN=CGNL1 PE=1 SV=2
Length=1302

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 50/308 (16%), Positives = 116/308 (38%), Gaps = 11/308 (4%)

Query  83   QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASV  142
            Q + +EE+E +    +E R        E   L+++ E++  E+        Q+  ++   
Sbjct  637  QQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQH  696

Query  143  KAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQL  202
            + ++  L  +L E    L++A +     +G       QA+Q   +    +++    + + 
Sbjct  697  QTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAKEEQEDLLRKR  756

Query  203  RMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLED  262
              +  +++ AL+ E  +  +E            +L ++YD  +++     E       E 
Sbjct  757  ERELTALKGALKEEVSSHDQE----------MDKLKEQYDAELQALRESVEEATKNV-EV  805

Query  263  LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL  322
            L  +   +E+     +  +  L+EE E+ +   E +    AQ      D + +    ++ 
Sbjct  806  LASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEELERRVAQLQRQIEDLKGDEAKAKET  865

Query  323  AEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALP  382
             +K E    QLE+      K +     + R  +      + + +        LS  L   
Sbjct  866  LKKYEGEIRQLEEALVHARKEEKEAVSARRALENELEAAQGNLSQTTQEQKQLSEKLKEE  925

Query  383  SQRRSPPE  390
            S+++    
Sbjct  926  SEQKEQLR  933


 Score = 50.6 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 60/317 (19%), Positives = 125/317 (39%), Gaps = 16/317 (5%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
            LQR L+   + +  I++  + +R   EEL      + EE   L  + +E+   + +   E
Sbjct  626  LQRQLQLEVKNQQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLEESEGELRKNLEE  685

Query  111  KLDLKRQKEQALREV----EHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKE  166
               +K ++EQ   E+    + L     ++   K S   +  +L+ EL +++  L+     
Sbjct  686  LFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIA  745

Query  167  CQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRK  226
             +  E   R    +   L+   +     H  ++D+L+ Q  +   ALR     + EE  K
Sbjct  746  KEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQYDAELQALR----ESVEEATK  801

Query  227  LAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKE  286
              ++  +     ++     +  V   + +     E L+ + ++ E  +   Q  I+ LK 
Sbjct  802  NVEVLASRSNTSEQDQAGTEMRVKLLQEEN----EKLQGRSEELERRVAQLQRQIEDLKG  857

Query  287  EAEQHKIVMETVPVLKAQADIYKADFQAER----QAREKLAEKKELLQEQLEQLQREYSK  342
            +  + K  ++       Q +      + E      AR  L  + E  Q  L Q  +E  +
Sbjct  858  DEAKAKETLKKYEGEIRQLEEALVHARKEEKEAVSARRALENELEAAQGNLSQTTQEQKQ  917

Query  343  LKASCQESARIEDMRKR  359
            L    +E +  ++  +R
Sbjct  918  LSEKLKEESEQKEQLRR  934


 Score = 49.5 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 66/285 (23%), Positives = 119/285 (42%), Gaps = 13/285 (5%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             E L +  ++ Q+L  A  +   +LR+R  EL   + + +EE   +    QE  KL E+  
Sbjct  730   EELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEE---VSSHDQEMDKLKEQYD  786

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              E   L+   E+A + VE L        +D+A  + +V  L  E ++ Q R E       
Sbjct  787   AELQALRESVEEATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEE------  840

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              LE R      Q   L+ +    ++       ++R   +++  A + E++A S  +    
Sbjct  841   -LERRVAQLQRQIEDLKGDEAKAKETLKKYEGEIRQLEEALVHARKEEKEAVSARRALEN  899

Query  229   QLQVAYHQLFQEYDNHIKSSVV-GSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEE  287
             +L+ A   L Q      + S     E ++  QL  LK +++     L    E +   KE 
Sbjct  900   ELEAAQGNLSQTTQEQKQLSEKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQ--KEM  957

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQ  332
             A+  +    +   L+ Q D YK   + E    ++  ++K L  E+
Sbjct  958   ADIVEASRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTLEAEK  1002


 Score = 46.4 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 52/325 (16%), Positives = 136/325 (42%), Gaps = 21/325 (6%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             ++  EE+++     R  N++  ER       +  Q+E  + +        +L  +L   K
Sbjct  920   EKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQKEMADIVEASRTSTLELQNQLDEYK  979

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
                +R+  +  R+++      ++       ++ ++  +  EL++ Q   + A  + Q LE
Sbjct  980   EKNRRELAEMQRQLKEKTLEAEKSRLTAMKMQDEMRLMEEELRDYQRAQDEALTKRQLLE  1039

Query  172   GRARAASEQA---RQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
                +    +      L+ +R  L +Q   +V QL M+ +       +  +  S  + ++ 
Sbjct  1040  QTLKDLEYELEAKSHLKDDRSRLVKQMEDKVSQLEMELEEERNNSDLLSERISRSREQME  1099

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEA-LVAKQEVIDKLKEE  287
             QL+   ++L QE     +  +   +     Q +DLK ++   E +   +K+ ++ +++  
Sbjct  1100  QLR---NELLQE--RAARQDLECDKISLERQNKDLKSRIIHLEGSYRSSKEGLVVQMEAR  1154

Query  288   AEQHKIVMETVPVLKAQADIYKADFQAERQARE----------KLAEKKELLQEQLEQLQ  337
               + +  +E+    +A   +  ++ + ER+ +E           L ++K+ L  +L+ ++
Sbjct  1155  IAELEDRLESEERDRANLQL--SNRRLERKVKELVMQVDDEHLSLTDQKDQLSLRLKAMK  1212

Query  338   REYSKLKASCQESARIEDMRKRHVE  362
             R+  + +         +   +R +E
Sbjct  1213  RQVEEAEEEIDRLESSKKKLQRELE  1237


 Score = 46.4 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 55/331 (17%), Positives = 133/331 (40%), Gaps = 22/331 (7%)

Query  62    RDAIRQSNQILRERCEELLHFQASQREE---KEFLMCKFQEARKLVERLGLEKLDLKRQK  118
             ++ +++    +R+  E L+H +  ++E    +  L  + + A+  + +   E+  L  + 
Sbjct  863   KETLKKYEGEIRQLEEALVHARKEEKEAVSARRALENELEAAQGNLSQTTQEQKQLSEKL  922

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGEL----QESQSRLEAATKECQALEGRA  174
             ++   + E L+R + +M  ++  +   +  L  E+    + S++       +    + + 
Sbjct  923   KEESEQKEQLRRLKNEMENERWHLGKTIEKLQKEMADIVEASRTSTLELQNQLDEYKEKN  982

Query  175   RAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAY  234
             R    + ++   E+    ++  +   +++ + + +E  LR  ++A  E   K   L+   
Sbjct  983   RRELAEMQRQLKEKTLEAEKSRLTAMKMQDEMRLMEEELRDYQRAQDEALTKRQLLEQTL  1042

Query  235   HQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV  294
               L  EY+   KS +     +   Q+ED   QL+              +L+EE     ++
Sbjct  1043  KDL--EYELEAKSHLKDDRSRLVKQMEDKVSQLEM-------------ELEEERNNSDLL  1087

Query  295   METVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIE  354
              E +   + Q +  + +   ER AR+ L   K  L+ Q + L+     L+ S + S    
Sbjct  1088  SERISRSREQMEQLRNELLQERAARQDLECDKISLERQNKDLKSRIIHLEGSYRSSKEGL  1147

Query  355   DMRKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
              ++             +     + L L ++R
Sbjct  1148  VVQMEARIAELEDRLESEERDRANLQLSNRR  1178


 Score = 44.8 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 49/296 (17%), Positives = 125/296 (42%), Gaps = 13/296 (4%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             +T+++  +E  ++ +A R S   L+ + +E   ++   R E   +  + +E     E+  
Sbjct  948   KTIEKLQKEMADIVEASRTSTLELQNQLDE---YKEKNRRELAEMQRQLKEKTLEAEKSR  1004

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             L  + ++ +      E+   +R Q +    +  ++  +  L  EL+      +  ++  +
Sbjct  1005  LTAMKMQDEMRLMEEELRDYQRAQDEALTKRQLLEQTLKDLEYELEAKSHLKDDRSRLVK  1064

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
              +E +      +  +  +  + L ++ S      R Q + +   L  ER A  + +    
Sbjct  1065  QMEDKVSQLEMELEEERNNSDLLSERISRS----REQMEQLRNELLQERAARQDLECDKI  1120

Query  229   QLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLE----DLKQQLQQAEEALVAKQEVIDKL  284
              L+   ++  +    H++ S   S+    +Q+E    +L+ +L+  E      Q    +L
Sbjct  1121  SLE-RQNKDLKSRIIHLEGSYRSSKEGLVVQMEARIAELEDRLESEERDRANLQLSNRRL  1179

Query  285   KEEAEQHKIVMETVPV-LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE  339
             + + ++  + ++   + L  Q D      +A ++  E+  E+ + L+   ++LQRE
Sbjct  1180  ERKVKELVMQVDDEHLSLTDQKDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRE  1235


 Score = 40.6 bits (93),  Expect = 0.033, Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 92/243 (38%), Gaps = 12/243 (5%)

Query  137  EDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHS  196
            E K+ +  +V  L  +LQ      +   +E + +         Q  +   E   LQQ+  
Sbjct  614  EQKSKLTIEVAELQRQLQLEVKNQQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLE  673

Query  197  VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
                +LR   + +   ++MER+    E R L            E  + + S+    +R++
Sbjct  674  ESEGELRKNLEELF-QVKMEREQHQTEIRDL-------QDQLSEMHDELDSAKRSEDREK  725

Query  257  GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ----HKIVMETVPVLKAQADIYKADF  312
            G  +E+L Q  Q  ++ L+AK+E  D L++   +       + E V     + D  K  +
Sbjct  726  GALIEELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDKLKEQY  785

Query  313  QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAP  372
             AE QA  +  E+     E L        + +A  +   ++       ++     L    
Sbjct  786  DAELQALRESVEEATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEELERRV  845

Query  373  AYL  375
            A L
Sbjct  846  AQL  848


>sp|Q0J9V3|KN14H_ORYSJ Kinesin-like protein KIN-14H OS=Oryza sativa 
subsp. japonica OX=39947 GN=KIN14H PE=2 SV=1
Length=788

 Score = 51.8 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 86/232 (37%), Gaps = 16/232 (7%)

Query  72   LRERCEELLHFQASQREEKEFLMCKF--QEARKLVERLGLEKLDLKRQKEQALREVEHLK  129
            L    EEL     +   + + L   F  ++A +++     EK   ++Q+E A   ++ L 
Sbjct  142  LSSDLEELKAAHLNLTRQCDSLEESFNKEKADRMLAVESYEKE--RQQRESAEASLDLLS  199

Query  130  RCQQQMAEDKASVKAQVTSLL---GELQESQSRLEAATKECQALEGRARAASEQARQLES  186
               ++++ +      Q+  +      LQE  + L+      QA   ++     + ++ +S
Sbjct  200  VDLERVSHEAKRFSEQLKMVQDTNKRLQEYNTSLQQYNSNLQADASKSGDIISKLQKEKS  259

Query  187  EREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK  246
                         + ++    S   + +   +   +  +++  L++  HQ+ ++ D  + 
Sbjct  260  AMMETMASLKDLNNSMKNHLDSSRTSQQEAIRMKEQLMKEVDCLRIELHQIREDRDQSVS  319

Query  247  S---------SVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAE  289
                      +      K     E L  ++   EE    +QE I  L+++  
Sbjct  320  QVNTLSAELANYKELAGKSTKDCESLSVKVSAFEETCSMQQEQIQTLQKQLA  371


 Score = 40.2 bits (92),  Expect = 0.035, Method: Composition-based stats.
 Identities = 47/278 (17%), Positives = 113/278 (41%), Gaps = 30/278 (11%)

Query  73   RERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQ  132
            RE  E LL  +   + + ++   + ++  + +++L          ++  L E E L+   
Sbjct  70   REDVERLLAEKMKGKSKTDY-KGRTEQMSEYIKKLRACIRWYIELEDGYLVEQEKLRSTM  128

Query  133  QQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQ  192
                   A ++AQ++S L EL+ +   L   T++C +LE       E+A ++ +     +
Sbjct  129  DAENAQHAKLEAQLSSDLEELKAAHLNL---TRQCDSLEE--SFNKEKADRMLAVESYEK  183

Query  193  QQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGS  252
            ++   +  +  +   SV+            E+ K+ Q     ++  QEY+  ++      
Sbjct  184  ERQQRESAEASLDLLSVDLERVSHEAKRFSEQLKMVQ---DTNKRLQEYNTSLQQYN---  237

Query  253  ERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF  312
                     +L+    ++ + +   Q+    +          MET+  LK   +  K   
Sbjct  238  --------SNLQADASKSGDIISKLQKEKSAM----------METMASLKDLNNSMKNHL  279

Query  313  QAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES  350
             + R ++++    KE L ++++ L+ E  +++    +S
Sbjct  280  DSSRTSQQEAIRMKEQLMKEVDCLRIELHQIREDRDQS  317


 Score = 37.1 bits (84),  Expect = 0.35, Method: Composition-based stats.
 Identities = 42/259 (16%), Positives = 101/259 (39%), Gaps = 33/259 (13%)

Query  51   LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
                L+  Q+    +++ N  L++    L    +   +    ++ K Q+ +  +      
Sbjct  212  FSEQLKMVQDTNKRLQEYNTSLQQYNSNLQADASKSGD----IISKLQKEKSAMMETMAS  267

Query  111  KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
              DL    +     ++  +  QQ+    K  +  +V  L  EL + +   + +  +   L
Sbjct  268  LKDLNNSMKN---HLDSSRTSQQEAIRMKEQLMKEVDCLRIELHQIREDRDQSVSQVNTL  324

Query  171  EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                   S +    +     L  + +   + L ++  + E    M+++     +++LA  
Sbjct  325  -------SAELANYKE----LAGKSTKDCESLSVKVSAFEETCSMQQEQIQTLQKQLA--  371

Query  231  QVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQ  290
             VA ++L       I++     E+   + ++DL+++L  AE  +V      DKL+++   
Sbjct  372  -VATNKLKLADVTAIEAMTGYEEQ--KVIIKDLEERLASAEFQIV----EADKLRKKL--  422

Query  291  HKIVMETVPVLKAQADIYK  309
            H  ++E    LK    ++ 
Sbjct  423  HNTILE----LKGNIRVFC  437


>sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela 
putorius furo OX=9669 GN=CTTNBP2 PE=3 SV=1
Length=1645

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 46/294 (16%), Positives = 108/294 (37%), Gaps = 39/294 (13%)

Query  98   QEARKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQV  146
            + A+K  +   L K +L+        E+E           R ++   +++    ++    
Sbjct  25   EAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPF  84

Query  147  TSLLGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRM  204
             +L  + +      E        L       A   + ++  S + A  +    +++  ++
Sbjct  85   LALQRDYEAGAGEKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKL  144

Query  205  QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
            Q Q +E   +       EE+ K        H +        + S    +  +   LED+ 
Sbjct  145  QLQGLEQEHKQLAARLEEERGK------NKHVVLMLVKECKQLSGKVLDEAQK--LEDVL  196

Query  265  QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLA  323
             +L++ ++     +E +   K ++ + +          AQ +   ++F  ER Q R KL 
Sbjct  197  ARLEEEKKKTGTLEEQLSAEKRKSTEME----------AQMEKQLSEFDTEREQLRAKLH  246

Query  324  EKKEL---LQEQLEQLQREYSKLKASCQESARIEDMR----KRHVEVSQAPLPP  370
             ++     L+E+++++++   +LK        +   R    +R V +S     P
Sbjct  247  REEAHTTDLKEEIDKMKKMIEQLKRGNDSKPSLSLPRKTKDRRSVSISVGTEGP  300


>sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens OX=9606 GN=MYH8 
PE=1 SV=3
Length=1937

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 64/334 (19%), Positives = 120/334 (36%), Gaps = 14/334 (4%)

Query  51    LQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLE  110
               R L+E   L   + +S Q   ++ EEL H    + + K  L    Q +R         
Sbjct  1290  YSRQLDEKDALVSQLSRSKQASTQQIEELKHQLEEETKAKNALAHALQSSRH--------  1341

Query  111   KLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQAL  170
               D    +EQ   E E     Q+ +++  + V    T    +  +    LE A K+    
Sbjct  1342  --DCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR  1399

Query  171   EGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQL  230
                A    E      +  E  +Q+   +V+ L +  +   AA     +      + L++ 
Sbjct  1400  LQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEW  1459

Query  231   QVAYHQLFQEYDNHIKSSVVGSERKRGM--QLEDLKQQLQQAEEALVAKQEVIDKLKEEA  288
             +  Y +   E +   K S   S     +    E+   QL+         Q+ I  L E+ 
Sbjct  1460  KQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQI  1519

Query  289   EQHKIVMETVPVLKAQADIYKADFQA--ERQAREKLAEKKELLQEQLEQLQREYSKLKAS  346
              +    +  +  +K Q +  K + QA  E        E+ ++L+ QLE  Q +    +  
Sbjct  1520  AEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKI  1579

Query  347   CQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLA  380
              ++   I+ +++ H  V +       A + S   
Sbjct  1580  AEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRND  1613


 Score = 50.6 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 60/364 (16%), Positives = 152/364 (42%), Gaps = 20/364 (5%)

Query  48    PETLQRCLEENQELRDAIRQSNQIL---RERCEELLHFQASQREEKEFLMCKFQEARKLV  104
              E +   L+E  +L+  ++     L    ERCE+L+  +     + + +  + +E  ++ 
Sbjct  877   EEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEIN  936

Query  105   ERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               L  +K  L+ +  +  ++++ L+    ++ ++K + + +V +L  E+      +   +
Sbjct  937   AELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLS  996

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK  224
             KE +AL+   +   +  +  E +   L +  +    +L  Q   +E +L  E++   + +
Sbjct  997   KEKKALQETHQQTLDDLQAEEDKVNILTKAKT----KLEQQVDDLEGSLEQEKKLRMDLE  1052

Query  225   RKLAQLQVAYHQLFQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVI  281
             R   +L+    +L QE    +++     +    K+  ++ +L  +++  +   +  Q+ I
Sbjct  1053  RAKRKLEGDL-KLAQESTMDMENDKQQLDEKLEKKEFEISNLISKIEDEQAVEIQLQKKI  1111

Query  282   DKLKEEAEQHKIVMETVPVLKAQADIYKADFQAE-RQAREKLAEKKELLQEQLEQLQREY  340
              +L+   E+    +E     +A+A+  ++D   E  +  E+L E       Q+E  ++  
Sbjct  1112  KELQARIEELGEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVELNKKRE  1171

Query  341   SKL--------KASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEP  392
             ++         +A+ Q  A +  +RK+H +                  L  ++     E 
Sbjct  1172  AEFQKLRRDLEEATLQHEAMVAALRKKHADSMAELGEQIDNLQRVKQKLEKEKSELKMET  1231

Query  393   PDFC  396
              D  
Sbjct  1232  DDLS  1235


 Score = 42.1 bits (97),  Expect = 0.010, Method: Composition-based stats.
 Identities = 65/350 (19%), Positives = 135/350 (39%), Gaps = 21/350 (6%)

Query  48    PETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERL  107
               +L++  +   +L  A R+    L+   E  +  +  +++  E L  K  E   L+ ++
Sbjct  1038  EGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLDEKLEKKEFEISNLISKI  1097

Query  108   GLEKL---DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT  164
               E+     L+++ ++    +E L    +     +A  + Q + L  EL+E   RLE A 
Sbjct  1098  EDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRSDLSRELEEISERLEEAG  1157

Query  165   KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME-------R  217
                 A     +    + ++L  + E    QH   V  LR +     A L  +       +
Sbjct  1158  GATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHADSMAELGEQIDNLQRVK  1217

Query  218   QAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAK  277
             Q   +EK +L            E  +  K ++    R    Q+ +LK + ++ +  +   
Sbjct  1218  QKLEKEKSELKMETDDLSS-NAEAISKAKGNLEKMCRSLEDQVSELKTKEEEQQRLINDL  1276

Query  278   QEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQ  337
                  +L+ EA ++   ++    L +Q            ++++   ++ E L+ QLE+  
Sbjct  1277  TAQRARLQTEAGEYSRQLDEKDALVSQLS----------RSKQASTQQIEELKHQLEEET  1326

Query  338   REYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRS  387
             +  + L  + Q S    D+ +   E  Q         LS   +  +Q R+
Sbjct  1327  KAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRT  1376


 Score = 41.4 bits (95),  Expect = 0.017, Method: Composition-based stats.
 Identities = 61/367 (17%), Positives = 139/367 (38%), Gaps = 49/367 (13%)

Query  48    PETLQRCLEENQELRDAIRQSN-------QILRERCEELLHFQASQREEKEFLMCKFQEA  100
              +T QR   E ++L   + +SN       +  R   + L  ++    E +  L    +E+
Sbjct  1418  EKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKES  1477

Query  101   RKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQE-----  155
             R L      E   +K   E++L ++E L+R  + + ++ + +  Q+     ++ E     
Sbjct  1478  RSL----STELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQIAEGGKQIHELEKIK  1533

Query  156   ---------SQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQ-  205
                       Q+ LE A    +  EG+      +  Q++SE +    +   ++DQL+   
Sbjct  1534  KQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNH  1593

Query  206   ---GQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ---  259
                 +++++ L  E ++ ++  R   +++   +++  + ++  + +       R  Q   
Sbjct  1594  TRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGIL  1653

Query  260   -------------LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQAD  306
                           EDLK+QL   E      Q  I++L    EQ +   +        A 
Sbjct  1654  KETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDAS  1713

Query  307   IYKADFQAERQA----REKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVE  362
                     +  +    ++KL      LQ ++E++ +E    +   +++     M    ++
Sbjct  1714  ERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELK  1773

Query  363   VSQAPLP  369
               Q    
Sbjct  1774  KEQDTSA  1780


 Score = 38.3 bits (87),  Expect = 0.15, Method: Composition-based stats.
 Identities = 84/416 (20%), Positives = 159/416 (38%), Gaps = 57/416 (14%)

Query  8     SQLCEMVQPSGGPAADQDVLGEESPLGKPAMLH-LPSEQGAPETLQRCLEENQE----LR  62
             SQL    Q S     +     EE    K A+ H L S +   + L+   EE QE    L+
Sbjct  1302  SQLSRSKQASTQQIEELKHQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQ  1361

Query  63    DAIRQSNQIL---RERCEELLHFQASQREE-KEFLMCKFQEARKLVERLGLEKLDLKRQK  118
              A+ ++N  +   R + E     +  + EE K+ L  + QEA + VE +  +   L++ K
Sbjct  1362  RALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTK  1421

Query  119   EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
             ++   EVE L    ++     A++  +  +    L E + + E    E +A +  +R+ S
Sbjct  1422  QRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLS  1481

Query  179   --------------EQARQLESEREALQQ-------------QHSVQVDQLRMQGQS---  208
                           +Q   L  E + LQQ             +   ++++++ Q +    
Sbjct  1482  TELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKC  1541

Query  209   --------VEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQL  260
                      EA+L  E       + +L Q++    +   E D  I        R      
Sbjct  1542  EIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQ  1601

Query  261   EDLKQQLQQAEEAL-VAKQEVIDKLKEEAEQHKIVMETVPVLK----AQADIYKADFQAE  315
               L  +++   +AL V K+   D  + E + +         L+     Q  + +     +
Sbjct  1602  STLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLD  1661

Query  316   RQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPA  371
                R +     E L+EQL  ++R  + L+A  +E     +  +R  ++++  L  A
Sbjct  1662  DALRGQ-----EDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDA  1712


 Score = 37.5 bits (85),  Expect = 0.25, Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 117/279 (42%), Gaps = 21/279 (8%)

Query  98    QEARKLVERLGL------EKLDLKRQKEQALREVEH-LKRCQQQMAEDKASVKAQVTSLL  150
             +E  ++ ERL         +++L +++E   +++   L+    Q     A+++ +    +
Sbjct  1144  RELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHADSM  1203

Query  151   GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE  210
              EL E    L+   ++ +  +   +  ++            +         L  Q   ++
Sbjct  1204  AELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVSELK  1263

Query  211   AALRMERQAASEEKRKLAQLQVAYHQLFQEYD--NHIKSSVVGSERKRGMQLEDLKQQLQ  268
                  +++  ++   + A+LQ    +  ++ D  + + S +  S++    Q+E+LK QL+
Sbjct  1264  TKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKHQLE  1323

Query  269   QAEE-------ALVAKQEVIDKLKEEAEQHKIVMETV--PVLKAQADIYKADFQAERQA-  318
             +  +       AL + +   D L+E+ E+ +     +   + KA +++ +   + E  A 
Sbjct  1324  EETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAI  1383

Query  319   --REKLAEKKELLQEQLEQLQREYSKLKASCQESARIED  355
                E+L E K+ L ++L++ +     + A C    + + 
Sbjct  1384  QRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQ  1422


 Score = 35.6 bits (80),  Expect = 1.0, Method: Composition-based stats.
 Identities = 42/287 (15%), Positives = 112/287 (39%), Gaps = 20/287 (7%)

Query  52    QRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK  111
             Q  L+E Q   D   +  + L+E+   +       + E E L    ++  +  +    E 
Sbjct  1650  QGILKETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQEL  1709

Query  112   LDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALE  171
             LD   + +    +   L   ++++  D + ++++V  ++ E + ++ + + A  +   + 
Sbjct  1710  LDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMA  1769

Query  172   GRARAASEQARQLESEREALQQQH------------------SVQVDQLRMQGQSVEAAL  213
                +   + +  LE  ++ L+Q                      Q+ +L  + + +E  +
Sbjct  1770  EELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEV  1829

Query  214   RMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQ--LEDLKQQLQQAE  271
               E++  +E  + L + +    +L  + +   K+ +   +    +Q  ++  K+Q ++AE
Sbjct  1830  ENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAE  1889

Query  272   EALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQA  318
             E   A      KL+ E E+ +   +       +  +   +   +  A
Sbjct  1890  EQSNANLSKFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKISA  1936


>sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces 
pombe (strain 972 / ATCC 24843) OX=284812 GN=tea3 
PE=1 SV=1
Length=1125

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 55/321 (17%), Positives = 131/321 (41%), Gaps = 27/321 (8%)

Query  45   QGAPETLQRCLEENQELRDAIRQ---SNQILRERCEELLHFQASQREEKEFLMCKFQEAR  101
            QG  E      ++N EL+  ++Q   ++++L+ R E+L         + + L   F+E  
Sbjct  663  QGTLEEATSYYQKNTELQQLLKQNESASELLKSRNEKLCV-------DYDKLRSVFEEDS  715

Query  102  KLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
              +  L  E  +L+ Q  Q   E+   +   + +      ++ ++  +   ++   + +E
Sbjct  716  SKILSLQKENENLQSQILQISEELVDYRSRCEALEYGNYELETKLIEMHDRVEMQTNVIE  775

Query  162  AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRME--RQA  219
            A+            +  +  R+   E+  LQQ        L +Q +     + +E  +  
Sbjct  776  ASASALDVSNTAILSFEDSLRRERDEKSTLQQ------KCLNLQYEYENVRIELENLQSR  829

Query  220  ASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQE  279
            A E +  L Q          +Y   I  S +        + +D  ++  ++++ +   + 
Sbjct  830  ALELESALEQSVSD-----AKYSKAIMQSGLSKLLSSINENKDNLKEFSKSKQKISYLES  884

Query  280  VIDKLKEEAEQHKIVME--TVPVLKAQADIY--KADFQAERQAREKLAEKKELLQEQLEQ  335
             ++ L E   + + + E  T  +L +Q  +Y  K  + +    + KL+++   L EQ + 
Sbjct  885  QLEGLHELLRESQRLCEGRTKELLNSQQKLYDLKHSYSSVMTEKSKLSDQVNDLTEQAKI  944

Query  336  LQREYSKLKASCQESARIEDM  356
             QR+ S+++ +  +S   + +
Sbjct  945  TQRKLSEVQIALADSKMNQQL  965


>sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix 
albiventris OX=9368 GN=CTTNBP2 PE=3 SV=1
Length=1654

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 105/278 (38%), Gaps = 35/278 (13%)

Query  98   QEARKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQV  146
            + A+K  +   L K +L+        E+E           R ++   +++    ++    
Sbjct  25   EPAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPF  84

Query  147  TSLLGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRM  204
             +L  + +      E        L       A   + ++  S + A  +    +++  ++
Sbjct  85   LALQRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKL  144

Query  205  QGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK  264
            Q Q++E   +       EE+ K        H +        + S    E  +   L+++ 
Sbjct  145  QLQALEQEHKKLSACLDEERNK------NKHVVLMLVKECKQLSGKVIEEAQK--LDEVM  196

Query  265  QQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLA  323
             +L++ ++   A +E +   K+ + + +          AQ +   ++F  ER Q R KL 
Sbjct  197  TKLEEEKKKTTALEEELSAEKQRSTEME----------AQMEKQLSEFDTEREQLRAKLH  246

Query  324  EKKEL---LQEQLEQLQREYSKLKASCQESARIEDMRK  358
             ++     L+E+++++++   +LK        +   RK
Sbjct  247  REEAHTADLKEEIDKMKKMIEQLKRGSDSKPGLSLPRK  284


>sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium 
discoideum OX=44689 GN=kif1 PE=1 SV=1
Length=2205

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 52/352 (15%), Positives = 117/352 (33%), Gaps = 40/352 (11%)

Query  83    QASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ---------------------A  121
             QA+  E+++  +      RK+ E    E    K+Q E+                      
Sbjct  1597  QANSVEDRDKWVQTLDPLRKVTELKDEELRTAKQQIEKSSSQLDQIKSQLQTGQQIVLAK  1656

Query  122   LREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT----KECQALEGRARAA  177
              +E+E L     Q+  +K     Q   L  E+Q     LE       ++   L G+    
Sbjct  1657  QKEIEELTNTISQLQLEKEINTQQFDGLRDEIQNRDEELEQYKSQQSQKINQLSGQVNKL  1716

Query  178   SEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQL  237
                 ++ E    +L    +     + +  +  ++   +        + +  QL+    QL
Sbjct  1717  ENVTQEKELTIGSLSSTLNNTNQIIELINEQSKSYKNVAEMEIESLRDETTQLRET-SQL  1775

Query  238   FQEYDNHIKSSVVGSE---RKRGMQLEDLKQQLQQAEEALVAKQEVIDKLK--EEAEQHK  292
                     +SS+  +E    +R +++  LK  L Q EE+       +  L+  +  +Q +
Sbjct  1776  LANRLKECRSSIQSAESLLSERDLEITQLKALLTQQEESSGITSLNLKNLQSDQTMKQGQ  1835

Query  293   IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE---  349
             I + +  V ++ A I     Q +   +   ++ +++        + E  +LK    +   
Sbjct  1836  IDILSKTVQQSTATIQNISSQLDSTTKASDSKDEQITSINSAY-KDESDRLKDQTTQLNS  1894

Query  350   -----SARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFC  396
                    ++  + + H++  +         L     +        +   D  
Sbjct  1895  LTTNLRQQMRSLEQTHLQQKETSASDQKTLLLLLHDMEQGLTRASQTITDQS  1946


 Score = 46.8 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 49/350 (14%), Positives = 125/350 (36%), Gaps = 19/350 (5%)

Query  50    TLQRCLEENQELRDAIR---QSNQIL----RERCEELLHFQASQREEKEFLMCKFQEARK  102
             T ++ +E++    D I+   Q+ Q +    ++  EEL +  +  + EKE    +F   R 
Sbjct  1627  TAKQQIEKSSSQLDQIKSQLQTGQQIVLAKQKEIEELTNTISQLQLEKEINTQQFDGLRD  1686

Query  103   LVERLGLEKLDLKRQKEQALREVE-HLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLE  161
              ++    E    K Q+ Q + ++   + + +    E + ++ +  ++L    Q  +   E
Sbjct  1687  EIQNRDEELEQYKSQQSQKINQLSGQVNKLENVTQEKELTIGSLSSTLNNTNQIIELINE  1746

Query  162   AATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAA-  220
              +       E    +  ++  QL    + L  +       +    +S+ +   +E     
Sbjct  1747  QSKSYKNVAEMEIESLRDETTQLRETSQLLANRLKECRSSI-QSAESLLSERDLEITQLK  1805

Query  221   -----SEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALV  275
                   EE   +  L +   Q  Q         +  + ++    ++++  QL    +A  
Sbjct  1806  ALLTQQEESSGITSLNLKNLQSDQTMKQGQIDILSKTVQQSTATIQNISSQLDSTTKASD  1865

Query  276   AKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLA-EKKELLQEQLE  334
             +K E I  +      +K   + +     Q +    + + + ++ E+   ++KE      +
Sbjct  1866  SKDEQITSIN---SAYKDESDRLKDQTTQLNSLTTNLRQQMRSLEQTHLQQKETSASDQK  1922

Query  335   QLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQ  384
              L      ++     +++    +   V V +  L  +         +  Q
Sbjct  1923  TLLLLLHDMEQGLTRASQTITDQSAQVTVLKKQLEDSKKSNEQLPTVEKQ  1972


>sp|F4HWY6|MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 
GN=XI-E PE=3 SV=1
Length=1529

 Score = 52.1 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/192 (22%), Positives = 80/192 (42%), Gaps = 19/192 (10%)

Query  62    RDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQA  121
             R  +RQ     RE          + +E K+ L  K +E   L  R  LEK      +E+ 
Sbjct  874   RRELRQLKMASRE--------TGALKEAKDMLEKKVEE---LTYRAQLEKRSRVDLEEEK  922

Query  122   LREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA---TKECQALEGRARAAS  178
              +E   +K+ Q  + E +  V      L+ E + ++  +E A     E Q L    +   
Sbjct  923   NQE---IKKLQSSLEEMRKKVDETNGLLVKEREAAKKAIEEAPPVVTETQVLVEDTQKIE  979

Query  179   EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
                 ++E  +  L+Q+     D  R   ++ E++    ++   + ++K  QLQ +  +L 
Sbjct  980   ALTEEVEGLKANLEQEKQRADDATRKFDEAQESS-EDRKKKLEDTEKKAQQLQESVTRL-  1037

Query  239   QEYDNHIKSSVV  250
             +E  N+++S   
Sbjct  1038  EEKCNNLESENK  1049


>sp|Q2KN96|CYTSA_XENTR Cytospin-A OS=Xenopus tropicalis OX=8364 
GN=specc1l PE=2 SV=1
Length=1101

 Score = 51.8 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 54/303 (18%), Positives = 112/303 (37%), Gaps = 36/303 (12%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            +Q    +L+   ++N++ +D IR     L+ER   +     +++  K+ L    +E +  
Sbjct  491  QQHLSNSLKMAEQDNKDAQDVIR----ALKERNHHMERIAEAEQLSKQALAATLEEYKAT  546

Query  104  VERLGLEKLDLKRQKEQALREV------------EHLKRCQQQMAEDKASVKAQVTSLLG  151
            +     E   LK   EQ  + V             H++   + +  DK   ++  +SL  
Sbjct  547  LNSEQGECARLKALLEQEKQRVAELYSIHSSGDASHIQNLLESVRSDKEKAESLASSLQE  606

Query  152  ELQESQSRLEAATKECQALEGRARAASEQAR---------------QLESEREALQQQHS  196
            EL  +++ +         LE   RA  E+A+               +LE +   L     
Sbjct  607  ELLHARTDVNRMQDAFGKLEDEYRAFREEAQKQVSELTLALEKVRHELEEKETELSDMKE  666

Query  197  VQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKR  256
              + +L  + +   A    +    S+ +  + +LQ   H + +E    +   +     + 
Sbjct  667  -TIFELEDEVEQHRAVKLHDNLIISDVENAVKKLQDQKHDMERE-IKILNRKLREESAEW  724

Query  257  GMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER  316
                 DL+  +  A +     QE I +LK +    +  +E    L  + +   +  Q E 
Sbjct  725  RQFQADLQTAVVIANDIKSEAQEEIGELKRQL---QEALEKNEKLAKEMENATSRKQEEE  781

Query  317  QAR  319
            + R
Sbjct  782  RGR  784


 Score = 33.3 bits (74),  Expect = 5.9, Method: Composition-based stats.
 Identities = 61/389 (16%), Positives = 132/389 (34%), Gaps = 54/389 (14%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEE-------------------------LLHFQ  83
            E LQ+   EN+ L+D +      L ++ ++                             +
Sbjct  233  EELQQLKSENRMLKDRLNALGFSLGQQPDDPDKLYGFQSLGINPGSHSDCGGGTLTSSVE  292

Query  84   ASQREEKEFLMCKFQEARK------LVERLGLEKLDLKRQKEQALREVEHLKRCQQQ---  134
             S     E L+ + +           ++ L  E  ++ +    +   ++      +    
Sbjct  293  GSAPGSMEDLLSQDESTLTGERRSSSMDNLDSECSEVYQPLTSSDDALDAPSSSSESEGL  352

Query  135  -------MAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESE  187
                         + +  V  L   + + +    +  +E QA         +  ++L SE
Sbjct  353  PSTERSRKGSSGNASEVSVACLTERIHQMEENQHSTAEELQATLQELADLQQITQELNSE  412

Query  188  REALQQQHSVQVDQLRMQGQSVEA-ALRMERQAASEEKRKLAQLQVA------YHQLFQE  240
             E L ++  + +D L  Q   +E  + ++E   A  ++  +A           Y  L Q 
Sbjct  413  NERLGEEKVILMDSLCQQSDKLELFSRQLEYAQALLDEHHIAYSLDEDLKSSRYLDLEQR  472

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            Y +  ++     E+  G+Q + L   L+ AE+     Q+VI  LKE     + + E   +
Sbjct  473  YMDLAENGRFEREQLLGVQ-QHLSNSLKMAEQDNKDAQDVIRALKERNHHMERIAEAEQL  531

Query  301  ----LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDM  356
                L A  + YKA   +E+    +L    E  ++++ +L   +S    +      +E +
Sbjct  532  SKQALAATLEEYKATLNSEQGECARLKALLEQEKQRVAELYSIHSS-GDASHIQNLLESV  590

Query  357  RKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
            R    +            L +   +   +
Sbjct  591  RSDKEKAESLASSLQEELLHARTDVNRMQ  619


>sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus 
OX=9685 GN=CTTNBP2 PE=3 SV=1
Length=1658

 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 40/201 (20%), Positives = 84/201 (42%), Gaps = 25/201 (12%)

Query  63   DAIRQSNQILRERCE-ELLHFQASQRE---EKEFLMCKFQEARKLVERLGLEKLDLKRQK  118
            +A+    + ++ER   +L   ++ Q++   EK  L    QE +KL  RL  E+   K   
Sbjct  112  EAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQAVEQEHQKLAARLEEERGKNKHVV  171

Query  119  EQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAAS  178
                  +  +K C+Q        +  +V     +L+E  ++LE    +  ALE    A  
Sbjct  172  ------LMLVKECKQ--------LSGKVIEEAQKLEEVMAKLEEEKTKTSALEEELSAEK  217

Query  179  EQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLF  238
             ++ ++E+       Q   Q+ +   + + + A L  E    ++ K ++ +++    QL 
Sbjct  218  RRSTEMEA-------QMEKQLSEFDTEREQLRAKLHREEAHTTDLKEEIDKMKKMIEQLK  270

Query  239  QEYDNHIKSSVVGSERKRGMQ  259
            +  D+    S+    + R + 
Sbjct  271  RGNDSKPSLSLPRKTKDRRVV  291


 Score = 48.7 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 101/275 (37%), Gaps = 35/275 (13%)

Query  101  RKLVERLGLEKLDLKRQKEQALREVE--------HLKRCQQQMAEDKA---SVKAQVTSL  149
            +K  +   L K +L+        E+E           R ++   +++    ++     +L
Sbjct  28   KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL  87

Query  150  LGELQESQSRLEAATKECQALE--GRARAASEQARQLESEREALQQQHSVQVDQLRMQGQ  207
              + +      E        L       A   + ++  S + A  +    +++  ++Q Q
Sbjct  88   QRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ  147

Query  208  SVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQL  267
            +VE   +       EE+ K        H +        + S    E  +   LE++  +L
Sbjct  148  AVEQEHQKLAARLEEERGK------NKHVVLMLVKECKQLSGKVIEEAQK--LEEVMAKL  199

Query  268  QQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER-QAREKLAEKK  326
            ++ +    A +E +   K  + + +          AQ +   ++F  ER Q R KL  ++
Sbjct  200  EEEKTKTSALEEELSAEKRRSTEME----------AQMEKQLSEFDTEREQLRAKLHREE  249

Query  327  EL---LQEQLEQLQREYSKLKASCQESARIEDMRK  358
                 L+E+++++++   +LK        +   RK
Sbjct  250  AHTTDLKEEIDKMKKMIEQLKRGNDSKPSLSLPRK  284


>sp|A7YWM2|K1C40_BOVIN Keratin, type I cytoskeletal 40 OS=Bos 
taurus OX=9913 GN=KRT40 PE=2 SV=1
Length=431

 Score = 51.4 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 51/299 (17%), Positives = 106/299 (35%), Gaps = 26/299 (9%)

Query  82   FQASQREEKEFLMCKFQEARKLVERLGLEKLDLK-RQKEQALREVEHLKRCQQQMAEDKA  140
            F ++++E  +FL  +     + V  L     +L+ R +EQ   +V  +    Q   +   
Sbjct  85   FNSNEKETMQFLNDRLASYLEKVRGLEELNAELECRIREQCEEDVPLVCPDYQCYFDTIE  144

Query  141  SVKAQVTSLLGE--------------LQESQSRLEAATKECQALEGRARAASEQARQLES  186
             ++ ++     E                + +S+ E+     Q +E           +L  
Sbjct  145  DLQQKILCTKAENCRLAVQLDNCKLAADDFRSKYESELSLRQLVETDISGLRGILGELTV  204

Query  187  EREALQQQHSVQVDQLRMQGQSVEAALRM------ERQAASEEKRKLAQLQVAYHQLFQE  240
             R  L+       D L    +S E  + +      +R +   +      L     ++  +
Sbjct  205  CRSDLEAHVESLKDDLLCLKKSHEEEVNVLRGQLGDRLSVELDTAPTTDLNRVLDEMRCQ  264

Query  241  YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV  300
            Y+  + ++    E     Q E+L QQ   + E L   Q  I +LK  A   +I ++    
Sbjct  265  YETVLANNRRDVEEWFAAQTEELNQQQLSSAEQLQGCQTEILELKRTANTLEIELQAQQS  324

Query  301  LKAQADIYKADFQAERQAREK-----LAEKKELLQEQLEQLQREYSKLKASCQESARIE  354
            L    +   A+ +A+  +        +   +  L E    L+R+  + +      AR+E
Sbjct  325  LTESLECTVAETEAQYSSELAQIQCLIDNVENQLAEIRCDLERQNQEYRVLLDTKARLE  383


>sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 
GN=Itsn1 PE=1 SV=2
Length=1714

 Score = 51.8 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 61/353 (17%), Positives = 143/353 (41%), Gaps = 24/353 (7%)

Query  49   ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
            E  +R   E ++ R A+ +  +  +ER  +L      +R+E+E    + +   +L ++L 
Sbjct  355  ENFERGSVELEKRRQALLEQQRKEQERLAQLER-AEQERKERERQEQERKRQLELEKQLE  413

Query  109  LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
             ++   ++++E+  +E+E  +  ++++   +     Q+       QE  ++     +   
Sbjct  414  KQRELERQREEERRKEIERREAAKRELERQR-----QLEWERNRRQELLNQRNKEQEGTV  468

Query  169  ALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLA  228
             L+ R +    +   L  ++  L+ +      +L  Q Q +E+  +      +E      
Sbjct  469  VLKARRKTLEFELEALNDKKHQLEGKLQDIRCRLATQRQEIESTNKSRELRIAEITHLQQ  528

Query  229  QLQVAYHQ----LFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKL  284
            QLQ +       + ++     +   V         L  LK+ L+  E A    +E +D++
Sbjct  529  QLQESQQMLGRLIPEKQILSDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLREQLDEV  588

Query  285  KEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK  344
            + E       ++ + V   Q    +     E  ++++L +++ L   +L+Q ++E   L+
Sbjct  589  ERETRSK---LQEIDVFNNQLKELR-----EIHSKQQLQKQRSLEAARLKQKEQERKSLE  640

Query  345  ASCQESARIEDMRKR------HVEVSQAPLPPAPAYLSSPLALPSQRRSPPEE  391
               Q+      +++R      HV+  + P P  P          S R+   EE
Sbjct  641  LEKQKEDAQRRVQERDKQWLEHVQQEEQPRPRKPHEEDRLKREDSVRKKEAEE  693


 Score = 43.3 bits (100),  Expect = 0.005, Method: Composition-based stats.
 Identities = 61/304 (20%), Positives = 114/304 (38%), Gaps = 36/304 (12%)

Query  73   RERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVE-HLKRC  131
            R R +ELL+ +  ++E    L  +    RK +E       D K Q E  L+++   L   
Sbjct  450  RNRRQELLNQRNKEQEGTVVLKAR----RKTLEFELEALNDKKHQLEGKLQDIRCRLATQ  505

Query  132  QQQMAEDKASVKAQVTSL---LGELQESQSRLEAATKECQALEGRARAASE---------  179
            +Q++     S + ++  +     +LQESQ  L     E Q L  + +   +         
Sbjct  506  RQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILSDQLKQVQQNSLHRDSLL  565

Query  180  QARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEK--------RKLAQLQ  231
              ++    +E  +QQ   Q+D++  + +S    + +      E +        +K   L+
Sbjct  566  TLKRALEAKELARQQLREQLDEVERETRSKLQEIDVFNNQLKELREIHSKQQLQKQRSLE  625

Query  232  VAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLK--QQLQQAEEALVAKQEVIDKLKEEAE  289
             A  +  ++    ++      + +R +Q  D +  + +QQ E+    K    D+LK E  
Sbjct  626  AARLKQKEQERKSLELEKQKEDAQRRVQERDKQWLEHVQQEEQPRPRKPHEEDRLKREDS  685

Query  290  QHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQE  349
              K   E     + Q D     F           ++   L  Q      E   L  S QE
Sbjct  686  VRKKEAEERAKPEMQ-DKQSRLFHP--------HQEPAKLATQAPWSTTEKGPLTISAQE  736

Query  350  SARI  353
            S ++
Sbjct  737  SVKV  740


>sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus 
OX=10090 GN=Cit PE=1 SV=3
Length=2055

 Score = 52.1 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 65/344 (19%), Positives = 135/344 (39%), Gaps = 9/344 (3%)

Query  44   EQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL  103
            EQ   E  Q   +  Q L D   QS ++   + +E        R     L      AR+ 
Sbjct  521  EQARMEVSQEDDKALQLLHDIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARR-  579

Query  104  VERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAA  163
              R  L + +L+  +  A         CQ ++ + K   K +V     +L++  +  +  
Sbjct  580  --RSDLYESELRESRLAAEEFKRKANECQHKLMKAKDQGKPEVGE-YSKLEKINAEQQLK  636

Query  164  TKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEE  223
             +E Q    +A  AS +A +L       +++   ++++L  +  S E   +   +A  EE
Sbjct  637  IQELQEKLEKAVKASTEATELLQNIRQAKERAERELEKLHNREDSSEGIKKKLVEA--EE  694

Query  224  KRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDK  283
            +R   + +V   +  +  +N +K  +     +     + + +  ++  EA V+ Q +   
Sbjct  695  RRHSLENKVKRLETMERRENRLKDDIQTKSEQIQQMADKILELEEKHREAQVSAQHLEVH  754

Query  284  LKEEAEQHKIVMETV--PVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYS  341
            LK++ + ++  ++ +   + K  AD    +   +R   E+  EK ++L EQ   +    S
Sbjct  755  LKQKEQHYEEKIKVLDNQIKKDLADKESLENMMQRH-EEEAHEKGKILSEQKAMINAMDS  813

Query  342  KLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQR  385
            K+++  Q    + +  K     S        A       L  Q+
Sbjct  814  KIRSLEQRIVELSEANKLAANSSLFTQRNMKAQEEMISELRQQK  857


 Score = 47.1 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 59/371 (16%), Positives = 132/371 (36%), Gaps = 12/371 (3%)

Query  49    ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLG  108
             + +Q   E+ Q++ D I +  +  RE      H +   +++++    K +     +++  
Sbjct  718   DDIQTKSEQIQQMADKILELEEKHREAQVSAQHLEVHLKQKEQHYEEKIKVLDNQIKKDL  777

Query  109   LEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQ  168
              +K  L+   ++   E     +   +      ++ +++ SL    ++    L  A K   
Sbjct  778   ADKESLENMMQRHEEEAHEKGKILSEQKAMINAMDSKIRSL----EQRIVELSEANKLAA  833

Query  169   ALEGRARAASEQARQLESEREALQQQHSVQVDQ