PSIBLAST 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: uniprot_sprot.fasta 571,282 sequences; 206,678,396 total letters Results from round 1 Query= sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score E Sequences producing significant alignments: (Bits) Value sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute res... 85.1 2e-23 sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus... 53.9 4e-11 sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus... 53.9 4e-11 sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus... 46.6 3e-08 sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory sy... 38.5 5e-05 sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2... 30.8 0.21 >sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score = 85.1 bits (209), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 >sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus Rp3/2004 OX=349344 GN=7b PE=4 SV=1 Length=44 Score = 53.9 bits (128), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV 44 >sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus 279/2005 OX=389167 GN=7b PE=4 SV=1 Length=44 Score = 53.9 bits (128), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV 44 >sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus HKU3 OX=442736 GN=7b PE=4 SV=1 Length=44 Score = 46.6 bits (109), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIML+IFWFSLEIQD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLLIFWFSLEIQDIEEPCNKV 44 >sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7b PE=1 SV=1 Length=43 Score = 38.5 bits (88), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPC 41 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD E C Sbjct 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETC 41 >sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana OX=3702 GN=HDF7 PE=3 SV=1 Length=279 Score = 30.8 bits (68), Expect = 0.21, Method: Compositional matrix adjust. Identities = 12/31 (39%), Positives = 22/31 (71%), Gaps = 0/31 (0%) Query 8 DFYLCFLAFLLFLVLIMLIIFWFSLEIQDLE 38 +++LCFL L+LVL+ +I+W E+ D++ Sbjct 125 NWFLCFLYIALYLVLVEFMIYWVHKELHDIK 155 Lambda K H a alpha 0.342 0.155 0.498 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5106278320 Results from round 2 Query= sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute res... 45.9 5e-08 sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus... 34.0 0.003 sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus... 34.0 0.003 sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus... 32.1 0.018 sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory sy... 30.1 0.11 Sequences not found previously or not previously below threshold: sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2... 26.7 6.8 >sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score = 45.9 bits (108), Expect = 5e-08, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 >sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus Rp3/2004 OX=349344 GN=7b PE=4 SV=1 Length=44 Score = 34.0 bits (77), Expect = 0.003, Method: Composition-based stats. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV 44 >sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus 279/2005 OX=389167 GN=7b PE=4 SV=1 Length=44 Score = 34.0 bits (77), Expect = 0.003, Method: Composition-based stats. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNKV 44 >sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus HKU3 OX=442736 GN=7b PE=4 SV=1 Length=44 Score = 32.1 bits (72), Expect = 0.018, Method: Composition-based stats. Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV 44 MNELTLIDFYLCFLAFLLFLVLIML+IFWFSLEIQD+EEPC KV Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLLIFWFSLEIQDIEEPCNKV 44 >sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7b PE=1 SV=1 Length=43 Score = 30.1 bits (67), Expect = 0.11, Method: Composition-based stats. Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%) Query 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPC 41 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD E C Sbjct 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETC 41 >sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana OX=3702 GN=HDF7 PE=3 SV=1 Length=279 Score = 26.7 bits (58), Expect = 6.8, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 0/35 (0%) Query 4 LTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLE 38 L +++LCFL L+LVL+ +I+W E+ D++ Sbjct 121 LDHFNWFLCFLYIALYLVLVEFMIYWVHKELHDIK 155 Lambda K H a alpha 0.323 0.164 0.577 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0501 0.140 1.90 42.6 43.6 Effective search space used: 5106278320 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Apr 3, 2024 12:05 PM Number of letters in database: 206,678,396 Number of sequences in database: 571,282 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40