PSIBLAST 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: uniprot_sprot.fasta 573,661 sequences; 207,922,125 total letters Results from round 1 Query= YP_009725318.1 ORF7b [Severe acute respiratory syndrome coronavirus 2] Length=43 Score E Sequences producing significant alignments: (Bits) Value sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory sy... 83.6 7e-23 sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus... 40.8 7e-06 sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus... 40.8 7e-06 sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute res... 38.9 3e-05 sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus... 31.2 0.041 sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2... 30.0 0.34 sp|P79949|RFNG_XENLA Beta-1,3-N-acetylglucosaminyltransferase rad... 29.6 0.59 >sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7b PE=1 SV=1 Length=43 Score = 83.6 bits (205), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA Sbjct 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 >sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus Rp3/2004 OX=349344 GN=7b PE=4 SV=1 Length=44 Score = 40.8 bits (94), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLELQD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK 43 >sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus 279/2005 OX=389167 GN=7b PE=4 SV=1 Length=44 Score = 40.8 bits (94), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLELQD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK 43 >sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score = 38.9 bits (89), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD E C Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTK 43 >sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus HKU3 OX=442736 GN=7b PE=4 SV=1 Length=44 Score = 31.2 bits (69), Expect = 0.041, Method: Compositional matrix adjust. Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIML+IFWFSLE+QD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLLIFWFSLEIQDIEEPCNK 43 >sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana OX=3702 GN=HDF7 PE=3 SV=1 Length=279 Score = 30.0 bits (66), Expect = 0.34, Method: Compositional matrix adjust. Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%) Query 8 DFYLCFLAFLLFLVLIMLIIFWFSLELQD 36 +++LCFL L+LVL+ +I+W EL D Sbjct 125 NWFLCFLYIALYLVLVEFMIYWVHKELHD 153 >sp|P79949|RFNG_XENLA Beta-1,3-N-acetylglucosaminyltransferase radical fringe OS=Xenopus laevis OX=8355 GN=rfng PE=2 SV=1 Length=340 Score = 29.6 bits (65), Expect = 0.59, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 4/37 (11%) Query 11 LCFLAFLLFLVLIMLIIFW----FSLELQDHNETCHA 43 +CFL FLL ++L I W S LQ N TC A Sbjct 11 VCFLVFLLLCATVLLNISWRQRDSSQSLQHCNSTCSA 47 Lambda K H a alpha 0.345 0.154 0.510 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5152417088 Results from round 2 Query= YP_009725318.1 ORF7b [Severe acute respiratory syndrome coronavirus 2] Length=43 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory sy... 44.0 3e-07 sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus... 33.2 0.006 sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus... 33.2 0.006 sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute res... 32.5 0.013 Sequences not found previously or not previously below threshold: sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus... 30.9 0.052 sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2... 26.3 8.1 >sp|P0DTD8|NS7B_SARS2 ORF7b protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=7b PE=1 SV=1 Length=43 Score = 44.0 bits (103), Expect = 3e-07, Method: Composition-based stats. Identities = 43/43 (100%), Positives = 43/43 (100%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA Sbjct 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 >sp|Q3I5I9|NS7B_BCRP3 Non-structural protein 7b OS=Bat coronavirus Rp3/2004 OX=349344 GN=7b PE=4 SV=1 Length=44 Score = 33.2 bits (75), Expect = 0.006, Method: Composition-based stats. Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLELQD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK 43 >sp|P0C5A9|NS7B_BC279 Non-structural protein 7b OS=Bat coronavirus 279/2005 OX=389167 GN=7b PE=4 SV=1 Length=44 Score = 33.2 bits (75), Expect = 0.006, Method: Composition-based stats. Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLELQD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK 43 >sp|Q7TFA1|NS7B_SARS Protein non-structural 7b OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=7b PE=1 SV=1 Length=44 Score = 32.5 bits (73), Expect = 0.013, Method: Composition-based stats. Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIMLIIFWFSLE+QD E C Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTK 43 >sp|Q3LZX6|NS7B_BCHK3 Non-structural protein 7b OS=Bat coronavirus HKU3 OX=442736 GN=7b PE=4 SV=1 Length=44 Score = 30.9 bits (69), Expect = 0.052, Method: Composition-based stats. Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%) Query 1 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 43 M EL+LIDFYLCFLAFLLFLVLIML+IFWFSLE+QD E C+ Sbjct 1 MNELTLIDFYLCFLAFLLFLVLIMLLIFWFSLEIQDIEEPCNK 43 >sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana OX=3702 GN=HDF7 PE=3 SV=1 Length=279 Score = 26.3 bits (57), Expect = 8.1, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 4 LSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHN 38 L +++LCFL L+LVL+ +I+W EL D Sbjct 121 LDHFNWFLCFLYIALYLVLVEFMIYWVHKELHDIK 155 Lambda K H a alpha 0.323 0.163 0.575 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0499 0.140 1.90 42.6 43.6 Effective search space used: 5152417088 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Jun 30, 2025 8:32 PM Number of letters in database: 207,922,125 Number of sequences in database: 573,661 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40