[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
PSIBLAST 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           571,609 sequences; 206,878,625 total letters

Results from round 1


Query= sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapie...  1288    0.0   
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus...  1043    0.0   
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus muscul...  1001    0.0   
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorh...  380     4e-123
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm...  353     8e-113
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyos...  335     2e-105
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorh...  328     1e-103
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyos...  273     4e-82 
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dict...  194     4e-54 
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesteras...  189     3e-52 
sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A OS=R...  188     4e-52 
sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  181     2e-49 
sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  177     6e-48 
sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS...  177     9e-48 
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesteras...  176     1e-47 
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dict...  104     1e-22 
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces p...  85.1    5e-16 
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (st...  84.7    8e-16 
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoforma...  84.7    9e-16 
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (str...  76.6    3e-13 
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii...  70.1    3e-11 
sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii...  65.9    7e-10 
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis ...  65.5    1e-09 
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevis...  63.9    3e-09 
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (...  53.9    4e-06 
sp|Q75EN9|CCZ1_EREGS Vacuolar fusion protein CCZ1 OS=Eremothecium...  35.8    1.3   
sp|B0SUK3|THIE_CAUSK Thiamine-phosphate synthase OS=Caulobacter s...  35.0    1.3   
sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol ...  34.7    2.6   
sp|Q99NB2|B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosam...  33.9    4.3   
sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol ...  33.5    5.5   
sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1...  33.5    7.9   
sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homoc...  33.1    9.9   


>sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5 Length=631 Score = 1288 bits (3332), Expect = 0.0, Method: Compositional matrix adjust. Identities = 631/631 (100%), Positives = 631/631 (100%), Gaps = 0/631 (0%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE Sbjct 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 Query 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK Sbjct 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 Query 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL Sbjct 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 Query 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR Sbjct 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 Query 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT Sbjct 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 Query 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL Sbjct 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 Query 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD Sbjct 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 Query 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV Sbjct 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 Query 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR Sbjct 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 Query 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS Sbjct 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 Query 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC Sbjct 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631
>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus
OX=9913 GN=SMPD1 PE=2 SV=1 Length=625 Score = 1043 bits (2696), Expect = 0.0, Method: Compositional matrix adjust. Identities = 535/631 (85%), Positives = 569/631 (90%), Gaps = 6/631 (1%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 MPR+G S Q PRSGREQ D + GAP + L L LALALAL +S VLW+PAE Sbjct 1 MPRHGVSPGQGLPRSGREQASDRSLGAP------CLRLLWLGLALALALPNSPVLWSPAE 54 Query 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 A PL QGHPA+ RI P+L++ FGW NLTCP CKGLFTAI+ GL+ + +VA VGSVAIK Sbjct 55 ARPLPTQGHPAKFIRIAPQLQEAFGWWNLTCPTCKGLFTAIDFGLRNQASVAWVGSVAIK 114 Query 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 LC LLKIAPPAVCQS V LFEDDMVEVW RSVLSPSEACGLLLGS+CGHWDIFSSWNISL Sbjct 115 LCVLLKIAPPAVCQSAVQLFEDDMVEVWTRSVLSPSEACGLLLGSSCGHWDIFSSWNISL 174 Query 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 P VPKPPP+PP PPAPG+PVSR+LFLTDLHWDHDYLEGTDP+C +PLCCRR SG PPAS+ Sbjct 175 PAVPKPPPQPPKPPAPGSPVSRVLFLTDLHWDHDYLEGTDPNCENPLCCRRDSGPPPASQ 234 Query 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH++W Q+RQDQLRALTT Sbjct 235 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHNIWQQSRQDQLRALTT 294 Query 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 +TALV+KFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS WLYEAMA+AWEPWLPAEAL Sbjct 295 ITALVKKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSHWLYEAMAEAWEPWLPAEAL 354 Query 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 RTLRIGGFYALSP PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD Sbjct 355 RTLRIGGFYALSPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 414 Query 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 KVHIIGHIPPGHCLKSWSWNYYRIV RYENTLA QFFGHTHVDEFEVFYDEETLSRPL+V Sbjct 415 KVHIIGHIPPGHCLKSWSWNYYRIVERYENTLAGQFFGHTHVDEFEVFYDEETLSRPLSV 474 Query 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYI+NLT+AN PGA PHW LLYR Sbjct 475 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIMNLTEANEPGATPHWYLLYR 534 Query 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 ARETYGLPN LPTAWH+LVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS Sbjct 535 ARETYGLPNALPTAWHDLVYRMRKDTQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 594 Query 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 AR+DSPALCRHL+PD SLP+ QSLW PL C Sbjct 595 ARSDSPALCRHLVPDASLPDVQSLWSMPLLC 625
>sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus
OX=10090 GN=Smpd1 PE=1 SV=2 Length=627 Score = 1001 bits (2588), Expect = 0.0, Method: Compositional matrix adjust. Identities = 518/633 (82%), Positives = 555/633 (88%), Gaps = 8/633 (1%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAP--GLLWMGLVLALALALALALALSDSRVLWAP 58 MP + AS Q R+G EQ + + AP GLLWM L LAL LAL DS VLW P Sbjct 1 MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWM------GLGLALVLALFDSTVLWVP 54 Query 59 AEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVA 118 A A+PL +GH + I P L+ FGW NLTCP CK LFTA+N GLKKEPNVARVGSVA Sbjct 55 ARAYPLPSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVA 114 Query 119 IKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNI 178 IK+C +L IAP VCQS VHLFEDD+VEVW RSVLSPSEACGLLLGS+CGHWDIFS+WNI Sbjct 115 IKICKMLNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNI 174 Query 179 SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA 238 SLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCRRGSG PP Sbjct 175 SLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPN 234 Query 239 SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL 298 S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+RQDQLRAL Sbjct 235 SQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRAL 294 Query 299 TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE 358 TT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKAWEPWLPA+ Sbjct 295 TTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPAD 354 Query 359 ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR 418 AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV ELQAAE+R Sbjct 355 ALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENR 414 Query 419 GDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPL 478 GDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYDEETLSRPL Sbjct 415 GDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPL 474 Query 479 AVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLL 538 AVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN G P W+ L Sbjct 475 AVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRL 534 Query 539 YRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ 598 YRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ Sbjct 535 YRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ 594 Query 599 LSARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 LSARADSPALCRHLMP+GSLP+A LW RPL C Sbjct 595 LSARADSPALCRHLMPNGSLPDANRLWSRPLLC 627
>sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis
elegans OX=6239 GN=asm-2 PE=1 SV=3 Length=618 Score = 380 bits (977), Expect = 4e-123, Method: Compositional matrix adjust. Identities = 216/615 (35%), Positives = 329/615 (53%), Gaps = 41/615 (7%) Query 35 LVLALALALALALALSDSRVLWAPAEAHPL----SPQGHPA-------RLHRIVPRLRDV 83 ++L + + LAL + +S VL P + H + +G+ A ++ R + + Sbjct 6 IILGIGIVLALVSNV-ESGVLRKPVDEHEYEKWTNARGNEAAVPPPKYKMLRYAKKAINE 64 Query 84 FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD 143 ++C C + + + + + + LC+L + P VC++I++ F+D+ Sbjct 65 PENRKMSCLFCTFAVDGVQALIAQNSTDNEIAAFLVNLCDLFDVEQPHVCKNIIYAFKDE 124 Query 144 MVEVWRRSVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVS 201 +V V RSV +P E CG + + CGH D + WNI++P KPP KP P Sbjct 125 VVFVLERSVFTPEEICGAFIAN-CGHSDKPLTHMWNITIPG-GKPPIKPWPKIPDNKPTF 182 Query 202 RILFLTDLHWDHDYLEGTDPDC-------ADPLCCRRGS----GLPPASRPG-----AGY 245 ++L L+D+H DH Y+ GT+ C +CCR S G P + AG Sbjct 183 KVLHLSDIHIDHQYVVGTEAYCQLDSALGTYAMCCRDYSQDSQGAPTNLKDKPIYVPAGP 242 Query 246 WGEYSKCDLPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL 304 WG CDLP +T ES + + D + TGD AHD W T + +T + Sbjct 243 WGMPYLCDLPYQTFESAMKHISKTFKDLDYIIITGDFEAHDSWDYTEDLTRENMNNMTNV 302 Query 305 VRKFLGPVPVYPAVGNHESTPVNSFPPPFI--EGNHSSRWLYEAMAKAWEPWLPAEALRT 362 ++ VPVY ++GNHE P ++ P + +WLY+ M++ W W+P EAL T Sbjct 303 FLEYFPGVPVYVSIGNHEGVPQDAMAPHTMPEYDTRGPQWLYKIMSEMWSHWIPQEALDT 362 Query 363 LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKV 422 ++ YA+ P PGL+LISLN +CS NF+L +N DP L+WL+ ELQ +E++G+ V Sbjct 363 VQYRASYAVYPKPGLKLISLNTIYCSEFNFYLYVNEVDPDATLEWLIEELQDSENKGELV 422 Query 423 HIIGHIPPG--HCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD-EETLSRPLA 479 HII HIPPG +CLK WSWN++ IV RYENT+A F+GHTH D+F V+YD ++ RP Sbjct 423 HIISHIPPGDNYCLKGWSWNFFEIVKRYENTIAQMFYGHTHYDQFMVYYDMDDPNRRPFH 482 Query 480 VAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY 539 +++PS TTY LNP YR+Y+IDG Y G+++ V D +TY N+T+AN+ P W L Y Sbjct 483 FNWISPSLTTYDWLNPAYRIYEIDGGYEGATYTVKDAKTYFANVTEANMKNKEPEWVLSY 542 Query 540 RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGT--PCRLATLCA 597 RE Y + + P +W +L ++ + LF+ + LY++ H +E C T CR +C Sbjct 543 DTREHYQMADFSPQSWSDLSDKLWTNTTLFRDYVRLYYRNHYNNE-CYTDYKCRYTFVCD 601 Query 598 QLSARADSPALCRHL 612 R+ + C HL Sbjct 602 IKKGRSYDESFCDHL 616
>sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase
asm-3 OS=Caenorhabditis elegans OX=6239 GN=asm-3 PE=3 SV=2 Length=589 Score = 353 bits (905), Expect = 8e-113, Method: Compositional matrix adjust. Identities = 190/522 (36%), Positives = 279/522 (53%), Gaps = 17/522 (3%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C CK + + ++ V +A+ +C I VC I+ F D+ + V ++ Sbjct 21 CEECKSIVDLLQFEWGEKKTEECVMEIAVFICETFHIEDNDVCNFIISDFSDEFMYVIKQ 80 Query 151 SVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD 208 +++P + CGLL+ + CG + + + WN+++P +PP P PG P R L LTD Sbjct 81 ILVTPHQLCGLLMKNDCGDFVDPLATIWNMTIPG-NQPPFVPKQVVPPGNPTLRALHLTD 139 Query 209 LHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG-----AGYWGEYSKCDLPLRTLESLL 263 LH D Y G + DC P CCR G AG WG CD P L ++L Sbjct 140 LHVDMFYTVGLEADCGTPQCCRPQDMNVEIVENGDVKQPAGPWGSVGSCDTPYWLLTNML 199 Query 264 SGLGP-AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE 322 + AG D + +GD+ +H VW T + + ++ +R + PVY AVGNHE Sbjct 200 QNIASTAGKLDYIMVSGDLVSHTVWAYTPETHSFMVKNLSDTIRSYFPKTPVYFAVGNHE 259 Query 323 STPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL 382 PV++ P F + WLY+AM+ AW+ W+PA+ ++L G Y Y GLR+ISL Sbjct 260 GVPVDNIAPHFTPKKYHMDWLYKAMSNAWQGWIPADQEKSLEYNGCYMKKIYDGLRMISL 319 Query 383 NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWN 440 N + R NFWL IN TDP G LQWL+ +LQ AE+ GDKVHI+ HIP G L+ ++ N Sbjct 320 NNVYGDRINFWLYINQTDPDGTLQWLINQLQDAENVGDKVHIVAHIPGSDGEALEGYALN 379 Query 441 YYRIVARYENTLAAQFFGHTHVDEFEVFYD--EETLSRPLAVAFLAPSATTYIGLNPGYR 498 YY+I+ RY NT+ QFFGHTH ++F + Y ++ S P V + APS T Y P YR Sbjct 380 YYKIINRYANTVVGQFFGHTHSEKFYMMYANPDDYKSTPTNVVYSAPSVTPYSDYFPAYR 439 Query 499 VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR-ARETYGLPNTLPTAWHN 557 +Y IDG + GS++ V+D+E + NLT N W++LY+ A YGL +PT ++ Sbjct 440 IYTIDGVHKGSTYQVIDYEEWFFNLTSNNANPTNVKWEVLYQSANMEYGLKGQIPTEYNQ 499 Query 558 LVYRMRGDMQLFQTFWFLYHKG--HPPSEPCG-TPCRLATLC 596 ++ RM+ D LF ++ +++ + PC CR LC Sbjct 500 MIERMKTDDSLFNKYYENHNRRSIYDGRAPCNDQQCRNGYLC 541
>sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium
discoideum OX=44689 GN=sgmB PE=3 SV=1 Length=637 Score = 335 bits (860), Expect = 2e-105, Method: Compositional matrix adjust. Identities = 203/537 (38%), Positives = 288/537 (54%), Gaps = 32/537 (6%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C ICK + + + + + AI LC L I VC ++ LF + V Sbjct 77 CDICKFGINQVQKMIASKQGIEDISKYAIDLCTYLHIEKAEVCNGLIPLFANMTYNVLSY 136 Query 151 SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH 210 ++ CG + C + SS NI PKPP PP P+P +P +IL ++D+H Sbjct 137 PTVTGEYVCGFV--GFCPYVPRNSS-NIINFPKPKPPHVPPVAPSPNSPTMKILHISDIH 193 Query 211 WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP-- 268 D Y G + DC +PLCCR +G P AG WG Y CD+ ++ +ES+ + Sbjct 194 VDPVYESGMNADCGEPLCCRAPNG-PGVGEKAAGEWGHY-LCDINMKMVESMFEFIDQEF 251 Query 269 AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPV-PVYPAVGNHESTPVN 327 D+V+WTGD P HD+W QT Q+ A VT LV+K+ G V+PA+GNHES PVN Sbjct 252 GEDIDIVFWTGDNPPHDIWEQTYDSQINASQLVTNLVKKYFGSTAKVFPAIGNHESLPVN 311 Query 328 SFP-PPFIEGNHSSRWLYEAMAKAWEPWLPA-EALRTLRIGGFYALSPYPGLRLISLNMN 385 SFP PP S W++ A++ W W+ E + L+ GG+Y L GLR+ISLNMN Sbjct 312 SFPLPP------GSSWIFNALSYDWSDWVNVDEQVANLQYGGYYTLPVQSGLRVISLNMN 365 Query 386 FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--HCLKSWSWNYYR 443 +C+ N +L NSTDPA LQW+V LQA+ED G+KV+++GHIPPG C+ SWS + Sbjct 366 WCNNGNLYLAENSTDPANMLQWIVDTLQASEDIGEKVYLVGHIPPGIPDCIDSWSEQLLQ 425 Query 444 IVARYENTLAAQFFGHTHVDEFEVFY---DEETLSRPL---AVAFLAPSATTYIGLNPGY 497 IV RYE+T+ A F+GHTH DEF V+Y DE S P+ V + PS TTY NP + Sbjct 426 IVNRYEDTILASFYGHTHRDEFSVYYTQSDENDPSSPMRASNVIYTTPSVTTYQHQNPSF 485 Query 498 RVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHN 557 R++ +D N + +++ TY +L+QAN+ G P W L Y TY +PN P + Sbjct 486 RIFTVDSN----TGYLMESSTYHTDLSQANLNGK-PTWLLEYNTTNTYNIPNLTPISMDL 540 Query 558 LVYRMRGDMQLFQTFWFLYHKG--HPPSEPCGT-PCRLATLCAQLSARADSPALCRH 611 + + + + + Y+ +P S+PC + C+L +C SA C H Sbjct 541 AIQNINSSNSMLEDYHVHYYSASPYPESKPCTSISCKLDYICKMKSAAYLKYYECIH 597
>sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis
elegans OX=6239 GN=asm-1 PE=1 SV=2 Length=564 Score = 328 bits (841), Expect = 1e-103, Method: Compositional matrix adjust. Identities = 184/539 (34%), Positives = 283/539 (53%), Gaps = 21/539 (4%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFE 141 D +G+ L C C GL + + LK + + + A +C L P AVC I F Sbjct 33 DKYGFQPL-CISCTGLISVASFFLKFDVSEPVILEFATIVCKLFAKQPWAVCDGISSQFR 91 Query 142 DDMVEVWRR-SVLSPSEACGLLLGSTCGHWD-IFSSWNISLPTVPKPP--PKPPSPPAPG 197 D+ V+RR + SPS+ CG++L D S W ++LP PK K P Sbjct 92 DEFFYVFRRLANESPSQICGIILPDCADPTDPSESGWMVALPPKPKRTRISKKKVQKKPN 151 Query 198 APVSR---ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL 254 +S+ +L LTDLH D +Y ++ +C DP+CCR P + AGYWG KCD+ Sbjct 152 MSMSQNLNVLQLTDLHVDFEYKYPSEANCDDPVCCRVSVSEP---KKAAGYWGSVGKCDI 208 Query 255 PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV 314 P T+E++LS + DMV TGD H W + ++ L L + LV+ P+ Sbjct 209 PFWTVENMLSHINKTHMIDMVIMTGDYINHVDWEYSIEEHLSVLRKLHRLVQNTFPSTPI 268 Query 315 YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY 374 Y A+GNHE PVNSF P ++ WLY+ PWL A +L G Y+ Sbjct 269 YWALGNHEGVPVNSFAPHSVDERFWPTWLYKEFQTMSGPWLSEGAKDSLLKRGSYSTQVM 328 Query 375 PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--H 432 GL+LI+LN FC NF+L +N +DP + W V EL +E +G++V+++ HIPPG Sbjct 329 DGLKLITLNTGFCEVTNFFLYLNQSDPDSSMSWFVKELFESEKKGEQVYVLAHIPPGDSE 388 Query 433 CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE--ETLSRPLAVAFLAPSATTY 490 CL+ W++NYYR++ R+ +T+AAQFFGH H+D F VFY++ S+P++V + +PS TT+ Sbjct 389 CLEGWAFNYYRVIQRFSSTIAAQFFGHDHLDYFTVFYEDMHNVSSKPISVGYASPSVTTF 448 Query 491 IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNT 550 NP YR+Y+ID + ++D TY +L +A P W+ LY AR+ +G+ + Sbjct 449 EYQNPAYRIYEID---PYNKFKIVDFTTYYADLEKAT-EDKKPVWEKLYSARQAHGMDDL 504 Query 551 LPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALC 609 P +W+ ++ ++ + + F+ + P C + C++ +C +S C Sbjct 505 SPLSWNKVIQKLFTSEKKREKFYQYAFRNFSPQ--CDSTCQMQLMCNLRMGHHNSTLYC 561
>sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium
discoideum OX=44689 GN=sgmA PE=3 SV=1 Length=583 Score = 273 bits (697), Expect = 4e-82, Method: Compositional matrix adjust. Identities = 166/535 (31%), Positives = 269/535 (50%), Gaps = 47/535 (9%) Query 89 LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVW 148 L+C +C+ + + +KK ++ + LC K P VC I++ + +V+V Sbjct 53 LSCDVCQIGASLLEDFIKKNASLTEIIKGLSDLCIASKEEQPEVCTGILNNYVPIIVDVL 112 Query 149 RRSVLSPSEACGLL-LGSTCGHW----------DIFSSWNISLPTVP---KPPPKPPSPP 194 +S +PS+ CG + S G + + + + PT+ KP K S Sbjct 113 IQSDFTPSQLCGYFKICSATGSSESSSISNSFDNEYRQESFNKPTMKVNKKPQYKDLSNQ 172 Query 195 AP-------GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWG 247 P + IL ++D+H+D DY G++P+C PLCCR G G AG G Sbjct 173 EPLVKKFKGNDSIGYILQISDVHFDPDYKVGSNPNCGRPLCCRDGVG-------SAGPIG 225 Query 248 EYSKCDLPLRTLESLLSGLGP-AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVR 306 Y CD+P T+E + L D + WTGD P H+VW Q++ Q A T+ +++ Sbjct 226 HY-LCDIPFSTVELIFQHLATLTDQLDFIVWTGDNPPHNVWEQSQAQQELATATLAQVIQ 284 Query 307 KFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIG 366 K PV P++GNHE+ P + + P +S+WL +++ W PWL A+AL ++ Sbjct 285 KTFPNTPVLPSLGNHEAYPADQYVLP------NSQWLLDSIYTYWAPWLDADALELVKER 338 Query 367 GFYALSPYPGLRLISLNMNFCSRENFWLLINS--TDPAGQLQWLVGELQAAEDRGDKVHI 424 G+Y PGLR++SLN NF+ L+ + P Q W++ L+ A+ G+KV I Sbjct 339 GYYTSLIKPGLRVMSLNTLENDMINFYNLLPTYLKGPNNQSDWMINTLEQAQSNGEKVLI 398 Query 425 IGHIP---PGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVA 481 IGHIP W Y ++V ++ + + Q +GHTH D+F VF D T + P + Sbjct 399 IGHIPCTVKSASTDGWCAMYEQVVGQFSDVIIGQLYGHTHYDQFSVFSDVATHTIPTGMN 458 Query 482 FLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRA 541 ++ PS TTY PGYR+YQ D S++ ++++ Y N+T+AN GA+ ++QL Y A Sbjct 459 YIVPSLTTYQNHEPGYRIYQFD----YSTNQIVNYYQYHANITEANETGAL-NFQLTYSA 513 Query 542 RETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLC 596 +E Y + + PT+W + +M+ + +F ++ F P E C C+ +C Sbjct 514 KELYNMDDLSPTSWTKVANQMKTNSTMFNSY-FENLSSSPIKESCDQACQTKWIC 567
>sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium
discoideum OX=44689 GN=sgmC PE=3 SV=1 Length=446 Score = 194 bits (493), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 130/413 (31%), Positives = 200/413 (48%), Gaps = 40/413 (10%) Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 +TD H+D Y+EG D D CR + + GA G Y KCD L+S Sbjct 37 ITDTHYDFMYIEGGDEDKQ----CREVTYKSKYEKGGASSIGNY-KCDTSFELLQSSFEY 91 Query 266 LGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGPVPVYPAVGNHES 323 + D + WTGD P H Q + L+++T +T L++ + +P++P++GNH+S Sbjct 92 MVKHEEKPDFIIWTGDDPPHLGNSQLNETLVLQSITNMTNLIKGYFPDIPIFPSIGNHDS 151 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 383 P + WL+E +A+ W P+L +++ T ++GG+Y G R+ISLN Sbjct 152 YPQHQIGV-------GPNWLFENVAQLWSPFLSNDSIETFKLGGYYTELVSEGFRIISLN 204 Query 384 MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYR 443 F EN L N TDPAGQL WL L A G++V IIGH+PPG+ K +N+++ Sbjct 205 TVFYYNENRQCL-NLTDPAGQLLWLNETLANASLAGERVWIIGHVPPGYNEKYDVFNFHK 263 Query 444 --------IVARYENTLAAQFFGHTHVDEFEVFYDEETLS----RPLAVAFLAPSATTYI 491 ++Y + + +GH H D F +FYD+ P + FL+PS T ++ Sbjct 264 QFNDEYLFSFSQYSDIIEFHIYGHEHTDTFRLFYDDPNDHINDIEPTGIMFLSPSLTPWM 323 Query 492 GL-------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARET 544 NPG R+Y+ Y+ +S +LD+ + NLT I G I WQL YRA E Sbjct 324 NQFLPALPNNPGLRLYE----YNITSFALLDYYQFWTNLTDNIISGNID-WQLEYRATEF 378 Query 545 YGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCA 597 + N P + + ++ F F Y+ P++ C C+ LC+ Sbjct 379 FNTFNLSPVSMYEAYLLIQSVTSQLLKFHF-YNSVSYPTKGCDEICKKIQLCS 430
>sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase
3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2 Length=455 Score = 189 bits (481), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 135/440 (31%), Positives = 202/440 (46%), Gaps = 49/440 (11%) Query 206 LTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSG 265 + DLH D DY DP P +G P P AG WG+Y CD P + S + Sbjct 26 IADLHLDPDYKVSKDPFQVCP-----SAGSQPV--PDAGPWGDY-LCDSPWALINSSIYA 77 Query 266 LGPAGPF-DMVYWTGDIPAHDVWHQTRQDQ-LRALTTVTALVRKFLGPVPVYPAVGNHES 323 + P D + WTGD H + + L + +T L+R+ VY A+GNH+ Sbjct 78 MKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF 137 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS---PYPGLRLI 380 P N FP S +Y +A+ W+PWL E++ + G FY P R++ Sbjct 138 HPKNQFPA-------GSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIV 190 Query 381 SLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKS---- 436 LN N N L + DP Q QWL L A GD V+I+GH+PPG K+ Sbjct 191 VLNTNLYYTSNA-LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKA 249 Query 437 -----WSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSA---- 487 ++ Y ++V ++ +A QFFGH H D F + YD+ + P++ F+ P Sbjct 250 WFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDAGV--PISAMFITPGVTPWK 307 Query 488 TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRAR 542 TT G+ NP RV++ Y ++ + D TY +NL+QAN G P W+L Y+ Sbjct 308 TTLPGVVNGANNPAIRVFE----YDRATLSLKDMVTYFMNLSQANAQGT-PRWELEYQLT 362 Query 543 ETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSAR 602 E YG+P+ + H ++ R+ GD Q + ++Y+ + C C + +CA Sbjct 363 EAYGVPDASAHSMHTVLDRIAGDQSTLQRY-YVYNSVSYSAGVCDEACSMQHVCAMRQVD 421 Query 603 ADSPALCRHLMPDGSLPEAQ 622 D+ C L G+ P Q Sbjct 422 IDAYTTC--LYASGTTPVPQ 439
>sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Rattus norvegicus OX=10116 GN=Smpdl3a PE=2 SV=1 Length=445 Score = 188 bits (478), Expect = 4e-52, Method: Compositional matrix adjust. Identities = 139/445 (31%), Positives = 215/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA GAP V + +TDLH D Y TD D +G+ + S PG +G+ Sbjct 24 PLAPAYGAPAVGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANV---SNPGP--FGDV 76 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + + +T +T V+ Sbjct 77 -LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMTVTVQN 135 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P ++ +Y A++ W+PWL EA+ TLR GG Sbjct 136 LFPNLQVFPALGNHDYWPQDQLPI-------ATSKVYSAVSDLWKPWLDEEAISTLRKGG 188 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ P LR+ISLN N N + +N TDPA Q +WL L ++ +KV++I Sbjct 189 FYSQKVASNPDLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLRNKEKVYVI 247 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 248 AHVPVGYLPYATKTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 305 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 P+ F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 306 PINSVFVAPAVTPVKGVLEKETNNPGVRLFQ----YKPGDYTLLDMLQYYLNLTEANLKG 361 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + YG+ + P + H L ++ D + F ++ + + S PC Sbjct 362 E-SNWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSAPCDQR 420 Query 590 CRLATLCAQLSARADSPALC--RHL 612 C+ +CA ++ S C RHL Sbjct 421 CKTLQICAIMNLDLVSYEDCLKRHL 445
>sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2 Length=445 Score = 181 bits (460), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 140/445 (31%), Positives = 213/445 (48%), Gaps = 46/445 (10%) Query 191 PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P PA AP V + +TDLH D Y TD D +G+ AS PG +G+ Sbjct 24 PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD- 75 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VWHQTRQDQLRALTTVTALVRK 307 CD P + + S + +G + WTGD P H V + ++ +T +T V+ Sbjct 76 VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQN 135 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ TL+ GG Sbjct 136 LFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGG 188 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY+ ++ PGLR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 189 FYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYII 247 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 248 AHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN 305 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+AN+ G Sbjct 306 PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKG 361 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W L Y + Y + + P + + LV + D + F ++ Y + S C Sbjct 362 E-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQH 420 Query 590 CRLATLCA--QLSARADSPALCRHL 612 C+ +CA L + + L +HL Sbjct 421 CKTLQVCAIMNLDSMSYDDCLKQHL 445
>sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2 Length=453 Score = 177 bits (449), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 139/452 (31%), Positives = 213/452 (47%), Gaps = 49/452 (11%) Query 178 ISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP 237 + LP P PP PA G + +TDLH D Y TD D +G+ Sbjct 21 LGLPVAPAGGRNPP--PAIG----QFWHVTDLHLDPTY-HITD-DHTKVCASSKGAN--- 69 Query 238 ASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQ-L 295 AS PG +G+ CD P + + S + +G + WTGD P H + D + Sbjct 70 ASNPGP--FGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVI 126 Query 296 RALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL 355 +T +T ++ + V+PA+GNH+ P + P + +Y A+A W+PWL Sbjct 127 NVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWL 179 Query 356 PAEALRTLRIGGFYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQ 413 EA+ TLR GGFY+ ++ P LR+ISLN N N + +N TDPA Q +WL L Sbjct 180 DEEAISTLRKGGFYSQKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLN 238 Query 414 AAEDRGDKVHIIGHIPPGHCLKSWSWN----YYR-----IVARYENTLAAQFFGHTHVDE 464 ++ +KV+II H+P G+ S + YY I +Y + +A QF+GHTH D Sbjct 239 NSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDS 298 Query 465 FEVFYDEETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHET 518 V D++ P+ F+AP+ T + NPG R++Q Y + +LD Sbjct 299 IMVLSDKK--GSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQ 352 Query 519 YILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYH 577 Y LNLT+AN+ G W+L Y +TY + + P + + L + D + F ++ + Sbjct 353 YYLNLTEANLKGE-SIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFF 411 Query 578 KGHPPSEPCGTPCRLATLCAQLSARADSPALC 609 + S C C+ +CA ++ S A C Sbjct 412 VSYDSSVTCDKTCKAFQICAIMNLDNISYADC 443
>sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1 Length=450 Score = 177 bits (448), Expect = 9e-48, Method: Compositional matrix adjust. Identities = 130/440 (30%), Positives = 205/440 (47%), Gaps = 43/440 (10%) Query 190 PPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P +P G V + +TD H D Y D C G AS PG +G+ Sbjct 24 PLAPAGTGPAVGQFWHVTDFHLDPTYHITGD----HTKVCASSKG-AEASDPGP--FGD- 75 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQTRQDQLRALT-TVTALVRK 307 CD P R + S L + +G + WTGD P H + D++ +T +T +++ Sbjct 76 VMCDSPYRLIFSALDFIKNSGQKVSFMIWTGDSPPHVPVLELSTDKVINVTANITTTIQR 135 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL +A+ TLR GG Sbjct 136 LFPNLQVFPALGNHDYWPQDQLPV-------VNSKVYNAVANLWKPWLTEDAITTLRKGG 188 Query 368 FYA--LSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY +S P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 189 FYTQKVSNNPKLRIISLNTNLYYGPN-SVTLNQTDPANQFEWLENTLNISQQNKEKVYII 247 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ K + I +Y + +A QF+GHTH D V D++ + Sbjct 248 AHVPVGYLPYARGISAMRKYHNEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKK--GK 305 Query 477 PLAVAFLAPSAT------TYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 P+ F+AP+ T + NPG R++Q Y + +LD Y LNLT AN+ G Sbjct 306 PVNSLFVAPAVTPVRSVLERLTNNPGVRLFQ----YDPRDYKLLDMLQYYLNLTDANLKG 361 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR-GDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W+L Y + Y + + P + + L + + + F ++ + + S C Sbjct 362 E-SNWKLEYNLTQAYDIQDLQPKSLYKLAKQFAIQESKQFIKYYKYFFVSYDSSVICQGK 420 Query 590 CRLATLCAQLSARADSPALC 609 C++ +CA ++ S C Sbjct 421 CKIFQICAIMNLDVISYTDC 440
>sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase
3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1 Length=456 Score = 176 bits (447), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 131/438 (30%), Positives = 197/438 (45%), Gaps = 47/438 (11%) Query 197 GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPL 256 GA + R ++DLH D +Y DP P +G P AG WG+Y CD P Sbjct 17 GAQLGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVL--NAGPWGDY-LCDSPW 68 Query 257 RTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTT-VTALVRKFLGPVPV 314 + S L + P D + WTGD H + + A+ +T L+++ V Sbjct 69 ALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKV 128 Query 315 YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS-- 372 Y A+GNH+ P N FP S +Y +A+ W PWL E+ + G FY+ Sbjct 129 YAALGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLP 181 Query 373 -PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG 431 P R++ LN N N DP Q +WL L A G+ V++IGH+PPG Sbjct 182 GPSRAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPG 240 Query 432 HCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF 482 K S++ Y +++ ++ +A QFFGH H D F +FYD P+ V F Sbjct 241 FFEKTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMF 298 Query 483 LAPSA----TTYIGL-----NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 L P TT G+ NPG R+++ Y ++ + D TY LNL QAN+ P Sbjct 299 LTPGVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETP 353 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLA 593 W+ YR E Y +P+ ++ H + R+ + + Q + ++Y+ C CR+ Sbjct 354 RWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRY-YVYNSVSYNHLTCEDSCRIE 412 Query 594 TLCAQLSARADSPALCRH 611 +CA ++ A C H Sbjct 413 HVCAIQHVAFNTYATCLH 430
>sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium
discoideum OX=44689 GN=sgmD PE=3 SV=1 Length=438 Score = 104 bits (260), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 93/354 (26%), Positives = 150/354 (42%), Gaps = 47/354 (13%) Query 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDV----WHQTRQDQL 295 P G +G Y CD L ++S + D + +TGD H + W +++ Sbjct 72 PTNGLYGRYG-CDTNQLLLSEVISEMLNVNSNPDFIIYTGDGAGHGLPNGPWSESQ---- 126 Query 296 RALTTVTALVRKFLGPVP---VYPAVGNHESTPVNSFPPPFIEGNHSS-RWLYEAMAKAW 351 + L + G P P +GN++ FP + N S+ ++LYE W Sbjct 127 ------STLAKSLYGAYPNTQFIPTIGNNDV-----FPDYNSQCNDSNLQFLYET----W 171 Query 352 EPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGE 411 W+P + + G + +SP GL +ISLN S +N DP GQ WL + Sbjct 172 AQWIPTNQVSSFLYRGSFVVSPVSGLTIISLNTILYSVKNKNTFSTPQDPCGQFAWLEQQ 231 Query 412 LQAAEDRGDKVHIIGHIPPG----HCLKSWSWNY----YRIVARYENTLAAQFFGHTHVD 463 L AA+ G+ V+IIGHI PG + +W Y + I + Y+ T+ A FFGH H D Sbjct 232 LIAAKQAGNSVYIIGHIFPGLDPFYLQGTWKSQYQTAFFNITSDYQTTITAGFFGHIHRD 291 Query 464 EF-EVFYDEETLSRPLAV-AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIL 521 E + +D +L+ F+ S T NP ++ + Y S + D Y Sbjct 292 EIRSIQFDNPSLTNNHYFPMFIGSSITPVYFNNPTFKQFT----YDSQSKNITDITAYFS 347 Query 522 NLTQANIPGAIPHWQLLYRARETYGLPNTLPTA---WHNLVYRMRGDMQLFQTF 572 ++ +N+ G + +W Y Y + N ++L+ RM +F + Sbjct 348 DVYISNLKGHM-NWTEEYDFVSIYDIDNQYGIGGDQLNSLMERMVSSNSIFNNY 400
>sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces
pombe (strain 972 / ATCC 24843) OX=284812 GN=ppn1 PE=3 SV=1 Length=577 Score = 85.1 bits (209), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 99/367 (27%), Positives = 157/367 (43%), Gaps = 52/367 (14%) Query 195 APGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLC--CRRGSGLPPASRPGAGYW--GEY 249 + G P V R L +TD+H D Y +G+ D C S P + GY G Sbjct 40 SKGKPLVGRFLHITDMHPDIYYEKGS---TVDHYCHSYDHNSDDTPLGKSKVGYLSPGPG 96 Query 250 SKCD----LPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL 304 +CD L +TLE L G D + WTGD HD + + Q L + L Sbjct 97 YECDSSPALIDKTLEWLKEHQDDVLGGIDFILWTGDNSRHDNDNHFPRTQSEILASNEDL 156 Query 305 VRKFLG---PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR 361 V K + VP+ A+GN++ P N +E SS + +A AW+ +P E Sbjct 157 VNKMIEAFPDVPIVSAIGNNDIYPHN-----IMEAGPSS--MTRQLAGAWDALIPYEERH 209 Query 362 TLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLL---INSTDPAGQL--QWLVGELQAA 415 T G +Y P L IS+N + S +N + ++ D G L +W +L+A Sbjct 210 TFEKGSYYLCDVIPDKLAAISINTLYLSNKNAAVDGCPDDNLDEPGSLFMRWFKIQLEAY 269 Query 416 EDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEET 473 +G KV ++GHIPP G + ++ ++ + + + Q +GH +++ F VF + + Sbjct 270 RLKGMKVWLLGHIPPTRGQWYEDCYTSFTDLLYEFRDIIVGQLYGHMNINHF-VFLEFDK 328 Query 474 LSRPLAVAFLAPSATTYIGLN---PGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 L P T G+ P Y ID Y+ + T+ NLT+ + G Sbjct 329 L----------PVDTESYGIKSAQPKYVKSLIDAQYA-------ELPTFPENLTEEFLNG 371 Query 531 AIPHWQL 537 + ++ L Sbjct 372 TVGNYSL 378
>sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=epp-1 PE=3 SV=3 Length=731 Score = 84.7 bits (208), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 83/314 (26%), Positives = 130/314 (41%), Gaps = 42/314 (13%) Query 202 RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLES 261 + L +TDLH D Y + D AD C RG G P Y E S CD P + + Sbjct 56 KFLHITDLHPDQFYKPHSSTDEAD--ACHRGKG------PAGVYGAEVSDCDSPFALINA 107 Query 262 LLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG--------- 310 + D V WTGD HD ++ + L T + K Sbjct 108 TFDWIAANVKDDIDFVIWTGDTARHDSDEGVPRNADQVLGTNRWIADKMAELFSDSTGRH 167 Query 311 -PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFY 369 +P+ P +GN++ P N P G +S WL + W ++P + + GG++ Sbjct 168 LEIPIVPTLGNNDILPHNILLP----GPNS--WL-QHYTHIWRRFVPEAQRHSFQFGGWF 220 Query 370 ALSPYPG-LRLISLNMNFCSRENFWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHII 425 + P L + SLN + N + ++P Q++WL +L +RG K ++ Sbjct 221 YVEVIPNRLAIFSLNTLYFFDRNAGTDGCASPSEPGYKQMEWLRIQLHIMRERGMKAILM 280 Query 426 GHIPPGHC--LKSWS---WNYYRI-VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 GH+PP K W W Y + + +Y + + + FGH ++D F +DE R + Sbjct 281 GHVPPARTDSKKLWDENCWQKYSLWLRQYRDVVVSGVFGHMNIDHF-FIHDE----RDIN 335 Query 480 VAFLAPSATTYIGL 493 V LA A I + Sbjct 336 VGQLAGLADNSIDI 349
>sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=PPN1 PE=3 SV=1 Length=678 Score = 84.7 bits (208), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 69/247 (28%), Positives = 109/247 (44%), Gaps = 22/247 (9%) Query 243 AGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALT 299 AG WG S CD P+ + L A D V WTGD HD+ + + Sbjct 120 AGKWGTAVSDCDCPMSLVNITFDWLKEEWANEVDFVVWTGDNARHDIDRRIPRTPKEIFD 179 Query 300 TVTALVRKFLG----PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL 355 + +V + L +P+ P++GN++ P N + SR + E W+ ++ Sbjct 180 SNRMIVDRMLDAFGRDMPIVPSIGNNDIYPHN------VLAAGPSR-ITEEFLLIWKHFI 232 Query 356 PAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL---LINSTDPAG-QLQWLVG 410 P+EA G ++++ P L +ISLN F N + +S DP ++ WL Sbjct 233 PSEAAHVFERGAYFSVEVIPDRLAVISLNTLFWYDANTLVDGCRDHSNDPGALEMDWLEV 292 Query 411 ELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVF 468 +L RG +V + GH+PP H + Y + RY++T+ FGH +VD F F Sbjct 293 QLNNFRQRGMQVWLTGHVPPHMNHYYDNCYLRYGDLALRYQDTIVGHLFGHMNVDHF-FF 351 Query 469 YDEETLS 475 D + L Sbjct 352 IDVDELE 358
>sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata
(strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PPN1 PE=3 SV=1 Length=663 Score = 76.6 bits (187), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 79/289 (27%), Positives = 124/289 (43%), Gaps = 41/289 (14%) Query 202 RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE 260 R L +TD+H D Y+ GT D +C SG P + A +G S CD P+ ++ Sbjct 86 RFLHITDMHPDEYYVAGT---SIDNVC---HSGEPTKGKDRAAKFGNAMSGCDSPMLLMD 139 Query 261 SLLSGLGP--AGPFDMVYWTGDIPAHD---VWHQTRQDQLRALTTVTALVRK-FLGP--- 311 L + D V WTGD HD + +T + R V ++K F P Sbjct 140 MTLDWIDKNLKDQIDFVVWTGDNIRHDNDRTYPRTEDEIFRMNAEVAEKIKKIFRTPNSP 199 Query 312 ------VPVYPAVGNHESTPVNSFP-PPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLR 364 VPV P++GN++ P N F P ++ +R Y + W ++P E R Sbjct 200 DPRDFAVPVVPSIGNNDVFPHNLFSLGPTLQ----TREYY----RLWGDFIPEEQQRMFD 251 Query 365 IGGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPAGQ-----LQWLVGELQAAEDR 418 + PG L ++S N + + N L+++ D Q L WL L +R Sbjct 252 RDASFFTEVIPGKLAVLSFNTLYLFKAN--PLVDNCDSRKQPGYQLLLWLGYVLDEIRER 309 Query 419 GDKVHIIGHIPP-GHCLKSWSWNYYRI-VARYENTLAAQFFGHTHVDEF 465 G KV I GH+PP S ++ + + + Y + + +GH ++D F Sbjct 310 GMKVWISGHVPPIAKNYDSSCYDKFSLWMHEYRDVIIGGLYGHMNMDHF 358
>sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii
(strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=PPN1 PE=3 SV=3 Length=713 Score = 70.1 bits (170), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 80/312 (26%), Positives = 125/312 (40%), Gaps = 54/312 (17%) Query 184 PKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGA 243 PKP K R L +TD+H D Y G D C G G A + G Sbjct 78 PKPKLKIVKGGDEQVLHGRFLHITDMHPDKYYKTGADVGS----LCHSGKG--SAGKYGD 131 Query 244 GYWGEYSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHD---VWHQTRQDQLRAL 298 G CD P+ +E L + D V WTGD HD + +T + Sbjct 132 AVLG----CDSPMVLMEDTLKWVKENLKDKIDFVVWTGDNVRHDNDRRYPRTESNIFDMN 187 Query 299 TTVTALVRKFLG------------PVPVYPAVGNHESTPVNSFPP-PFIEGNHSSRWLYE 345 V+ L+ + +P+ P++GN++ P N F P P ++ +R L+ Sbjct 188 QRVSELMYETFKEENPRGGRPRQLKIPLVPSLGNNDVFPHNLFSPGPTLQ----TRELF- 242 Query 346 AMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLIN---STDP 401 K W ++PA L G ++ P L ++S+N + + N L+ N DP Sbjct 243 ---KIWHDFVPAAQLHIFNRGAYFFKEIIPNELAVLSINTLYLFQSN-PLVDNCDRKKDP 298 Query 402 AGQL-QWLVGELQAAEDRGDKVHIIGHIPPGH------CLKSW-SWNYYRIVARYENTLA 453 +L +WL L+ R KV + GH+PP CL+ + W + Y + + Sbjct 299 GHKLFEWLGYTLKEMRARNMKVWLSGHVPPNEKNYDISCLRKYIVW-----MHEYRDVII 353 Query 454 AQFFGHTHVDEF 465 +GH ++D F Sbjct 354 GGLYGHMNIDHF 365
>sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii
(strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=PPN1 PE=3 SV=2 Length=594 Score = 65.9 bits (159), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 76/291 (26%), Positives = 113/291 (39%), Gaps = 46/291 (16%) Query 202 RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE 260 R L +TD+H D Y+EG+ A C + R AG +G+ CD P+ + Sbjct 70 RFLHITDIHPDPLYVEGSSIAGA----CHGDPARDASDR--AGRFGDAMGGCDAPMDLMN 123 Query 261 SLLSGLGP--AGPFDMVYWTGDIPAHD-----------VWHQTRQ--DQLRALTTVTALV 305 L+ + D V WTGD HD + H Q DQ L Sbjct 124 YTLAWVATHLRDEIDFVVWTGDNARHDNDRRQPRTAEQILHMNAQVADQFYELFQQQRDG 183 Query 306 RKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRI 365 G VPV P++GN++ P N F + + + + W ++P E + Sbjct 184 DTMQG-VPVVPSLGNNDVFPHNMF-------SLGPTLMTRQLQRIWAKFIPEEQRQAFEH 235 Query 366 GGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPA----GQLQWLVGELQAAEDRGD 420 + + P L +IS N + + N L+ N D A L WL L+ R Sbjct 236 DTSFFVEVIPDRLAVISFNTLYFFKSNP-LVDNCNDKAQPGHALLLWLGSVLEEMRARNM 294 Query 421 KVHIIGHIPP------GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEF 465 KV + GH+PP G C +W Y Y + + +GH +VD F Sbjct 295 KVWLSGHVPPIPKNFEGSCYNKLAWWTY----EYRDVIIGGLYGHMNVDHF 341
>sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=PPN1 PE=3 SV=1 Length=681 Score = 65.5 bits (158), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 86/315 (27%), Positives = 125/315 (40%), Gaps = 46/315 (15%) Query 179 SLPTVPKPPPKPPSPPAPGAPVS-RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP 237 SL P P K + R L +TD+H D Y E T D C RG P Sbjct 87 SLGLTPNQPVKITDIGGKEKSIKGRFLHITDMHPDLYYKENTSIDD----TCHRGK--PK 140 Query 238 ASRPGAGYWGEYSK-CDLP----LRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQ--- 289 A +G K CD P TL+ + L + D + WTGD HD + Sbjct 141 NDGDRAARFGNAMKGCDGPPDLMYYTLDWIHKNL--SDEIDFIIWTGDNVRHDNDRRIPR 198 Query 290 TRQDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPP-PFIEGNH 338 T Q V+ L K V + P++GN++ P N F P P ++ Sbjct 199 TEQQIFDMNRQVSELFLKTFKDHESDDPRDLKVKIIPSLGNNDVFPHNLFSPGPTLQ--- 255 Query 339 SSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLIN 397 +R LY+ W ++P T + + PG L +ISLN + + N L++ Sbjct 256 -TRELYDI----WSQFIPPAQQNTFDRYASFFVEAIPGKLAVISLNTLYMFKGN--PLVD 308 Query 398 STDPAGQ-----LQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWNYYRIVARYEN 450 + Q L W+ LQ DRG KV + GH+P P + S S + Y + Sbjct 309 NCSNKKQPGYKMLLWVGFTLQELRDRGMKVWLSGHVPPIPKNFDSSCSDKLALWLHEYSD 368 Query 451 TLAAQFFGHTHVDEF 465 + F+GH ++D F Sbjct 369 IIIGGFYGHMNMDHF 383
>sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae
(strain ATCC 204508 / S288c) OX=559292 GN=PPN1 PE=1 SV=1 Length=674 Score = 63.9 bits (154), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 73/291 (25%), Positives = 124/291 (43%), Gaps = 45/291 (15%) Query 202 RILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTLE 260 R L +TD+H D Y+EG+ D +C +G P + A +G+ S CD P+ +E Sbjct 96 RFLHITDIHPDPYYVEGS---SIDAVC---HTGKPSKKKDVAPKFGKAMSGCDSPVILME 149 Query 261 SLLSGLGPA--GPFDMVYWTGDIPAHD--VWHQTRQDQLRALTTVTA--LVRKFLG---- 310 L + D V WTGD HD H + Q+ + + A + F Sbjct 150 ETLRWIKENLRDKIDFVIWTGDNIRHDNDRKHPRTEAQIFDMNNIVADKMTELFSAGNEE 209 Query 311 -----PVPVYPAVGNHESTPVNSFP-PPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLR 364 V V P++GN++ P N F P ++ +R Y + W+ ++P + RT Sbjct 210 DPRDFDVSVIPSLGNNDVFPHNMFALGPTLQ----TREYY----RIWKNFVPQQQQRTFD 261 Query 365 IGGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPAGQ-----LQWLVGELQAAEDR 418 + PG L ++S+N + + N L+++ + + L W L+ R Sbjct 262 RSASFLTEVIPGKLAVLSINTLYLFKAN--PLVDNCNSKKEPGYQLLLWFGYVLEELRSR 319 Query 419 GDKVHIIGHIPPGHCLKSWSWNYYRIVA----RYENTLAAQFFGHTHVDEF 465 G KV + GH+PP K++ + Y Y + + +GH ++D F Sbjct 320 GMKVWLSGHVPP--IAKNFDQSCYDKFTLWTHEYRDIIIGGLYGHMNIDHF 368
>sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica
(strain CLIB 122 / E 150) OX=284591 GN=PPN1 PE=3 SV=1 Length=747 Score = 53.9 bits (128), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 67/266 (25%), Positives = 99/266 (37%), Gaps = 53/266 (20%) Query 241 PGAGYWGE-YSKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDV---WHQTRQDQ 294 P AGY+G S CD P+ + + + D + WTGD HD + + QD Sbjct 114 PKAGYYGHPLSSCDGPISLMNATFDWIDQNIRDEIDFIIWTGDNVRHDNDNRYPRLEQDI 173 Query 295 LRALTTVTALVRKFLG--------------------PVPVYPAVGNHESTPVNSF--PPP 332 V++ + +P+ P++GN++ P N + P Sbjct 174 FGYNQIVSSKFHELFRYNETRDGEGHNGGGDPQHPLVIPIIPSLGNNDVFPHNLYLAGPS 233 Query 333 FIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSREN 391 F S R M + W ++P G +Y G L +ISLN + + N Sbjct 234 F----QSRR-----MLQIWSEFVPEAQQHIFSRGSYYFQEVITGKLAVISLNTLYFYKSN 284 Query 392 FWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP------GHC-LKSWSWNY 441 TDP L WL L RG KV + GH+PP C LK W Sbjct 285 PMSDGCDEKTDPGYKHLVWLGVVLDEMRQRGMKVWLSGHVPPVEKNYEDSCHLKLAYW-- 342 Query 442 YRIVARYENTLAAQFFGHTHVDEFEV 467 + Y + + FGH ++D F V Sbjct 343 ---LTEYRDIIVGSVFGHMNIDHFVV 365
>sp|Q75EN9|CCZ1_EREGS Vacuolar fusion protein CCZ1 OS=Eremothecium
gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CCZ1 PE=3 SV=1 Length=663 Score = 35.8 bits (81), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/74 (30%), Positives = 30/74 (41%), Gaps = 6/74 (8%) Query 208 DLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSK------CDLPLRTLES 261 D WD DYL+ D D + GS + ++PG +G ++K C LPL Sbjct 407 DKIWDPDYLQAIDAKLYDAMLQLEGSVVTEDNKPGRFAYGVFNKTTKRIECSLPLLRFSD 466 Query 262 LLSGLGPAGPFDMV 275 S P MV Sbjct 467 KRSDEKSRQPLKMV 480
>sp|B0SUK3|THIE_CAUSK Thiamine-phosphate synthase OS=Caulobacter
sp. (strain K31) OX=366602 GN=thiE PE=3 SV=1 Length=219 Score = 35.0 bits (79), Expect = 1.3, Method: Compositional matrix adjust. Identities = 32/110 (29%), Positives = 49/110 (45%), Gaps = 19/110 (17%) Query 72 RLHRIVP-RLRDVFGWG-NLTCPICKGLFTAINLGLKKEPN------------VARVGSV 117 RL+ I P L D+ +G +L + G A+ + LK P+ +AR V Sbjct 5 RLYLITPPALDDLAAFGHDLAAALDGGDVAALQIRLKDAPDDIIAAAVQVLSPIARARDV 64 Query 118 AIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTC 167 A+ L + +A C VHL +DDM R ++ P G ++G TC Sbjct 65 AVILNDRPDLAARLGCDG-VHLGQDDMPLAQARKLMGP----GAMIGVTC 109
>sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0688000 PE=2 SV=1 Length=321 Score = 34.7 bits (78), Expect = 2.6, Method: Compositional matrix adjust. Identities = 33/110 (30%), Positives = 44/110 (40%), Gaps = 16/110 (15%) Query 393 WLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHC-LKSWSWNYYRIVA--R 447 +++ N QL WL LQ A R V + H+P PG + WNY ++A R Sbjct 192 FVMFNGGVGKEQLSWLNDVLQDASARRQNVILCSHLPMDPGSASFAALMWNYDEVMAIVR 251 Query 448 YENTLAAQFFGHTH-----VDEFEVFYDEETLSRPLAVAFLAPSATTYIG 492 + A F GH H VD V + R L A P T+ G Sbjct 252 QYKCVKACFAGHDHKGGHSVDSHGVHH------RTLEAALECPPGTSAFG 295
>sp|Q99NB2|B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2 Length=377 Score = 33.9 bits (76), Expect = 4.3, Method: Compositional matrix adjust. Identities = 16/60 (27%), Positives = 24/60 (40%), Gaps = 0/60 (0%) Query 52 SRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNV 111 R++W H + Q H + + FGW N CP + L TA + PN+ Sbjct 143 KRLIWEDQVYHDIIQQDFTDSFHNLTFKFLLQFGWANTFCPHARFLMTADDDIFIHMPNL 202
>sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Arabidopsis thaliana OX=3702 GN=At4g24730 PE=2 SV=1 Length=311 Score = 33.5 bits (75), Expect = 5.5, Method: Compositional matrix adjust. Identities = 30/96 (31%), Positives = 43/96 (45%), Gaps = 10/96 (10%) Query 404 QLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLK-SWSWNY---YRIVARYENTLAAQFF 457 QLQWL LQ A + +V + GH+P PG K + WN+ I+ +Y+ ++ Sbjct 195 QLQWLDSVLQDASNSNQRVIVCGHVPMSPGVASKAALLWNFDEVMNIIHKYD-SVKVCLS 253 Query 458 GHTHVDEFEVFYDEETL-SRPLAVAFLAPSATTYIG 492 GH H + F D + R L A P T G Sbjct 254 GHDHKGGY--FVDSHGVHHRSLEAALECPPGTYSFG 287
>sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP
PE=1 SV=3 Length=525 Score = 33.5 bits (75), Expect = 7.9, Method: Compositional matrix adjust. Identities = 26/98 (27%), Positives = 42/98 (43%), Gaps = 7/98 (7%) Query 62 HPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKL 121 H S +G PA R++PR F C +CK L ++ L+K ++ + K Sbjct 387 HLCSSRGLPAATVRVMPRKDGGF------CEVCKKLVGYLDRNLEKNSTKEQILAALEKG 440 Query 122 CNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC 159 C+ L C V +E ++E+ V+ PS C Sbjct 441 CSFLPDQYRKQCDQFVTEYEPVLIEILVE-VMDPSFVC 477
>sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homocysteine
methyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) OX=322159 GN=metE PE=3 SV=1 Length=749 Score = 33.1 bits (74), Expect = 9.9, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query 434 LKSW-SWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 +K W + NY+ IV ++E T A + GH DE++ D +RP+ V Sbjct 112 MKKWFNTNYHYIVPKFEKTTAVKLAGHKIFDEYQEAKDLGLDTRPVVV 159 Lambda K H a alpha 0.322 0.139 0.468 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 68951548263 Results from round 2 Query= sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens OX=9606 GN=SMPD1 PE=1 SV=5 Length=631 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapie... 897 0.0 sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus... 867 0.0 sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus muscul... 864 0.0 sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorh... 666 0.0 sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm... 609 0.0 sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorh... 604 0.0 sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyos... 564 0.0 sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyos... 552 0.0 sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A OS=R... 473 2e-161 sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS... 469 5e-160 sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A OS... 468 8e-160 sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A OS... 465 2e-158 sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesteras... 458 2e-155 sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesteras... 441 6e-149 sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dict... 426 2e-143 sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces p... 315 2e-98 sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (str... 317 3e-98 sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii... 313 4e-96 sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dict... 304 5e-96 sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis ... 310 2e-95 sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevis... 308 7e-95 sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoforma... 302 2e-92 sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii... 296 5e-91 sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (st... 295 2e-89 sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (... 277 5e-82 Sequences not found previously or not previously below threshold: sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE... 53.2 6e-06 sp|P10960|SAP_RAT Prosaposin OS=Rattus norvegicus OX=10116 GN=Psa... 51.7 2e-05 sp|Q61207|SAP_MOUSE Prosaposin OS=Mus musculus OX=10090 GN=Psap P... 50.9 3e-05 sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol ... 50.1 3e-05 sp|P20097|SAP_CAVPO Saposin-C OS=Cavia porcellus OX=10141 GN=PSAP... 45.9 3e-05 sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharom... 50.5 4e-05 sp|Q8C1C1|SAPL1_MOUSE Proactivator polypeptide-like 1 OS=Mus musc... 50.1 4e-05 sp|Q28FE0|CPPED_XENTR Serine/threonine-protein phosphatase CPPED1... 49.4 5e-05 sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1... 48.6 1e-04 sp|O13035|SAP_CHICK Prosaposin OS=Gallus gallus OX=9031 GN=PSAP P... 47.4 3e-04 sp|Q5U3W0|CPPED_DANRE Serine/threonine-protein phosphatase CPPED1... 45.9 7e-04 sp|Q5RCR9|CPPED_PONAB Serine/threonine-protein phosphatase CPPED1... 45.9 7e-04 sp|Q3LIE5|ADPRM_HUMAN Manganese-dependent ADP-ribose/CDP-alcohol ... 45.5 0.001 sp|Q8BFS6|CPPED_MOUSE Serine/threonine-protein phosphatase CPPED1... 44.7 0.001 sp|Q9BRF8|CPPED_HUMAN Serine/threonine-protein phosphatase CPPED1... 44.0 0.003 sp|A7YY53|ADPRM_BOVIN Manganese-dependent ADP-ribose/CDP-alcohol ... 42.4 0.009 sp|Q99KS6|ADPRM_MOUSE Manganese-dependent ADP-ribose/CDP-alcohol ... 42.4 0.009 sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with th... 42.8 0.012 sp|Q6NUJ1|SAPL1_HUMAN Proactivator polypeptide-like 1 OS=Homo sap... 41.7 0.019 sp|Q7T0Q0|ADPRM_XENLA Manganese-dependent ADP-ribose/CDP-alcohol ... 40.9 0.026 sp|Q5M886|ADPRM_RAT Manganese-dependent ADP-ribose/CDP-alcohol di... 40.9 0.031 sp|Q66JJ3|ADPRM_XENTR Manganese-dependent ADP-ribose/CDP-alcohol ... 40.5 0.040 sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1... 40.1 0.041 sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol ... 40.1 0.047 sp|Q29075|NKL_PIG Antimicrobial peptide NK-lysin (Fragment) OS=Su... 37.8 0.072 sp|P9WL81|Y2577_MYCTU Uncharacterized protein Rv2577 OS=Mycobacte... 39.7 0.092 sp|P9WL80|Y2577_MYCTO Uncharacterized protein MT2654 OS=Mycobacte... 39.7 0.092 sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome sts1... 38.2 0.16 sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosa... 38.6 0.19 sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome sts1... 37.4 0.34 sp|A2RSY6|TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090... 37.4 0.44 sp|Q08I43|ERI1_SCHPO 3'-5' exonuclease eri1 OS=Schizosaccharomyce... 37.0 0.50 sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protein B OS... 37.0 0.56 sp|Q8H129|PPA3_ARATH Purple acid phosphatase 3 OS=Arabidopsis tha... 36.6 0.56 sp|Q7T291|ADPRM_DANRE Manganese-dependent ADP-ribose/CDP-alcohol ... 35.9 1.1 sp|E7QJD3|YIM1_YEASZ Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|E7LYS5|YIM1_YEASV Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|E7KGT3|YIM1_YEASA Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|C8ZF09|YIM1_YEAS8 Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|B5VPS4|YIM1_YEAS6 Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|C7GQ91|YIM1_YEAS2 Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|B3LM39|YIM1_YEAS1 Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.9 1.2 sp|Q9SCX8|PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis t... 35.5 1.5 sp|A6ZML0|YIM1_YEAS7 Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.1 2.0 sp|P28625|YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae (st... 35.1 2.0 sp|E7NLM5|YIM1_YEASO Protein YIM1 OS=Saccharomyces cerevisiae (st... 34.0 4.7 sp|A5WBU9|CNPD3_PSYWF Probable cyclic nucleotide phosphodiesteras... 34.0 4.8 sp|Q05904|SM34_LYTPI 34 kDa spicule matrix protein OS=Lytechinus ... 33.2 7.9
>sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens
OX=9606 GN=SMPD1 PE=1 SV=5 Length=631 Score = 897 bits (2317), Expect = 0.0, Method: Composition-based stats. Identities = 631/631 (100%), Positives = 631/631 (100%), Gaps = 0/631 (0%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE Sbjct 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 Query 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK Sbjct 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 Query 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL Sbjct 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 Query 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR Sbjct 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 Query 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT Sbjct 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 Query 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL Sbjct 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 Query 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD Sbjct 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 Query 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV Sbjct 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 Query 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR Sbjct 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 Query 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS Sbjct 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 Query 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC Sbjct 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631
>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus
OX=9913 GN=SMPD1 PE=2 SV=1 Length=625 Score = 867 bits (2239), Expect = 0.0, Method: Composition-based stats. Identities = 535/631 (85%), Positives = 569/631 (90%), Gaps = 6/631 (1%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE 60 MPR+G S Q PRSGREQ D + GAP + L L LALALAL +S VLW+PAE Sbjct 1 MPRHGVSPGQGLPRSGREQASDRSLGAP------CLRLLWLGLALALALPNSPVLWSPAE 54 Query 61 AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK 120 A PL QGHPA+ RI P+L++ FGW NLTCP CKGLFTAI+ GL+ + +VA VGSVAIK Sbjct 55 ARPLPTQGHPAKFIRIAPQLQEAFGWWNLTCPTCKGLFTAIDFGLRNQASVAWVGSVAIK 114 Query 121 LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL 180 LC LLKIAPPAVCQS V LFEDDMVEVW RSVLSPSEACGLLLGS+CGHWDIFSSWNISL Sbjct 115 LCVLLKIAPPAVCQSAVQLFEDDMVEVWTRSVLSPSEACGLLLGSSCGHWDIFSSWNISL 174 Query 181 PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR 240 P VPKPPP+PP PPAPG+PVSR+LFLTDLHWDHDYLEGTDP+C +PLCCRR SG PPAS+ Sbjct 175 PAVPKPPPQPPKPPAPGSPVSRVLFLTDLHWDHDYLEGTDPNCENPLCCRRDSGPPPASQ 234 Query 241 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT 300 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH++W Q+RQDQLRALTT Sbjct 235 PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHNIWQQSRQDQLRALTT 294 Query 301 VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL 360 +TALV+KFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS WLYEAMA+AWEPWLPAEAL Sbjct 295 ITALVKKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSHWLYEAMAEAWEPWLPAEAL 354 Query 361 RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 RTLRIGGFYALSP PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD Sbjct 355 RTLRIGGFYALSPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 414 Query 421 KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV 480 KVHIIGHIPPGHCLKSWSWNYYRIV RYENTLA QFFGHTHVDEFEVFYDEETLSRPL+V Sbjct 415 KVHIIGHIPPGHCLKSWSWNYYRIVERYENTLAGQFFGHTHVDEFEVFYDEETLSRPLSV 474 Query 481 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR 540 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYI+NLT+AN PGA PHW LLYR Sbjct 475 AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYIMNLTEANEPGATPHWYLLYR 534 Query 541 ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 600 ARETYGLPN LPTAWH+LVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS Sbjct 535 ARETYGLPNALPTAWHDLVYRMRKDTQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS 594 Query 601 ARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 AR+DSPALCRHL+PD SLP+ QSLW PL C Sbjct 595 ARSDSPALCRHLVPDASLPDVQSLWSMPLLC 625
>sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus
OX=10090 GN=Smpd1 PE=1 SV=2 Length=627 Score = 864 bits (2232), Expect = 0.0, Method: Composition-based stats. Identities = 519/633 (82%), Positives = 556/633 (88%), Gaps = 8/633 (1%) Query 1 MPRYGASLRQSCPRSGREQGQDGTAGAP--GLLWMGLVLALALALALALALSDSRVLWAP 58 MP + AS Q R+G EQ + + AP GLLWMGL LAL LAL DS VLW P Sbjct 1 MPHHRASSGQDHLRAGWEQRLERSLPAPRVGLLWMGLGLAL------VLALFDSTVLWVP 54 Query 59 AEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVA 118 A A+PL +GH + I P L+ FGW NLTCP CK LFTA+N GLKKEPNVARVGSVA Sbjct 55 ARAYPLPSEGHSVKFSAIAPPLQSAFGWQNLTCPACKVLFTALNHGLKKEPNVARVGSVA 114 Query 119 IKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNI 178 IK+C +L IAP VCQS VHLFEDD+VEVW RSVLSPSEACGLLLGS+CGHWDIFS+WNI Sbjct 115 IKICKMLNIAPLDVCQSAVHLFEDDVVEVWTRSVLSPSEACGLLLGSSCGHWDIFSTWNI 174 Query 179 SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA 238 SLP+VPKPPPKPPSPPAPGAPVSR+LFLTDLHWDH+YLEGTDP CADPLCCRRGSG PP Sbjct 175 SLPSVPKPPPKPPSPPAPGAPVSRVLFLTDLHWDHEYLEGTDPYCADPLCCRRGSGWPPN 234 Query 239 SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL 298 S+ GAG+WGEYSKCDLPLRTLESLL GLGPAGPF+MVYWTGDIPAHDVW Q+RQDQLRAL Sbjct 235 SQKGAGFWGEYSKCDLPLRTLESLLKGLGPAGPFEMVYWTGDIPAHDVWQQSRQDQLRAL 294 Query 299 TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE 358 TT+T LVRKFLGPVPVYPAVGNHESTPVN FPPPFI+GN SS+WLYEAMAKAWEPWLPA+ Sbjct 295 TTITDLVRKFLGPVPVYPAVGNHESTPVNGFPPPFIKGNQSSQWLYEAMAKAWEPWLPAD 354 Query 359 ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR 418 AL TLRIGGFYAL+P PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLV ELQAAE+R Sbjct 355 ALHTLRIGGFYALTPRPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVEELQAAENR 414 Query 419 GDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPL 478 GDKVHIIGHIPPGHCLKSWSWNYY+I+ARYENTLA QFFGHTHVDEFE+FYDEETLSRPL Sbjct 415 GDKVHIIGHIPPGHCLKSWSWNYYKIIARYENTLAGQFFGHTHVDEFEIFYDEETLSRPL 474 Query 479 AVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLL 538 AVAFLAPSATT+I LNPGYRVYQIDGNY GSSHVVLDHETYILNLTQAN G P W+ L Sbjct 475 AVAFLAPSATTFINLNPGYRVYQIDGNYPGSSHVVLDHETYILNLTQANAAGGTPSWKRL 534 Query 539 YRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ 598 YRARETYGLP+ +P +WHNLVYRMR D QLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ Sbjct 535 YRARETYGLPDAMPASWHNLVYRMRDDEQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQ 594 Query 599 LSARADSPALCRHLMPDGSLPEAQSLWPRPLFC 631 LSARADSPALCRHLMP+GSLP+A LW RPL C Sbjct 595 LSARADSPALCRHLMPNGSLPDANRLWSRPLLC 627
>sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis
elegans OX=6239 GN=asm-2 PE=1 SV=3 Length=618 Score = 666 bits (1718), Expect = 0.0, Method: Composition-based stats. Identities = 216/615 (35%), Positives = 329/615 (53%), Gaps = 41/615 (7%) Query 35 LVLALALALALALALSDSRVLWAPAEAHPL----SPQGHPA-------RLHRIVPRLRDV 83 ++L + + LAL + +S VL P + H + +G+ A ++ R + + Sbjct 6 IILGIGIVLALVSNV-ESGVLRKPVDEHEYEKWTNARGNEAAVPPPKYKMLRYAKKAINE 64 Query 84 FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDD 143 ++C C + + + + + + LC+L + P VC++I++ F+D+ Sbjct 65 PENRKMSCLFCTFAVDGVQALIAQNSTDNEIAAFLVNLCDLFDVEQPHVCKNIIYAFKDE 124 Query 144 MVEVWRRSVLSPSEACGLLLGSTCGHWD--IFSSWNISLPTVPKPPPKPPSPPAPGAPVS 201 +V V RSV +P E CG + + CGH D + WNI++P KPP KP P Sbjct 125 VVFVLERSVFTPEEICGAFIAN-CGHSDKPLTHMWNITIPG-GKPPIKPWPKIPDNKPTF 182 Query 202 RILFLTDLHWDHDYLEGTDPDC-------ADPLCCRRGS----GLPPASRPG-----AGY 245 ++L L+D+H DH Y+ GT+ C +CCR S G P + AG Sbjct 183 KVLHLSDIHIDHQYVVGTEAYCQLDSALGTYAMCCRDYSQDSQGAPTNLKDKPIYVPAGP 242 Query 246 WGEYSKCDLPLRTLESLLSGLGPA-GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTAL 304 WG CDLP +T ES + + D + TGD AHD W T + +T + Sbjct 243 WGMPYLCDLPYQTFESAMKHISKTFKDLDYIIITGDFEAHDSWDYTEDLTRENMNNMTNV 302 Query 305 VRKFLGPVPVYPAVGNHESTPVNSFPPPFIE--GNHSSRWLYEAMAKAWEPWLPAEALRT 362 ++ VPVY ++GNHE P ++ P + +WLY+ M++ W W+P EAL T Sbjct 303 FLEYFPGVPVYVSIGNHEGVPQDAMAPHTMPEYDTRGPQWLYKIMSEMWSHWIPQEALDT 362 Query 363 LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKV 422 ++ YA+ P PGL+LISLN +CS NF+L +N DP L+WL+ ELQ +E++G+ V Sbjct 363 VQYRASYAVYPKPGLKLISLNTIYCSEFNFYLYVNEVDPDATLEWLIEELQDSENKGELV 422 Query 423 HIIGHIPPG--HCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYD-EETLSRPLA 479 HII HIPPG +CLK WSWN++ IV RYENT+A F+GHTH D+F V+YD ++ RP Sbjct 423 HIISHIPPGDNYCLKGWSWNFFEIVKRYENTIAQMFYGHTHYDQFMVYYDMDDPNRRPFH 482 Query 480 VAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY 539 +++PS TTY LNP YR+Y+IDG Y G+++ V D +TY N+T+AN+ P W L Y Sbjct 483 FNWISPSLTTYDWLNPAYRIYEIDGGYEGATYTVKDAKTYFANVTEANMKNKEPEWVLSY 542 Query 540 RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGT--PCRLATLCA 597 RE Y + + P +W +L ++ + LF+ + LY++ H +E C T CR +C Sbjct 543 DTREHYQMADFSPQSWSDLSDKLWTNTTLFRDYVRLYYRNHYNNE-CYTDYKCRYTFVCD 601 Query 598 QLSARADSPALCRHL 612 R+ + C HL Sbjct 602 IKKGRSYDESFCDHL 616
>sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase
asm-3 OS=Caenorhabditis elegans OX=6239 GN=asm-3 PE=3 SV=2 Length=589 Score = 609 bits (1569), Expect = 0.0, Method: Composition-based stats. Identities = 195/549 (36%), Positives = 286/549 (52%), Gaps = 18/549 (3%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C CK + + ++ V +A+ +C I VC I+ F D+ + V ++ Sbjct 21 CEECKSIVDLLQFEWGEKKTEECVMEIAVFICETFHIEDNDVCNFIISDFSDEFMYVIKQ 80 Query 151 SVLSPSEACGLLLGSTCGHW--DIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD 208 +++P + CGLL+ + CG + + + WN+++P +PP P PG P R L LTD Sbjct 81 ILVTPHQLCGLLMKNDCGDFVDPLATIWNMTIPG-NQPPFVPKQVVPPGNPTLRALHLTD 139 Query 209 LHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG-----AGYWGEYSKCDLPLRTLESLL 263 LH D Y G + DC P CCR G AG WG CD P L ++L Sbjct 140 LHVDMFYTVGLEADCGTPQCCRPQDMNVEIVENGDVKQPAGPWGSVGSCDTPYWLLTNML 199 Query 264 SGLG-PAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE 322 + AG D + +GD+ +H VW T + + ++ +R + PVY AVGNHE Sbjct 200 QNIASTAGKLDYIMVSGDLVSHTVWAYTPETHSFMVKNLSDTIRSYFPKTPVYFAVGNHE 259 Query 323 STPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL 382 PV++ P F + WLY+AM+ AW+ W+PA+ ++L G Y Y GLR+ISL Sbjct 260 GVPVDNIAPHFTPKKYHMDWLYKAMSNAWQGWIPADQEKSLEYNGCYMKKIYDGLRMISL 319 Query 383 NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSWSWN 440 N + R NFWL IN TDP G LQWL+ +LQ AE+ GDKVHI+ HIP G L+ ++ N Sbjct 320 NNVYGDRINFWLYINQTDPDGTLQWLINQLQDAENVGDKVHIVAHIPGSDGEALEGYALN 379 Query 441 YYRIVARYENTLAAQFFGHTHVDEFEVFYD--EETLSRPLAVAFLAPSATTYIGLNPGYR 498 YY+I+ RY NT+ QFFGHTH ++F + Y ++ S P V + APS T Y P YR Sbjct 380 YYKIINRYANTVVGQFFGHTHSEKFYMMYANPDDYKSTPTNVVYSAPSVTPYSDYFPAYR 439 Query 499 VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR-ARETYGLPNTLPTAWHN 557 +Y IDG + GS++ V+D+E + NLT N W++LY+ A YGL +PT ++ Sbjct 440 IYTIDGVHKGSTYQVIDYEEWFFNLTSNNANPTNVKWEVLYQSANMEYGLKGQIPTEYNQ 499 Query 558 LVYRMRGDMQLFQTFWFLYHKG--HPPSEPC-GTPCRLATLCAQLSARADSPALCRHLMP 614 ++ RM+ D LF ++ +++ + PC CR LC + LC L Sbjct 500 MIERMKTDDSLFNKYYENHNRRSIYDGRAPCNDQQCRNGYLCDARQFHQ-TQQLCTDLEG 558 Query 615 DGSLPEAQS 623 PE + Sbjct 559 GIQKPEPKK 567
>sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis
elegans OX=6239 GN=asm-1 PE=1 SV=2 Length=564 Score = 604 bits (1557), Expect = 0.0, Method: Composition-based stats. Identities = 184/539 (34%), Positives = 283/539 (53%), Gaps = 21/539 (4%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFE 141 D +G+ L C C GL + + LK + + + A +C L P AVC I F Sbjct 33 DKYGFQPL-CISCTGLISVASFFLKFDVSEPVILEFATIVCKLFAKQPWAVCDGISSQFR 91 Query 142 DDMVEVWRR-SVLSPSEACGLLLGSTCGHWD-IFSSWNISLPTVPKPPP--KPPSPPAPG 197 D+ V+RR + SPS+ CG++L D S W ++LP PK K P Sbjct 92 DEFFYVFRRLANESPSQICGIILPDCADPTDPSESGWMVALPPKPKRTRISKKKVQKKPN 151 Query 198 APVSR---ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL 254 +S+ +L LTDLH D +Y ++ +C DP+CCR P + AGYWG KCD+ Sbjct 152 MSMSQNLNVLQLTDLHVDFEYKYPSEANCDDPVCCRVSVSEP---KKAAGYWGSVGKCDI 208 Query 255 PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV 314 P T+E++LS + DMV TGD H W + ++ L L + LV+ P+ Sbjct 209 PFWTVENMLSHINKTHMIDMVIMTGDYINHVDWEYSIEEHLSVLRKLHRLVQNTFPSTPI 268 Query 315 YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY 374 Y A+GNHE PVNSF P ++ WLY+ PWL A +L G Y+ Sbjct 269 YWALGNHEGVPVNSFAPHSVDERFWPTWLYKEFQTMSGPWLSEGAKDSLLKRGSYSTQVM 328 Query 375 PGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--H 432 GL+LI+LN FC NF+L +N +DP + W V EL +E +G++V+++ HIPPG Sbjct 329 DGLKLITLNTGFCEVTNFFLYLNQSDPDSSMSWFVKELFESEKKGEQVYVLAHIPPGDSE 388 Query 433 CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE--ETLSRPLAVAFLAPSATTY 490 CL+ W++NYYR++ R+ +T+AAQFFGH H+D F VFY++ S+P++V + +PS TT+ Sbjct 389 CLEGWAFNYYRVIQRFSSTIAAQFFGHDHLDYFTVFYEDMHNVSSKPISVGYASPSVTTF 448 Query 491 IGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNT 550 NP YR+Y+ID + ++D TY +L +A P W+ LY AR+ +G+ + Sbjct 449 EYQNPAYRIYEID---PYNKFKIVDFTTYYADLEKAT-EDKKPVWEKLYSARQAHGMDDL 504 Query 551 LPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARADSPALC 609 P +W+ ++ ++ + + F+ + P C + C++ +C +S C Sbjct 505 SPLSWNKVIQKLFTSEKKREKFYQYAFRNFSPQ--CDSTCQMQLMCNLRMGHHNSTLYC 561
>sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium
discoideum OX=44689 GN=sgmB PE=3 SV=1 Length=637 Score = 564 bits (1454), Expect = 0.0, Method: Composition-based stats. Identities = 202/536 (38%), Positives = 287/536 (54%), Gaps = 30/536 (6%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C ICK + + + + + AI LC L I VC ++ LF + V Sbjct 77 CDICKFGINQVQKMIASKQGIEDISKYAIDLCTYLHIEKAEVCNGLIPLFANMTYNVLSY 136 Query 151 SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLH 210 ++ CG + C + SS NI PKPP PP P+P +P +IL ++D+H Sbjct 137 PTVTGEYVCGFV--GFCPYVPRNSS-NIINFPKPKPPHVPPVAPSPNSPTMKILHISDIH 193 Query 211 WDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP-- 268 D Y G + DC +PLCCR +G P AG WG Y CD+ ++ +ES+ + Sbjct 194 VDPVYESGMNADCGEPLCCRAPNG-PGVGEKAAGEWGHY-LCDINMKMVESMFEFIDQEF 251 Query 269 AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPV-PVYPAVGNHESTPVN 327 D+V+WTGD P HD+W QT Q+ A VT LV+K+ G V+PA+GNHES PVN Sbjct 252 GEDIDIVFWTGDNPPHDIWEQTYDSQINASQLVTNLVKKYFGSTAKVFPAIGNHESLPVN 311 Query 328 SFPPPFIEGNHSSRWLYEAMAKAWEPWLP-AEALRTLRIGGFYALSPYPGLRLISLNMNF 386 SFP P S W++ A++ W W+ E + L+ GG+Y L GLR+ISLNMN+ Sbjct 312 SFPLP-----PGSSWIFNALSYDWSDWVNVDEQVANLQYGGYYTLPVQSGLRVISLNMNW 366 Query 387 CSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG--HCLKSWSWNYYRI 444 C+ N +L NSTDPA LQW+V LQA+ED G+KV+++GHIPPG C+ SWS +I Sbjct 367 CNNGNLYLAENSTDPANMLQWIVDTLQASEDIGEKVYLVGHIPPGIPDCIDSWSEQLLQI 426 Query 445 VARYENTLAAQFFGHTHVDEFEVFY---DEETLSRPL---AVAFLAPSATTYIGLNPGYR 498 V RYE+T+ A F+GHTH DEF V+Y DE S P+ V + PS TTY NP +R Sbjct 427 VNRYEDTILASFYGHTHRDEFSVYYTQSDENDPSSPMRASNVIYTTPSVTTYQHQNPSFR 486 Query 499 VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNL 558 ++ +D N + +++ TY +L+QAN+ G P W L Y TY +PN P + Sbjct 487 IFTVDSN----TGYLMESSTYHTDLSQANLNGK-PTWLLEYNTTNTYNIPNLTPISMDLA 541 Query 559 VYRMRGDMQLFQTFWFLYHKG--HPPSEPCGT-PCRLATLCAQLSARADSPALCRH 611 + + + + + Y+ +P S+PC + C+L +C SA C H Sbjct 542 IQNINSSNSMLEDYHVHYYSASPYPESKPCTSISCKLDYICKMKSAAYLKYYECIH 597
>sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium
discoideum OX=44689 GN=sgmA PE=3 SV=1 Length=583 Score = 552 bits (1423), Expect = 0.0, Method: Composition-based stats. Identities = 168/565 (30%), Positives = 273/565 (48%), Gaps = 47/565 (8%) Query 72 RLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPA 131 +L + L+C +C+ + + +KK ++ + LC K P Sbjct 36 KLDKAAATTLQHGENIQLSCDVCQIGASLLEDFIKKNASLTEIIKGLSDLCIASKEEQPE 95 Query 132 VCQSIVHLFEDDMVEVWRRSVLSPSEACGLL-LGSTCGHW----------DIFSSWNISL 180 VC I++ + +V+V +S +PS+ CG + S G + + + + Sbjct 96 VCTGILNNYVPIIVDVLIQSDFTPSQLCGYFKICSATGSSESSSISNSFDNEYRQESFNK 155 Query 181 PTVP---KPPPKPPSPPAP-------GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCR 230 PT+ KP K S P + IL ++D+H+D DY G++P+C PLCCR Sbjct 156 PTMKVNKKPQYKDLSNQEPLVKKFKGNDSIGYILQISDVHFDPDYKVGSNPNCGRPLCCR 215 Query 231 RGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGP-AGPFDMVYWTGDIPAHDVWHQ 289 G G AG G Y CD+P T+E + L D + WTGD P H+VW Q Sbjct 216 DGVGS-------AGPIGHY-LCDIPFSTVELIFQHLATLTDQLDFIVWTGDNPPHNVWEQ 267 Query 290 TRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAK 349 ++ Q A T+ +++K PV P++GNHE+ P + + P S+WL +++ Sbjct 268 SQAQQELATATLAQVIQKTFPNTPVLPSLGNHEAYPADQYVLPN------SQWLLDSIYT 321 Query 350 AWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINS--TDPAGQLQW 407 W PWL A+AL ++ G+Y PGLR++SLN NF+ L+ + P Q W Sbjct 322 YWAPWLDADALELVKERGYYTSLIKPGLRVMSLNTLENDMINFYNLLPTYLKGPNNQSDW 381 Query 408 LVGELQAAEDRGDKVHIIGHIP---PGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDE 464 ++ L+ A+ G+KV IIGHIP W Y ++V ++ + + Q +GHTH D+ Sbjct 382 MINTLEQAQSNGEKVLIIGHIPCTVKSASTDGWCAMYEQVVGQFSDVIIGQLYGHTHYDQ 441 Query 465 FEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLT 524 F VF D T + P + ++ PS TTY PGYR+YQ D S++ ++++ Y N+T Sbjct 442 FSVFSDVATHTIPTGMNYIVPSLTTYQNHEPGYRIYQFD----YSTNQIVNYYQYHANIT 497 Query 525 QANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSE 584 +AN GA+ ++QL Y A+E Y + + PT+W + +M+ + +F ++ F P E Sbjct 498 EANETGAL-NFQLTYSAKELYNMDDLSPTSWTKVANQMKTNSTMFNSY-FENLSSSPIKE 555 Query 585 PCGTPCRLATLCAQLSARADSPALC 609 C C+ +C + C Sbjct 556 SCDQACQTKWICQIFGITSSEFDKC 580
>sp|Q641Z7|ASM3A_RAT Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Rattus norvegicus OX=10116 GN=Smpdl3a PE=2 SV=1 Length=445 Score = 473 bits (1216), Expect = 2e-161, Method: Composition-based stats. Identities = 137/450 (30%), Positives = 212/450 (47%), Gaps = 46/450 (10%) Query 186 PPPKPPSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAG 244 P P PA GAP V + +TDLH D Y TD D +G+ + G Sbjct 19 PGLGVPLAPAYGAPAVGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANVS-----NPG 71 Query 245 YWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQLRALTTVT 302 +G+ CD P + + S + +G + WTGD P H + + + +T +T Sbjct 72 PFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTGSVIEVITNMT 130 Query 303 ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT 362 V+ + V+PA+GNH+ P + P ++ +Y A++ W+PWL EA+ T Sbjct 131 VTVQNLFPNLQVFPALGNHDYWPQDQLPI-------ATSKVYSAVSDLWKPWLDEEAIST 183 Query 363 LRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 LR GGFY+ P LR+ISLN N N + +N TDPA Q +WL L ++ + Sbjct 184 LRKGGFYSQKVASNPDLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLRNKE 242 Query 421 KVHIIGHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE 471 KV++I H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 243 KVYVIAHVPVGYLPYATKTPAMRQYYNEKLVDIFRRYSSVIAGQFYGHTHRDSLMVLSDK 302 Query 472 ETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQ 525 P+ F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+ Sbjct 303 N--GNPINSVFVAPAVTPVKGVLEKETNNPGVRLFQ----YKPGDYTLLDMLQYYLNLTE 356 Query 526 ANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSE 584 AN+ G +W L Y + YG+ + P + H L ++ D + F ++ + + S Sbjct 357 ANLKGE-SNWTLEYTLTQAYGVADLQPKSLHGLAQQLATIDSKQFLKYYHYFFVSYDSSA 415 Query 585 PCGTPCRLATLCAQLSARADSPALC--RHL 612 PC C+ +CA ++ S C RHL Sbjct 416 PCDQRCKTLQICAIMNLDLVSYEDCLKRHL 445
>sp|Q92484|ASM3A_HUMAN Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2 Length=453 Score = 469 bits (1208), Expect = 5e-160, Method: Composition-based stats. Identities = 129/453 (28%), Positives = 204/453 (45%), Gaps = 49/453 (11%) Query 178 ISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP 237 + LP P PP + + +TDLH D Y TD D +G+ Sbjct 21 LGLPVAPAGGRNPPPA------IGQFWHVTDLHLDPTY-HITD-DHTKVCASSKGANAS- 71 Query 238 ASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQL 295 G +G+ CD P + + S + +G + WTGD P H + + + Sbjct 72 ----NPGPFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVI 126 Query 296 RALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWL 355 +T +T ++ + V+PA+GNH+ P + P + +Y A+A W+PWL Sbjct 127 NVITNMTTTIQSLFPNLQVFPALGNHDYWPQDQLPV-------VTSKVYNAVANLWKPWL 179 Query 356 PAEALRTLRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQ 413 EA+ TLR GGFY+ P LR+ISLN N N + +N TDPA Q +WL L Sbjct 180 DEEAISTLRKGGFYSQKVTTNPNLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLESTLN 238 Query 414 AAEDRGDKVHIIGHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDE 464 ++ +KV+II H+P G+ + ++ I +Y + +A QF+GHTH D Sbjct 239 NSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDS 298 Query 465 FEVFYDEETLSRPLAVAFLAPSATTY------IGLNPGYRVYQIDGNYSGSSHVVLDHET 518 V D++ P+ F+AP+ T NPG R++Q Y + +LD Sbjct 299 IMVLSDKK--GSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQ----YDPRDYKLLDMLQ 352 Query 519 YILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYH 577 Y LNLT+AN+ G W+L Y +TY + + P + + L + D + F ++ + Sbjct 353 YYLNLTEANLKGE-SIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFF 411 Query 578 KGHPPSEPCGTPCRLATLCAQLSARADSPALCR 610 + S C C+ +CA ++ S A C Sbjct 412 VSYDSSVTCDKTCKAFQICAIMNLDNISYADCL 444
>sp|P70158|ASM3A_MOUSE Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Mus musculus OX=10090 GN=Smpdl3a PE=1 SV=2 Length=445 Score = 468 bits (1205), Expect = 8e-160, Method: Composition-based stats. Identities = 137/450 (30%), Positives = 209/450 (46%), Gaps = 46/450 (10%) Query 186 PPPKPPSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAG 244 P P PA AP V + +TDLH D Y D C G A+ G Sbjct 19 PGLGVPLAPADRAPAVGQFWHVTDLHLDPTYHITDD----RTKVCASSKG---ANASNPG 71 Query 245 YWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVWHQ-TRQDQLRALTTVT 302 +G+ CD P + + S + +G + WTGD P H + + ++ +T +T Sbjct 72 PFGDV-LCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMT 130 Query 303 ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT 362 V+ + V+PA+GNH+ P + P + +Y A+A W+PWL EA+ T Sbjct 131 MTVQNLFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAIST 183 Query 363 LRIGGFYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD 420 L+ GGFY+ PGLR+ISLN N N + +N TDPA Q +WL L ++ + Sbjct 184 LKKGGFYSQKVASNPGLRIISLNTNLYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKE 242 Query 421 KVHIIGHIPPGHC---------LKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDE 471 KV+II H+P G+ + ++ I RY + +A QF+GHTH D V D+ Sbjct 243 KVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDK 302 Query 472 ETLSRPLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQ 525 PL F+AP+ T G+ NPG R++Q Y + +LD Y LNLT+ Sbjct 303 N--GNPLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTE 356 Query 526 ANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG-DMQLFQTFWFLYHKGHPPSE 584 AN+ G +W L Y + Y + + P + + LV + D + F ++ Y + S Sbjct 357 ANLKGE-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSA 415 Query 585 PCGTPCRLATLCAQLSARADSPALC--RHL 612 C C+ +CA ++ + S C +HL Sbjct 416 TCDQHCKTLQVCAIMNLDSMSYDDCLKQHL 445
>sp|Q3ZC91|ASM3A_BOVIN Cyclic GMP-AMP phosphodiesterase SMPDL3A
OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1 Length=450 Score = 465 bits (1196), Expect = 2e-158, Method: Composition-based stats. Identities = 124/440 (28%), Positives = 197/440 (45%), Gaps = 43/440 (10%) Query 190 PPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEY 249 P +P G V + +TD H D Y D C G + G +G+ Sbjct 24 PLAPAGTGPAVGQFWHVTDFHLDPTYHITGD----HTKVCASSKGAEASD---PGPFGDV 76 Query 250 SKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHDVW-HQTRQDQLRALTTVTALVRK 307 CD P R + S L + +G + WTGD P H + + +T +++ Sbjct 77 -MCDSPYRLIFSALDFIKNSGQKVSFMIWTGDSPPHVPVLELSTDKVINVTANITTTIQR 135 Query 308 FLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGG 367 + V+PA+GNH+ P + P + +Y A+A W+PWL +A+ TLR GG Sbjct 136 LFPNLQVFPALGNHDYWPQDQLPV-------VNSKVYNAVANLWKPWLTEDAITTLRKGG 188 Query 368 FYALSP--YPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 FY P LR+ISLN N N + +N TDPA Q +WL L ++ +KV+II Sbjct 189 FYTQKVSNNPKLRIISLNTNLYYGPN-SVTLNQTDPANQFEWLENTLNISQQNKEKVYII 247 Query 426 GHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR 476 H+P G+ K + I +Y + +A QF+GHTH D V D++ + Sbjct 248 AHVPVGYLPYARGISAMRKYHNEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKK--GK 305 Query 477 PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 P+ F+AP+ T + NPG R++Q Y + +LD Y LNLT AN+ G Sbjct 306 PVNSLFVAPAVTPVRSVLERLTNNPGVRLFQ----YDPRDYKLLDMLQYYLNLTDANLKG 361 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMR-GDMQLFQTFWFLYHKGHPPSEPCGTP 589 +W+L Y + Y + + P + + L + + + F ++ + + S C Sbjct 362 E-SNWKLEYNLTQAYDIQDLQPKSLYKLAKQFAIQESKQFIKYYKYFFVSYDSSVICQGK 420 Query 590 CRLATLCAQLSARADSPALC 609 C++ +CA ++ S C Sbjct 421 CKIFQICAIMNLDVISYTDC 440
>sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase
3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2 Length=455 Score = 458 bits (1177), Expect = 2e-155, Method: Composition-based stats. Identities = 134/452 (30%), Positives = 200/452 (44%), Gaps = 49/452 (11%) Query 194 PAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCD 253 A + + DLH D DY DP P +G P P AG WG+Y CD Sbjct 14 GGARAEPGKFWHIADLHLDPDYKVSKDPFQVCP-----SAGSQPV--PDAGPWGDY-LCD 65 Query 254 LPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGP 311 P + S + + P D + WTGD H + + L + +T L+R+ Sbjct 66 SPWALINSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPD 125 Query 312 VPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYAL 371 VY A+GNH+ P N FP S +Y +A+ W+PWL E++ + G FY Sbjct 126 TKVYAALGNHDFHPKNQFPA-------GSNNIYNQIAELWKPWLSNESIALFKKGAFYCE 178 Query 372 S---PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHI 428 P R++ LN N N L + DP Q QWL L A GD V+I+GH+ Sbjct 179 KLPGPSGAGRIVVLNTNLYYTSNA-LTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHV 237 Query 429 PPGHCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLA 479 PPG K ++ Y ++V ++ +A QFFGH H D F + YD+ P++ Sbjct 238 PPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYDDA--GVPIS 295 Query 480 VAFLAPSATTYIG---------LNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPG 530 F+ P T + NP RV++ Y ++ + D TY +NL+QAN G Sbjct 296 AMFITPGVTPWKTTLPGVVNGANNPAIRVFE----YDRATLSLKDMVTYFMNLSQANAQG 351 Query 531 AIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPC 590 P W+L Y+ E YG+P+ + H ++ R+ GD Q ++ +Y+ + C C Sbjct 352 T-PRWELEYQLTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYY-VYNSVSYSAGVCDEAC 409 Query 591 RLATLCAQLSARADSPALCRHLMPDGSLPEAQ 622 + +CA D+ C L G+ P Q Sbjct 410 SMQHVCAMRQVDIDAYTTC--LYASGTTPVPQ 439
>sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase
3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1 Length=456 Score = 441 bits (1134), Expect = 6e-149, Method: Composition-based stats. Identities = 130/446 (29%), Positives = 198/446 (44%), Gaps = 47/446 (11%) Query 197 GAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPL 256 GA + R ++DLH D +Y DP P +G P AG WG+Y CD P Sbjct 17 GAQLGRFWHISDLHLDPNYTVSKDPLQVCP-----SAGSQPVLN--AGPWGDY-LCDSPW 68 Query 257 RTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRAL-TTVTALVRKFLGPVPV 314 + S L + P D + WTGD H + + A+ +T L+++ V Sbjct 69 ALINSSLYAMKEIEPKPDFILWTGDDTPHVPNESLGEAAVLAIVERLTNLIKEVFPDTKV 128 Query 315 YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALS-- 372 Y A+GNH+ P N FP S +Y +A+ W PWL E+ + G FY+ Sbjct 129 YAALGNHDFHPKNQFPA-------QSNRIYNQVAELWRPWLSNESYALFKRGAFYSEKLP 181 Query 373 -PYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPG 431 P R++ LN N N DP Q +WL L A G+ V++IGH+PPG Sbjct 182 GPSRAGRVVVLNTNLYYSNN-EQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPG 240 Query 432 HCLK---------SWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF 482 K S++ Y +++ ++ +A QFFGH H D F +FYD P+ V F Sbjct 241 FFEKTQNKAWFRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYD--NTGAPINVMF 298 Query 483 LAPSATTYIG---------LNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP 533 L P T + NPG R+++ Y ++ + D TY LNL QAN+ P Sbjct 299 LTPGVTPWKTTLPGVVDGANNPGIRIFE----YDRATLNLKDLVTYFLNLRQANVQ-ETP 353 Query 534 HWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLA 593 W+ YR E Y +P+ ++ H + R+ + + Q ++ +Y+ C CR+ Sbjct 354 RWEQEYRLTEAYQVPDASVSSMHTALTRIASEPHILQRYY-VYNSVSYNHLTCEDSCRIE 412 Query 594 TLCAQLSARADSPALCRHLMPDGSLP 619 +CA ++ A C H + +P Sbjct 413 HVCAIQHVAFNTYATCLHGLGAKLVP 438
>sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium
discoideum OX=44689 GN=sgmC PE=3 SV=1 Length=446 Score = 426 bits (1096), Expect = 2e-143, Method: Composition-based stats. Identities = 130/431 (30%), Positives = 202/431 (47%), Gaps = 40/431 (9%) Query 201 SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLE 260 + +TD H+D Y+EG D D CR + + GA G Y KCD L+ Sbjct 32 GKFWHITDTHYDFMYIEGGDEDKQ----CREVTYKSKYEKGGASSIGNY-KCDTSFELLQ 86 Query 261 SLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQD-QLRALTTVTALVRKFLGPVPVYPAV 318 S + D + WTGD P H Q + L+++T +T L++ + +P++P++ Sbjct 87 SSFEYMVKHEEKPDFIIWTGDDPPHLGNSQLNETLVLQSITNMTNLIKGYFPDIPIFPSI 146 Query 319 GNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLR 378 GNH+S P + WL+E +A+ W P+L +++ T ++GG+Y G R Sbjct 147 GNHDSYPQHQIGV-------GPNWLFENVAQLWSPFLSNDSIETFKLGGYYTELVSEGFR 199 Query 379 LISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWS 438 +ISLN F EN +N TDPAGQL WL L A G++V IIGH+PPG+ K Sbjct 200 IISLNTVFYYNENRQ-CLNLTDPAGQLLWLNETLANASLAGERVWIIGHVPPGYNEKYDV 258 Query 439 WNYYR--------IVARYENTLAAQFFGHTHVDEFEVFYDEETLS----RPLAVAFLAPS 486 +N+++ ++Y + + +GH H D F +FYD+ P + FL+PS Sbjct 259 FNFHKQFNDEYLFSFSQYSDIIEFHIYGHEHTDTFRLFYDDPNDHINDIEPTGIMFLSPS 318 Query 487 ATTYIGL-------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLY 539 T ++ NPG R+Y+ Y+ +S +LD+ + NLT I G I WQL Y Sbjct 319 LTPWMNQFLPALPNNPGLRLYE----YNITSFALLDYYQFWTNLTDNIISGNID-WQLEY 373 Query 540 RARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQL 599 RA E + N P + + ++ F F Y+ P++ C C+ LC+ Sbjct 374 RATEFFNTFNLSPVSMYEAYLLIQSVTSQLLKFHF-YNSVSYPTKGCDEICKKIQLCSIR 432 Query 600 SARADSPALCR 610 C Sbjct 433 HPFTKGFKECL 443
>sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces
pombe (strain 972 / ATCC 24843) OX=284812 GN=ppn1 PE=3 SV=1 Length=577 Score = 315 bits (807), Expect = 2e-98, Method: Composition-based stats. Identities = 92/365 (25%), Positives = 149/365 (41%), Gaps = 48/365 (13%) Query 195 APGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYW--GEYSK 251 + G P V R L +TD+H D Y +G+ D S P + GY G + Sbjct 40 SKGKPLVGRFLHITDMHPDIYYEKGSTVDHYCH-SYDHNSDDTPLGKSKVGYLSPGPGYE 98 Query 252 CDLPLRTLESLLSGLGPA-----GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVR 306 CD ++ L L G D + WTGD HD + + Q L + LV Sbjct 99 CDSSPALIDKTLEWLKEHQDDVLGGIDFILWTGDNSRHDNDNHFPRTQSEILASNEDLVN 158 Query 307 KF---LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTL 363 K VP+ A+GN++ P N + +A AW+ +P E T Sbjct 159 KMIEAFPDVPIVSAIGNNDIYPHNIM-------EAGPSSMTRQLAGAWDALIPYEERHTF 211 Query 364 RIGGFYALSPYPG-LRLISLNMNFCSRENFWLL---INSTDPAGQL--QWLVGELQAAED 417 G +Y P L IS+N + S +N + ++ D G L +W +L+A Sbjct 212 EKGSYYLCDVIPDKLAAISINTLYLSNKNAAVDGCPDDNLDEPGSLFMRWFKIQLEAYRL 271 Query 418 RGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLS 475 +G KV ++GHIPP G + ++ ++ + + + Q +GH +++ F VF + + L Sbjct 272 KGMKVWLLGHIPPTRGQWYEDCYTSFTDLLYEFRDIIVGQLYGHMNINHF-VFLEFDKL- 329 Query 476 RPLAVAFLAPSATTYIGLN---PGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAI 532 P T G+ P Y ID Y+ + T+ NLT+ + G + Sbjct 330 ---------PVDTESYGIKSAQPKYVKSLIDAQYA-------ELPTFPENLTEEFLNGTV 373 Query 533 PHWQL 537 ++ L Sbjct 374 GNYSL 378 Score = 34.7 bits (78), Expect = 2.7, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 26/65 (40%), Gaps = 3/65 (5%) Query 506 YSGSSHVVLDHETYILNLTQ--ANIPGAIPHWQLLYRARET-YGLPNTLPTAWHNLVYRM 562 Y S + + Y LN + ++LLY ++++ Y +P+ + L R+ Sbjct 465 YVPSLFTPISFKQYFLNTSNYMDATKDTEISYELLYTSKDSPYNMPDLTVPEYMRLAKRI 524 Query 563 RGDMQ 567 + Sbjct 525 ATCDK 529
>sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata
(strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PPN1 PE=3 SV=1 Length=663 Score = 317 bits (813), Expect = 3e-98, Method: Composition-based stats. Identities = 78/314 (25%), Positives = 117/314 (37%), Gaps = 41/314 (13%) Query 178 ISLPTVPKPPPKPPS--PPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGL 235 ISL P+ P R L +TD+H D Y+ GT D SG Sbjct 60 ISLGLTPRKPVVITDLRTGNKRKLHGRFLHITDMHPDEYYVAGTSIDNVC------HSGE 113 Query 236 PPASRPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQ 289 P + A +G S CD P+ ++ L + D V WTGD HD + Sbjct 114 PTKGKDRAAKFGNAMSGCDSPMLLMDMTLDWIDKNLKDQIDFVVWTGDNIRHDNDRTYPR 173 Query 290 TRQDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHS 339 T + R V ++K VPV P++GN++ P N F Sbjct 174 TEDEIFRMNAEVAEKIKKIFRTPNSPDPRDFAVPVVPSIGNNDVFPHNLFS-------LG 226 Query 340 SRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWLLINS 398 + W ++P E R + PG L ++S N + + N L+++ Sbjct 227 PTLQTREYYRLWGDFIPEEQQRMFDRDASFFTEVIPGKLAVLSFNTLYLFKAN--PLVDN 284 Query 399 TDPAGQ-----LQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENT 451 D Q L WL L +RG KV I GH+PP + S + + Y + Sbjct 285 CDSRKQPGYQLLLWLGYVLDEIRERGMKVWISGHVPPIAKNYDSSCYDKFSLWMHEYRDV 344 Query 452 LAAQFFGHTHVDEF 465 + +GH ++D F Sbjct 345 IIGGLYGHMNMDHF 358
>sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii
(strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=PPN1 PE=3 SV=3 Length=713 Score = 313 bits (802), Expect = 4e-96, Method: Composition-based stats. Identities = 74/310 (24%), Positives = 114/310 (37%), Gaps = 42/310 (14%) Query 180 LPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPAS 239 L PKP K R L +TD+H D Y G D C G G Sbjct 74 LGLSPKPKLKIVKGGDEQVLHGRFLHITDMHPDKYYKTGADVGS----LCHSGKGS---- 125 Query 240 RPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQTRQD 293 AG +G+ CD P+ +E L + D V WTGD HD +T + Sbjct 126 ---AGKYGDAVLGCDSPMVLMEDTLKWVKENLKDKIDFVVWTGDNVRHDNDRRYPRTESN 182 Query 294 QLRALTTVTALVRKFLG------------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSR 341 V+ L+ + +P+ P++GN++ P N F P Sbjct 183 IFDMNQRVSELMYETFKEENPRGGRPRQLKIPLVPSLGNNDVFPHNLFSP-------GPT 235 Query 342 WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS 398 + K W ++PA L G ++ P L ++S+N + + N + Sbjct 236 LQTRELFKIWHDFVPAAQLHIFNRGAYFFKEIIPNELAVLSINTLYLFQSNPLVDNCDRK 295 Query 399 TDPAGQ-LQWLVGELQAAEDRGDKVHIIGHIPPGH--CLKSWSWNYYRIVARYENTLAAQ 455 DP + +WL L+ R KV + GH+PP S Y + Y + + Sbjct 296 KDPGHKLFEWLGYTLKEMRARNMKVWLSGHVPPNEKNYDISCLRKYIVWMHEYRDVIIGG 355 Query 456 FFGHTHVDEF 465 +GH ++D F Sbjct 356 LYGHMNIDHF 365
>sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium
discoideum OX=44689 GN=sgmD PE=3 SV=1 Length=438 Score = 304 bits (779), Expect = 5e-96, Method: Composition-based stats. Identities = 101/450 (22%), Positives = 171/450 (38%), Gaps = 60/450 (13%) Query 197 GAPVSRILFLTDLHWDH---DYLEGTDPDCADPLCCRRGS---------GLPPASRPGAG 244 A ++ L ++D+H+ L C P + + P G Sbjct 16 NALNNQFLHISDVHYSSAMNSLLYNASVMCIGPTVTKEFDHKEHEDLIEDTERLNLPTNG 75 Query 245 YWGEYSKCDLPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHD----VWHQTRQDQLRALT 299 +G Y CD L ++S + D + +TGD H W +++ Sbjct 76 LYGRYG-CDTNQLLLSEVISEMLNVNSNPDFIIYTGDGAGHGLPNGPWSESQST------ 128 Query 300 TVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSS-RWLYEAMAKAWEPWLPAE 358 + + P +GN++ P + N S+ ++LYE W W+P Sbjct 129 -LAKSLYGAYPNTQFIPTIGNNDVFP-----DYNSQCNDSNLQFLYET----WAQWIPTN 178 Query 359 ALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDR 418 + + G + +SP GL +ISLN S +N DP GQ WL +L AA+ Sbjct 179 QVSSFLYRGSFVVSPVSGLTIISLNTILYSVKNKNTFSTPQDPCGQFAWLEQQLIAAKQA 238 Query 419 GDKVHIIGHIPPG----HCLKSWSWNY----YRIVARYENTLAAQFFGHTHVDEFE-VFY 469 G+ V+IIGHI PG + +W Y + I + Y+ T+ A FFGH H DE + + Sbjct 239 GNSVYIIGHIFPGLDPFYLQGTWKSQYQTAFFNITSDYQTTITAGFFGHIHRDEIRSIQF 298 Query 470 DEETLSRPLAV-AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANI 528 D +L+ F+ S T NP ++ + Y S + D Y ++ +N+ Sbjct 299 DNPSLTNNHYFPMFIGSSITPVYFNNPTFKQFT----YDSQSKNITDITAYFSDVYISNL 354 Query 529 PGAIPHWQLLYRARETYGLPNTLPTA---WHNLVYRMRGDMQLFQTFWFLYHKGHPPSEP 585 G + +W Y Y + N ++L+ RM +F + + P Sbjct 355 KGHM-NWTEEYDFVSIYDIDNQYGIGGDQLNSLMERMVSSNSIFNNYDNFRSGSYLSDSP 413 Query 586 CGTPCRLATLCAQLSARADSPALCRHLMPD 615 + C +A D C ++ + Sbjct 414 -------SMTCLINAATIDELNACTYIAAN 436
>sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis
(strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=PPN1 PE=3 SV=1 Length=681 Score = 310 bits (794), Expect = 2e-95, Method: Composition-based stats. Identities = 79/310 (25%), Positives = 113/310 (36%), Gaps = 36/310 (12%) Query 179 SLPTVPKPPPKPPSPPAPGAPV-SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP 237 SL P P K + R L +TD+H D Y E T D C R G P Sbjct 87 SLGLTPNQPVKITDIGGKEKSIKGRFLHITDMHPDLYYKENTSIDDT----CHR--GKPK 140 Query 238 ASRPGAGYWGE-YSKCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVW---HQTR 291 A +G CD P + L + + D + WTGD HD +T Sbjct 141 NDGDRAARFGNAMKGCDGPPDLMYYTLDWIHKNLSDEIDFIIWTGDNVRHDNDRRIPRTE 200 Query 292 QDQLRALTTVTALVRKFLGP----------VPVYPAVGNHESTPVNSFPPPFIEGNHSSR 341 Q V+ L K V + P++GN++ P N F P Sbjct 201 QQIFDMNRQVSELFLKTFKDHESDDPRDLKVKIIPSLGNNDVFPHNLFSP-------GPT 253 Query 342 WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS 398 + W ++P T + + PG L +ISLN + + N + N Sbjct 254 LQTRELYDIWSQFIPPAQQNTFDRYASFFVEAIPGKLAVISLNTLYMFKGNPLVDNCSNK 313 Query 399 TDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQ 455 P L W+ LQ DRG KV + GH+PP + S S + Y + + Sbjct 314 KQPGYKMLLWVGFTLQELRDRGMKVWLSGHVPPIPKNFDSSCSDKLALWLHEYSDIIIGG 373 Query 456 FFGHTHVDEF 465 F+GH ++D F Sbjct 374 FYGHMNMDHF 383
>sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae
(strain ATCC 204508 / S288c) OX=559292 GN=PPN1 PE=1 SV=1 Length=674 Score = 308 bits (790), Expect = 7e-95, Method: Composition-based stats. Identities = 71/310 (23%), Positives = 115/310 (37%), Gaps = 37/310 (12%) Query 180 LPTVPKPP--PKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPP 237 L P+ P K R L +TD+H D Y+EG+ D +G P Sbjct 72 LGLTPREPVIIKDVKTGKERKLHGRFLHITDIHPDPYYVEGSSIDAVC------HTGKPS 125 Query 238 ASRPGAGYWGE-YSKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDVW---HQTR 291 + A +G+ S CD P+ +E L + D V WTGD HD +T Sbjct 126 KKKDVAPKFGKAMSGCDSPVILMEETLRWIKENLRDKIDFVIWTGDNIRHDNDRKHPRTE 185 Query 292 QDQLRALTTVTALVRKFLG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSR 341 V + + V V P++GN++ P N F Sbjct 186 AQIFDMNNIVADKMTELFSAGNEEDPRDFDVSVIPSLGNNDVFPHNMFA-------LGPT 238 Query 342 WLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINS 398 + W+ ++P + RT + PG L ++S+N + + N + + Sbjct 239 LQTREYYRIWKNFVPQQQQRTFDRSASFLTEVIPGKLAVLSINTLYLFKANPLVDNCNSK 298 Query 399 TDPAGQ-LQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYRIVARYENTLAAQ 455 +P Q L W L+ RG KV + GH+PP + +S + Y + + Sbjct 299 KEPGYQLLLWFGYVLEELRSRGMKVWLSGHVPPIAKNFDQSCYDKFTLWTHEYRDIIIGG 358 Query 456 FFGHTHVDEF 465 +GH ++D F Sbjct 359 LYGHMNIDHF 368 Score = 39.0 bits (89), Expect = 0.14, Method: Composition-based stats. Identities = 9/91 (10%), Positives = 28/91 (31%), Gaps = 9/91 (10%) Query 499 VYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIP--------HWQLLYRARET-YGLPN 549 Y++ Y + +L + N +++ Y + E Y + + Sbjct 579 KYELGPAYVPQLFTPTRFVQFYADLEKINQELHNSFVESKDIFRYEIEYTSDEKPYSMDS 638 Query 550 TLPTAWHNLVYRMRGDMQLFQTFWFLYHKGH 580 ++ +L R+ + ++ + Sbjct 639 LTVGSYLDLAGRLYENKPAWEKYVEWSFASS 669
>sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans
var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=PPN1 PE=3 SV=1 Length=678 Score = 302 bits (774), Expect = 2e-92, Method: Composition-based stats. Identities = 81/337 (24%), Positives = 125/337 (37%), Gaps = 52/337 (15%) Query 179 SLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA 238 S+P + + R L +TD+H D Y G+ D C R Sbjct 34 SVPQLDHSELQNVRINKKRPLKGRFLHITDIHPDPHYKTGSTFDSG----CHRKPKKDGK 89 Query 239 SRPG--------------------------AGYWGE-YSKCDLPLRTLESLLSGLGP--A 269 S AG WG S CD P+ + L A Sbjct 90 SEGKKATENERGNEDLDDKEFDTLIKNEDLAGKWGTAVSDCDCPMSLVNITFDWLKEEWA 149 Query 270 GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG----PVPVYPAVGNHESTP 325 D V WTGD HD+ + + + +V + L +P+ P++GN++ P Sbjct 150 NEVDFVVWTGDNARHDIDRRIPRTPKEIFDSNRMIVDRMLDAFGRDMPIVPSIGNNDIYP 209 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNM 384 N + E W+ ++P+EA G ++++ P L +ISLN Sbjct 210 HNVLAA-------GPSRITEEFLLIWKHFIPSEAAHVFERGAYFSVEVIPDRLAVISLNT 262 Query 385 NFCSRENF---WLLINSTDPAG-QLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWS 438 F N +S DP ++ WL +L RG +V + GH+PP H + Sbjct 263 LFWYDANTLVDGCRDHSNDPGALEMDWLEVQLNNFRQRGMQVWLTGHVPPHMNHYYDNCY 322 Query 439 WNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLS 475 Y + RY++T+ FGH +VD F F D + L Sbjct 323 LRYGDLALRYQDTIVGHLFGHMNVDHF-FFIDVDELE 358
>sp|Q756F2|PPN1_EREGS Endopolyphosphatase OS=Eremothecium gossypii
(strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=PPN1 PE=3 SV=2 Length=594 Score = 296 bits (758), Expect = 5e-91, Method: Composition-based stats. Identities = 71/292 (24%), Positives = 111/292 (38%), Gaps = 44/292 (15%) Query 201 SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGE-YSKCDLPLRTL 259 R L +TD+H D Y+EG+ C + R AG +G+ CD P+ + Sbjct 69 GRFLHITDIHPDPLYVEGSSIAG----ACHGDPARDASDR--AGRFGDAMGGCDAPMDLM 122 Query 260 ESLLSGLGPA--GPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG------- 310 L+ + D V WTGD HD + + + L + +F Sbjct 123 NYTLAWVATHLRDEIDFVVWTGDNARHDNDRRQPRTAEQILHMNAQVADQFYELFQQQRD 182 Query 311 -----PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRI 365 VPV P++GN++ P N F + + + W ++P E + Sbjct 183 GDTMQGVPVVPSLGNNDVFPHNMFS-------LGPTLMTRQLQRIWAKFIPEEQRQAFEH 235 Query 366 GGFYALSPYPG-LRLISLNMNFCSRENFWLLINSTDPA----GQLQWLVGELQAAEDRGD 420 + + P L +IS N + + N L+ N D A L WL L+ R Sbjct 236 DTSFFVEVIPDRLAVISFNTLYFFKSNP-LVDNCNDKAQPGHALLLWLGSVLEEMRARNM 294 Query 421 KVHIIGHIPP------GHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFE 466 KV + GH+PP G C +W Y Y + + +GH +VD F Sbjct 295 KVWLSGHVPPIPKNFEGSCYNKLAWWTY----EYRDVIIGGLYGHMNVDHFY 342
>sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa
(strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=epp-1 PE=3 SV=3 Length=731 Score = 295 bits (756), Expect = 2e-89, Method: Composition-based stats. Identities = 79/325 (24%), Positives = 128/325 (39%), Gaps = 42/325 (13%) Query 191 PSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS 250 P + + L +TDLH D Y + D AD C RG G P Y E S Sbjct 45 PIANSARKLHGKFLHITDLHPDQFYKPHSSTDEAD--ACHRGKG------PAGVYGAEVS 96 Query 251 KCDLPLRTLESLLSGLGP--AGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF 308 CD P + + + D V WTGD HD ++ + L T + K Sbjct 97 DCDSPFALINATFDWIAANVKDDIDFVIWTGDTARHDSDEGVPRNADQVLGTNRWIADKM 156 Query 309 LG----------PVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE 358 +P+ P +GN++ P N P + WL + W ++P Sbjct 157 AELFSDSTGRHLEIPIVPTLGNNDILPHNILLP------GPNSWL-QHYTHIWRRFVPEA 209 Query 359 ALRTLRIGGFYALSPYPG-LRLISLNMNFCSRENFWL--LINSTDPA-GQLQWLVGELQA 414 + + GG++ + P L + SLN + N + ++P Q++WL +L Sbjct 210 QRHSFQFGGWFYVEVIPNRLAIFSLNTLYFFDRNAGTDGCASPSEPGYKQMEWLRIQLHI 269 Query 415 AEDRGDKVHIIGHIPPGH------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVF 468 +RG K ++GH+PP ++ Y + +Y + + + FGH ++D F Sbjct 270 MRERGMKAILMGHVPPARTDSKKLWDENCWQKYSLWLRQYRDVVVSGVFGHMNIDHF-FI 328 Query 469 YDEETLSRPLAVAFLAPSATTYIGL 493 +DE R + V LA A I + Sbjct 329 HDE----RDINVGQLAGLADNSIDI 349
>sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica
(strain CLIB 122 / E 150) OX=284591 GN=PPN1 PE=3 SV=1 Length=747 Score = 277 bits (707), Expect = 5e-82, Method: Composition-based stats. Identities = 77/411 (19%), Positives = 133/411 (32%), Gaps = 69/411 (17%) Query 201 SRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR-------------------- 240 + L +TD+H D + G + + P Sbjct 49 GKFLHITDIHPDPYFHVGAVAEDKCHVDPDHKDSDYPDEDSELVWFRATGKKKHNHHKGK 108 Query 241 -----PGAGYWGEY-SKCDLPLRTLESLLSGLGPA--GPFDMVYWTGDIPAHDVW---HQ 289 P AGY+G S CD P+ + + + D + WTGD HD + Sbjct 109 DHEKMPKAGYYGHPLSSCDGPISLMNATFDWIDQNIRDEIDFIIWTGDNVRHDNDNRYPR 168 Query 290 TRQDQLRALTTVTALVRKFLG--------------------PVPVYPAVGNHESTPVNSF 329 QD V++ + +P+ P++GN++ P N + Sbjct 169 LEQDIFGYNQIVSSKFHELFRYNETRDGEGHNGGGDPQHPLVIPIIPSLGNNDVFPHNLY 228 Query 330 PPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPG-LRLISLNMNFCS 388 + M + W ++P G +Y G L +ISLN + Sbjct 229 LA-------GPSFQSRRMLQIWSEFVPEAQQHIFSRGSYYFQEVITGKLAVISLNTLYFY 281 Query 389 RENFWL--LINSTDPA-GQLQWLVGELQAAEDRGDKVHIIGHIPP--GHCLKSWSWNYYR 443 + N TDP L WL L RG KV + GH+PP + S Sbjct 282 KSNPMSDGCDEKTDPGYKHLVWLGVVLDEMRQRGMKVWLSGHVPPVEKNYEDSCHLKLAY 341 Query 444 IVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQID 503 + Y + + FGH ++D F V D + + + + P Y + I Sbjct 342 WLTEYRDIIVGSVFGHMNIDHFVVM-DPKKIEKAQSQDLGTPGL-GYKSHVTDFLDVAIS 399 Query 504 GNYSGSSHVVLDHETYILNLTQANIPGAIP-HWQLLYRARETYGLPNTLPT 553 ++ + + YI ++ + P W Y + + + + P+ Sbjct 400 ASHPVHTFGSIYKRNYIESVREDYSEIPGPKKWLDEYASN--FAIAHVSPS 448
>sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP
PE=1 SV=2 Length=524 Score = 53.2 bits (126), Expect = 6e-06, Method: Composition-based stats. Identities = 21/82 (26%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF 140 + +L C ICK + TA LK + K C+ L K A C+ IV + Sbjct 54 NKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSY 113 Query 141 EDDMVEVWRRSVLSPSEACGLL 162 ++++ + + P E C L Sbjct 114 LPVILDIIKGEMSRPGEVCSAL 135 Score = 44.0 bits (102), Expect = 0.004, Method: Composition-based stats. Identities = 15/84 (18%), Positives = 33/84 (39%), Gaps = 1/84 (1%) Query 79 RLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVH 138 + +V ++ C +C+ L + + + K+C+ L + CQ +V Sbjct 303 KKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVD 362 Query 139 LFEDDMVEVWRRSVLSPSEACGLL 162 + ++ + V SP C +L Sbjct 363 TYGSSILSILLEEV-SPELVCSML 385 Score = 40.5 bits (93), Expect = 0.052, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 31/79 (39%), Gaps = 3/79 (4%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C +CK L ++ L+K + + K C+ L C V +E ++E+ Sbjct 409 CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVE 468 Query 151 SVLSPSEACGLLLGSTCGH 169 V+ PS C L C Sbjct 469 -VMDPSFVC--LKIGACPS 484
>sp|P10960|SAP_RAT Prosaposin OS=Rattus norvegicus OX=10116 GN=Psap
PE=1 SV=1 Length=554 Score = 51.7 bits (122), Expect = 2e-05, Method: Composition-based stats. Identities = 27/129 (21%), Positives = 50/129 (39%), Gaps = 5/129 (4%) Query 78 PRLRDVFGWGN-LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSI 136 P +DV N + C +C+ + ++ + + K C+LL CQ + Sbjct 300 PYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEV 359 Query 137 VHLFEDDMVEVWRRSVLSPSEACGLL-LGSTCGHWD--IFSSWNISLPTVPKPPPKPPSP 193 + F +++V V +P+ CG++ L S + + + +PK P P P Sbjct 360 LVTFGPSLLDVLMHEV-NPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQP 418 Query 194 PAPGAPVSR 202 P R Sbjct 419 EEPKQSALR 427 Score = 49.4 bits (116), Expect = 9e-05, Method: Composition-based stats. Identities = 17/82 (21%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAP-PAVCQSIVHLF 140 +L C ICK + T LK + K C + + A C+ +V + Sbjct 54 SKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSY 113 Query 141 EDDMVEVWRRSVLSPSEACGLL 162 ++++ + + +P E C L Sbjct 114 LPVILDMIKGEMSNPGEVCSAL 135 Score = 44.4 bits (103), Expect = 0.003, Method: Composition-based stats. Identities = 27/116 (23%), Positives = 44/116 (38%), Gaps = 12/116 (10%) Query 44 ALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINL 103 A+ AL AP + Q + L VP ++ G+ C +CK L + Sbjct 403 AIVSALPKEP---APPKQPEEPKQ---SALRAHVPPQKNG-GF----CEVCKKLVIYLEH 451 Query 104 GLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC 159 L+K + + K C+ L C V +E ++E+ V+ PS C Sbjct 452 NLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVE-VMDPSFVC 506
>sp|Q61207|SAP_MOUSE Prosaposin OS=Mus musculus OX=10090 GN=Psap
PE=1 SV=2 Length=557 Score = 50.9 bits (120), Expect = 3e-05, Method: Composition-based stats. Identities = 23/115 (20%), Positives = 40/115 (35%), Gaps = 10/115 (9%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C C+ + + + + C LL CQ +V F +++++ Sbjct 317 CQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIH 376 Query 151 SVLSPSEACGLL-LGSTCG--------HWDIFSSWNISLPTVPKPPPKPPSPPAP 196 V +PS CG++ L + S + PT PK P +P P Sbjct 377 EV-NPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALP 430 Score = 49.0 bits (115), Expect = 1e-04, Method: Composition-based stats. Identities = 17/82 (21%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAP-PAVCQSIVHLF 140 +L C ICK + T LK + K C + + A C+ +V + Sbjct 54 SKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSY 113 Query 141 EDDMVEVWRRSVLSPSEACGLL 162 ++++ + + +P E C L Sbjct 114 LPVILDMIKGEMSNPGEVCSAL 135 Score = 41.7 bits (96), Expect = 0.019, Method: Composition-based stats. Identities = 24/108 (22%), Positives = 40/108 (37%), Gaps = 7/108 (6%) Query 52 SRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNV 111 S +L P Q + L VP ++ G+ C +CK L + L+K Sbjct 409 SALLKEPTPPKQ-PAQPKQSALPAHVPPQKNG-GF----CEVCKKLVLYLEHNLEKNSTK 462 Query 112 ARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEAC 159 + + K C+ L C V +E ++E+ V+ P C Sbjct 463 EEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVE-VMDPGFVC 509
>sp|Q9SB68|ADPRM_ARATH Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Arabidopsis thaliana OX=3702 GN=At4g24730 PE=2 SV=1 Length=311 Score = 50.1 bits (118), Expect = 3e-05, Method: Composition-based stats. Identities = 49/229 (21%), Positives = 76/229 (33%), Gaps = 56/229 (24%) Query 267 GPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLG-PVPVYPAVGNHESTP 325 G V GDI V +DQ A T LV +F PVY +GNH Sbjct 51 NQHGNLKFVINMGDI----VDGFCPKDQSLAATK--KLVHEFEKFNGPVYHMIGNHCLYN 104 Query 326 VNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSP---------YPG 376 + + A+ + P R + + G+ + Sbjct 105 LPREELLPLLKIPGRD------GNAYYDFSPTPEYRVVVLDGYDISAVGWPQEHPNTIAA 158 Query 377 LRLISLNMNFCSRENFWLLINSTDPAG------------------QLQWLVGELQAAEDR 418 L+++ +N + PAG QLQWL LQ A + Sbjct 159 LKIL-------EEKNPNT--DKNSPAGLEDVARRFVKYNGGVGEKQLQWLDSVLQDASNS 209 Query 419 GDKVHIIGHIP--PGHCLKS---WSW-NYYRIVARYENTLAAQFFGHTH 461 +V + GH+P PG K+ W++ I+ +Y++ GH H Sbjct 210 NQRVIVCGHVPMSPGVASKAALLWNFDEVMNIIHKYDSVKVC-LSGHDH 257
>sp|P20097|SAP_CAVPO Saposin-C OS=Cavia porcellus OX=10141 GN=PSAP
PE=1 SV=1 Length=81 Score = 45.9 bits (107), Expect = 3e-05, Method: Composition-based stats. Identities = 15/73 (21%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Query 87 GNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVE 146 ++TC C+ + + + ++ +C LL + VCQ +V + D +V Sbjct 1 ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVA 60 Query 147 VWRRSVLSPSEAC 159 + + +SP C Sbjct 61 LLLQE-MSPELVC 72
>sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces
cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR202W PE=1 SV=1 Length=602 Score = 50.5 bits (119), Expect = 4e-05, Method: Composition-based stats. Identities = 70/422 (17%), Positives = 140/422 (33%), Gaps = 50/422 (12%) Query 180 LPTVPKPPPKPPSPPAPGAPVSRILFLTDLHW-DHDYLEGTDPDCADPLCCRRGSGLPPA 238 + P + P+ P L D+H D +++ TD G + Sbjct 16 IFAKPYQQQQAVLAPSQDVP------LRDIHIGDINFIHTTDT--------HGWLGSHLS 61 Query 239 SRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRAL 298 WG++ + ++ L + +V TGD D + L Sbjct 62 QNDYDADWGDF------VAFVDILREKILRQSRDVIVIDTGD--KRDGNGLSDATWPPGL 113 Query 299 TTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAE 358 + + + + +GNHE S G S + + ++ + Sbjct 114 RS-SEIFNMMDYDL---LTLGNHELYTAES-AILEYRGTSQSSKFKDKYVCSNVEFIEDD 168 Query 359 ALRTLRIGGFY--ALSPYPGLRLISLNMNFCSRE--NFWLLINSTDPAGQLQWLVGELQA 414 R + G Y +P R+++L+ F + N ++ + Q W ++ Sbjct 169 GTR-VPFGNKYITFETPIMKQRVLALSFLFSFQRANNRAIVTPPLEEITQKSWFQNMVET 227 Query 415 AEDRG-DKVHIIGHIPPGHCLKSWSWNYYRIVARYE-NTLAAQFFGHTHVDEFEVFYDEE 472 + D + + GH+P + + ++ +Y NT+ F GHTH+ +F V D + Sbjct 228 NREEEIDLIIVFGHLPATDPTEREMHKIHALIRKYYPNTVIQYFGGHTHIRDF-VQLDSK 286 Query 473 TLSRPLA-----VAFLAPSAT-TYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQA 526 + V FL+ + T +P + ID N + + + N+ + Sbjct 287 STCLQSGRFAETVGFLSINMTDPVDAESPIFSRRYIDFNKEAFKYHLSKL-GHDSNVPVS 345 Query 527 NIPGAIPHWQLLYRARETYGLP---NTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPS 583 G +L+ R L +P ++ + + L + + HK P Sbjct 346 TKKGKTIS-RLVNDLRHELNLNEKLGYIPQTYYVSTRPLNSEENL---YHLITHKILPNL 401 Query 584 EP 585 P Sbjct 402 IP 403
>sp|Q8C1C1|SAPL1_MOUSE Proactivator polypeptide-like 1 OS=Mus
musculus OX=10090 GN=Psapl1 PE=1 SV=2 Length=522 Score = 50.1 bits (118), Expect = 4e-05, Method: Composition-based stats. Identities = 23/125 (18%), Positives = 52/125 (42%), Gaps = 4/125 (3%) Query 89 LTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVW 148 LTC +C L ++ L A + ++C ++ C ++V + ++V++ Sbjct 293 LTCDVCLNLVQELDKWLVTNSTEALISHTLERVCTVVPEPLVQQCITLVDTYSPELVQLM 352 Query 149 RRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTD 208 + ++P + C + CG S + ++ T P P + + R+L ++ Sbjct 353 SK--VTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSS 408 Query 209 LHWDH 213 + DH Sbjct 409 QNLDH 413
>sp|Q28FE0|CPPED_XENTR Serine/threonine-protein phosphatase CPPED1
OS=Xenopus tropicalis OX=8364 GN=cpped1 PE=2 SV=1 Length=311 Score = 49.4 bits (116), Expect = 5e-05, Method: Composition-based stats. Identities = 40/234 (17%), Positives = 72/234 (31%), Gaps = 51/234 (22%) Query 248 EYSKCD-------LPLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALT 299 E CD +R E + + P GD+ + +++Q + L Sbjct 48 EIGDCDYGGDEWEQEIRLTEEAVKAINKLSPKPKFFVLCGDLVHSMPGIEWKEEQEKDLK 107 Query 300 TVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEA 359 V ++K +P+ GNH+ GN + +A +W + Sbjct 108 NV---LQKTHQEIPLVFVSGNHDI------------GNAPTPETIQAYCDSWG-----DD 147 Query 360 LRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRG 419 + +GG + + LN + + +WL +L AE+R Sbjct 148 YFSFWVGGVFF---------LVLNSQLFFDASKCPEL----KDNHDRWLAAQLAIAEERK 194 Query 420 DK-VHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD 463 K + HIP +Y+ I + F GH H + Sbjct 195 CKHAIVFQHIPLFLQKADEDNDYFNIEKSLRQEILQMFLKAGIKAVFSGHYHRN 248
>sp|P26779|SAP_BOVIN Prosaposin OS=Bos taurus OX=9913 GN=PSAP
PE=1 SV=3 Length=525 Score = 48.6 bits (114), Expect = 1e-04, Method: Composition-based stats. Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 9/107 (8%) Query 62 HPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKL 121 H S +G PA R++PR F C +CK L ++ L+K ++ + K Sbjct 387 HLCSSRGLPAATVRVMPRKDGGF------CEVCKKLVGYLDRNLEKNSTKEQILAALEKG 440 Query 122 CNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCG 168 C+ L C V +E ++E+ V+ PS C L C Sbjct 441 CSFLPDQYRKQCDQFVTEYEPVLIEILVE-VMDPSFVC--LKIGACP 484 Score = 48.2 bits (113), Expect = 2e-04, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF 140 +L C ICK + TA LK + + C+ L K A C+ IV + Sbjct 54 SKPTVKSLPCDICKDVITAAGNLLKDNATEQEILMYLERTCDWLPKPNMSASCKEIVDSY 113 Query 141 EDDMVEVWRRSVLSPSEACGLL 162 ++++ + + P E C L Sbjct 114 LPVILDMIKGQMSHPGEVCSAL 135 Score = 42.8 bits (99), Expect = 0.008, Method: Composition-based stats. Identities = 15/87 (17%), Positives = 33/87 (38%), Gaps = 2/87 (2%) Query 83 VFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFED 142 ++ C +C+ + + + + K+C+ L + CQ +V + Sbjct 308 APAKADIYCEVCEFVVKEVAKLIDNNRTEEEILHALDKVCSKLPTSLAEQCQEVVDTYGS 367 Query 143 DMVEVWRRSVLSPSEACGLL-LGSTCG 168 ++ + SP C +L L S+ G Sbjct 368 SILSILLDEA-SPELVCSMLHLCSSRG 393
>sp|O13035|SAP_CHICK Prosaposin OS=Gallus gallus OX=9031 GN=PSAP
PE=1 SV=1 Length=518 Score = 47.4 bits (111), Expect = 3e-04, Method: Composition-based stats. Identities = 18/82 (22%), Positives = 30/82 (37%), Gaps = 1/82 (1%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAV-CQSIVHLF 140 ++ C +CK L T + LK + S K C L A C+ IV + Sbjct 55 SKPAVNSIPCDLCKELVTVVGKVLKDNGTEDEIRSYLEKRCEFLPDQGLASECKEIVDSY 114 Query 141 EDDMVEVWRRSVLSPSEACGLL 162 ++++ + P C L Sbjct 115 LPVIMDMIKEEFDKPEVVCSAL 136 Score = 44.7 bits (104), Expect = 0.002, Method: Composition-based stats. Identities = 17/129 (13%), Positives = 41/129 (32%), Gaps = 19/129 (15%) Query 69 HPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIA 128 H ++ + + C IC+ + + L+ + +C LL + Sbjct 291 HEVKMETVEKATVQEKTFS--VCEICETMVKEVTGLLESNKTEEEIVHEMEVVCYLLPAS 348 Query 129 PPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPP 188 C+ + ++ ++++ + +P C ++ C KPP Sbjct 349 VKDQCKDFIEVYGQALIDMLLEAT-NPEAVC--VMLKCC--------------AANKPPQ 391 Query 189 KPPSPPAPG 197 +P G Sbjct 392 QPVVVKPAG 400 Score = 44.0 bits (102), Expect = 0.004, Method: Composition-based stats. Identities = 18/78 (23%), Positives = 34/78 (44%), Gaps = 3/78 (4%) Query 91 CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR 150 C ICK + + L+K + ++ K+C+ L + C V +E +V++ Sbjct 403 CDICKMIVAYADKELEKNATTTEIEALLEKVCHFLPESVSDQCVQFVEQYEPVVVQLLAE 462 Query 151 SVLSPSEACGLLLGSTCG 168 ++ P+ C L CG Sbjct 463 -MMDPTFVCTKL--GVCG 477
>sp|Q5U3W0|CPPED_DANRE Serine/threonine-protein phosphatase CPPED1
OS=Danio rerio OX=7955 GN=cpped1 PE=2 SV=1 Length=309 Score = 45.9 bits (107), Expect = 7e-04, Method: Composition-based stats. Identities = 42/250 (17%), Positives = 73/250 (29%), Gaps = 54/250 (22%) Query 232 GSGLPPASRPGAGYWGEYSKCDL-------PLRTLESLLSGLGPAGPFD-MVYWTGDIPA 283 + P A G+ CD ++ + + + P + GD+ Sbjct 35 QAADPQLGLMKAWRIGD---CDSGGDEWDEEVQLTKQAVQAINKLQPKPRFIVLCGDLVH 91 Query 284 HDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWL 343 R+ Q++ L +R +P+ GNH+ GN + Sbjct 92 AMPGSPFREQQIKDLK---DALRGTDPHIPLVFVSGNHD------------LGNAPTPDT 136 Query 344 YEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAG 403 E W G Y G+ + LN F + + Sbjct 137 VEQFCHEW--------------GDDYFSFWVGGVLCLVLNSQFFFDSSGCPELME----A 178 Query 404 QLQWLVGELQAAEDRGDK-VHIIGHIP-----PGHCLKSWSWN---YYRIVARYENT-LA 453 WL LQ A + V + HIP P ++ ++ R++ + Sbjct 179 HEVWLENRLQMAVQTPSRHVLVFQHIPLFLRTPDEEDDYFNLQRGIREHLIQRFKRAGVK 238 Query 454 AQFFGHTHVD 463 A F GH H + Sbjct 239 AVFSGHYHRN 248
>sp|Q5RCR9|CPPED_PONAB Serine/threonine-protein phosphatase CPPED1
OS=Pongo abelii OX=9601 GN=CPPED1 PE=2 SV=1 Length=314 Score = 45.9 bits (107), Expect = 7e-04, Method: Composition-based stats. Identities = 43/233 (18%), Positives = 66/233 (28%), Gaps = 52/233 (22%) Query 250 SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV 301 CD +R E + + P GD+ R +Q L V Sbjct 52 GDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRV 111 Query 302 TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR 361 V + +P+ GNH+ GN + + + W Sbjct 112 LRTVDR---AIPLVLVSGNHDI------------GNAPTAETVDEFCRTW---------- 146 Query 362 TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK 421 G Y G+ + LN F + + Q QWL +L A R + Sbjct 147 ----GDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQ----AQDQWLDEQLSIARQRHCQ 198 Query 422 -VHIIGHIPPG-HCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD 463 I HIP + Y+ + LA +F GH H + Sbjct 199 HAIIFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRN 251
>sp|Q3LIE5|ADPRM_HUMAN Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Homo sapiens OX=9606 GN=ADPRM PE=1 SV=1 Length=342 Score = 45.5 bits (106), Expect = 0.001, Method: Composition-based stats. Identities = 50/250 (20%), Positives = 87/250 (35%), Gaps = 58/250 (23%) Query 264 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES 323 + V GDI D ++ ++L V + ++ VPV+ GNHE Sbjct 58 DWNNESSMPCCVLQLGDII--DGYNAQYNASKKSLELVMDMFKRL--KVPVHHTWGNHEF 113 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 383 N ++++L + + E + + ++ + P+P R I L+ Sbjct 114 Y--NFSREYLTHSKLNTKFLEDQIVHH------PETMPSEDYYAYHFV-PFPKFRFILLD 164 Query 384 -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG 410 M N +NS ++P QL WL Sbjct 165 AYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNE 224 Query 411 ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH--- 461 L ++ +KV I+ H+P P +WNY ++ +E + F GHTH Sbjct 225 VLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCF-FAGHTHDGG 283 Query 462 --VDEFEVFY 469 D F V++ Sbjct 284 YSEDPFGVYH 293
>sp|Q8BFS6|CPPED_MOUSE Serine/threonine-protein phosphatase CPPED1
OS=Mus musculus OX=10090 GN=Cpped1 PE=1 SV=1 Length=312 Score = 44.7 bits (104), Expect = 0.001, Method: Composition-based stats. Identities = 44/232 (19%), Positives = 68/232 (29%), Gaps = 51/232 (22%) Query 250 SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV 301 CD +R E + + P GD+ RQ+Q R L V Sbjct 52 GNCDAGGDEWGQEIRLTEQAVEAINKLNPKPKFFVLCGDLVHAMPGTPWRQEQTRDLQRV 111 Query 302 TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR 361 V + +P+ GNH+ GN + E + W Sbjct 112 LKAVDQ---DIPLVMVSGNHD------------LGNAPTAETVEEFCQTW---------- 146 Query 362 TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK 421 G Y G+ + LN F + + Q WL +L AE + + Sbjct 147 ----GDDYFSFWVGGVLFLVLNSQFLYDASRCPALKQ----AQDHWLDQQLNIAEQKQCQ 198 Query 422 -VHIIGHIP---PGHCLKSWSWNYYRIVAR------YENTLAAQFFGHTHVD 463 + HIP +N + V + + A F GH H + Sbjct 199 HAIVFQHIPLFLQSIDEDDDYFNLTKTVRKELAEKLTRAGIRAVFSGHYHRN 250
>sp|Q9BRF8|CPPED_HUMAN Serine/threonine-protein phosphatase CPPED1
OS=Homo sapiens OX=9606 GN=CPPED1 PE=1 SV=3 Length=314 Score = 44.0 bits (102), Expect = 0.003, Method: Composition-based stats. Identities = 43/233 (18%), Positives = 66/233 (28%), Gaps = 52/233 (22%) Query 250 SKCDL-------PLRTLESLLSGLGPAGPF-DMVYWTGDIPAHDVWHQTRQDQLRALTTV 301 CD +R E + + P GD+ R +Q L V Sbjct 52 GDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRV 111 Query 302 TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR 361 V + +P+ GNH+ GN + E + W Sbjct 112 LRAVDR---AIPLVLVSGNHDI------------GNTPTAETVEEFCRTW---------- 146 Query 362 TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK 421 G Y G+ + LN F + + Q QWL +L A R + Sbjct 147 ----GDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQ----AQDQWLDEQLSIARQRHCQ 198 Query 422 -VHIIGHIPPG-HCLKSWSWNYYRIVARYENTLAAQFF---------GHTHVD 463 + HIP + Y+ + LA +F GH H + Sbjct 199 HAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRN 251
>sp|A7YY53|ADPRM_BOVIN Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Bos taurus OX=9913 GN=ADPRM PE=2 SV=2 Length=337 Score = 42.4 bits (98), Expect = 0.009, Method: Composition-based stats. Identities = 46/222 (21%), Positives = 78/222 (35%), Gaps = 53/222 (24%) Query 279 GDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNH 338 GDI D ++ + ++L V + VPV+ GNHE N Sbjct 73 GDII--DGYNAQYKASEKSLERVMNTFQML--RVPVHHTWGNHEFY--NFSRDYLTNSKL 126 Query 339 SSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISL---------------- 382 ++++L + +A E + + ++ + P+P R I L Sbjct 127 NTKFLEDQIAHH------PETVPSEDYYAYHFV-PFPKFRFILLDAYDMSVLGVDQSSPK 179 Query 383 -------------NMNFCS----RENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 N S RE ++ N QL WL L ++ +KV I+ Sbjct 180 YQQCLKILREHNPNTELNSPQGLREPQFVQFNGGFSPEQLNWLNAVLTFSDRNQEKVVIV 239 Query 426 GHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH 461 H+P P +WNY ++ ++ + F GHTH Sbjct 240 SHLPIYPEASDSVCLAWNYRDALAVIWSHKCVVCF-FAGHTH 280
>sp|Q99KS6|ADPRM_MOUSE Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Mus musculus OX=10090 GN=Adprm PE=1 SV=1 Length=340 Score = 42.4 bits (98), Expect = 0.009, Method: Composition-based stats. Identities = 48/237 (20%), Positives = 82/237 (35%), Gaps = 53/237 (22%) Query 264 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES 323 + V GDI D ++ + ++L V + VPV+ GNHE Sbjct 58 DWNKESSMPCCVLQLGDII--DGYNAQYKVSEKSLELVMNTFQML--KVPVHHTWGNHEF 113 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 383 N +S++L + +A+ E + ++ + P+P R I L+ Sbjct 114 Y--NFSRDYLASSKLNSKFLEDQIAQH------PETTPSENYYAYHFV-PFPKFRFILLD 164 Query 384 -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG 410 M N + +NS ++P QL WL Sbjct 165 SYDLSVLGIDPSSPKYEQCMKMLREHNPNVELNSPQGLSEPQYVQFNGGFSQEQLNWLNE 224 Query 411 ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH 461 L ++ +KV I+ H+P P +WNY I+ ++ + GHTH Sbjct 225 VLTFSDTNQEKVVIVSHLPIYPEASDSVCLAWNYVDALSIIWSHKCVVCF-LAGHTH 280
>sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with
thrombospondin motifs 13 OS=Homo sapiens OX=9606 GN=ADAMTS13 PE=1 SV=1 Length=1427 Score = 42.8 bits (99), Expect = 0.012, Method: Composition-based stats. Identities = 22/105 (21%), Positives = 32/105 (30%), Gaps = 7/105 (7%) Query 4 YGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHP 63 + + C SG DG A GL W L+L L+ +R +W P P Sbjct 234 HDGAPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSL---LSAGRARCVWDPPRPQP 290 Query 64 ----LSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLG 104 P P + + R FG + C + Sbjct 291 GSAGHPPDAQPGLYYSANEQCRVAFGPKAVACTFAREHLDMCQAL 335
>sp|Q6NUJ1|SAPL1_HUMAN Proactivator polypeptide-like 1 OS=Homo
sapiens OX=9606 GN=PSAPL1 PE=2 SV=2 Length=521 Score = 41.7 bits (96), Expect = 0.019, Method: Composition-based stats. Identities = 16/83 (19%), Positives = 35/83 (42%), Gaps = 2/83 (2%) Query 82 DVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLL-KIAPPAVCQSIVHLF 140 + +L C +C+ + A GL + + + ++ +K C L A C+ +V Sbjct 55 NKPTAKSLPCDVCQDIAAAAGNGLNPDATESDILALVMKTCEWLPSQESSAGCKWMVDAH 114 Query 141 EDDMVEVWR-RSVLSPSEACGLL 162 ++ + R +P++ C L Sbjct 115 SSAILSMLRGAPDSAPAQVCTAL 137 Score = 39.0 bits (89), Expect = 0.13, Method: Composition-based stats. Identities = 25/153 (16%), Positives = 60/153 (39%), Gaps = 17/153 (11%) Query 68 GHPARLHRIV------------PRLRDVFGWGN-LTCPICKGLFTAINLGLKKEPNVARV 114 G PARL ++V PR + +TC +C + ++ L + + Sbjct 258 GAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMI 317 Query 115 GSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFS 174 ++C+++ + C +V + +V++ + ++P + C + CG+ Sbjct 318 THALERVCSVMPASITKECIILVDTYSPSLVQLVAK--ITPEKVCKFI--RLCGNRRRAR 373 Query 175 SWNISLPTVPKPPPKPPSPPAPGAPVSRILFLT 207 + + + VP P + + R+L ++ Sbjct 374 AVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVS 406
>sp|Q7T0Q0|ADPRM_XENLA Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Xenopus laevis OX=8355 GN=adprm PE=2 SV=1 Length=356 Score = 40.9 bits (94), Expect = 0.026, Method: Composition-based stats. Identities = 20/85 (24%), Positives = 36/85 (42%), Gaps = 5/85 (6%) Query 382 LNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSW-S 438 LN E ++L N QL W+ L +++ + +KV ++ H+P P Sbjct 208 LNSPTGLEEEQFVLFNGGISPSQLDWIQSILTSSDKKEEKVFVVSHLPVHPDAADTMCLI 267 Query 439 WNYYRIVA--RYENTLAAQFFGHTH 461 WNY +++ + + GH H Sbjct 268 WNYPEVLSMLQSHPCVVGYLAGHNH 292
>sp|Q5M886|ADPRM_RAT Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Rattus norvegicus OX=10116 GN=Adprm PE=1 SV=1 Length=337 Score = 40.9 bits (94), Expect = 0.031, Method: Composition-based stats. Identities = 47/237 (20%), Positives = 81/237 (34%), Gaps = 53/237 (22%) Query 264 SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHES 323 + V GDI D ++ + ++L V + VPV+ GNHE Sbjct 58 DWNKESSMPCCVLQLGDII--DGYNAQYKVSEKSLELVMNTFQML--KVPVHHTWGNHEF 113 Query 324 TPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN 383 N +S++L + + + E + ++ + P+P R I L+ Sbjct 114 Y--NFSRDYLANSKLNSKFLEDQIPQH------PETTPSENYYAYHFV-PFPKFRFILLD 164 Query 384 -------------------MNFCSRENFWLLINS----TDPA----------GQLQWLVG 410 M N + +NS ++P QL WL Sbjct 165 SYDLSVLGIDQFSPKYEQCMKILREHNPNVELNSPQGLSEPQYVQFNGGFSQEQLNWLNE 224 Query 411 ELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYR---IVARYENTLAAQFFGHTH 461 L ++ +KV I+ H+P P +WNY I+ ++ + GHTH Sbjct 225 VLTFSDANQEKVVIVSHLPIYPEASDSVCLAWNYVDALSIIWSHQCVVCF-LAGHTH 280
>sp|Q66JJ3|ADPRM_XENTR Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Xenopus tropicalis OX=8364 GN=adprm PE=2 SV=1 Length=342 Score = 40.5 bits (93), Expect = 0.040, Method: Composition-based stats. Identities = 18/100 (18%), Positives = 37/100 (37%), Gaps = 17/100 (17%) Query 401 PAGQLQWLVGELQAAEDRGDKVHIIGHIP--PGHCLKSW-SWNYYRIVA--RYENTLAAQ 455 QL W+ L +++++ + V ++ H+P P WNY +++ + + Sbjct 213 SPSQLDWMERVLTSSDEKEENVFVVSHLPVHPDAADPMCLVWNYPEVLSVLQSHPCVVGY 272 Query 456 FFGHTH-----VD-------EFEVFYDEETLSRPLAVAFL 483 GH H +D F + SR ++ Sbjct 273 LAGHNHEGRYCMDPYGIHHLTFSGVIETPPESRAFGTMYV 312
>sp|Q58DC0|CPPED_BOVIN Serine/threonine-protein phosphatase CPPED1
OS=Bos taurus OX=9913 GN=CPPED1 PE=2 SV=1 Length=313 Score = 40.1 bits (92), Expect = 0.041, Method: Composition-based stats. Identities = 43/257 (17%), Positives = 69/257 (27%), Gaps = 56/257 (22%) Query 230 RRGSGLPPASRPGAGYWGEY-----SKCDL-------PLRTLESLLSGLGPAGPF-DMVY 276 R G + +G CD +R E + + P Sbjct 27 REWKGPFYFIQGADPQFGLMKAWATGDCDNGGDEWEQEIRLAEQAVQAINKLNPKPKFFV 86 Query 277 WTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEG 336 GD+ R++Q L V V +P+ GNH+ G Sbjct 87 LCGDLVHAMPGRPWRKEQTEDLQRVLRTVDS---DIPLVLVSGNHDV------------G 131 Query 337 NHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLI 396 N + + W G Y G+ + LN F + + Sbjct 132 NVPTPETIAEFQRTW--------------GDDYFSFWVGGVLFLVLNSQFLYDASRCPAL 177 Query 397 NSTDPAGQLQWLVGELQAAEDRGDK-VHIIGHIPPGHCLKSWSWNYYRIVARYENTLA-- 453 WL +L+ A R + + HIP +Y+ + +A Sbjct 178 KQ----EHDHWLDQQLRIAGQRACRHAVVFQHIPLFLQSIGEDDDYFNLTKSVRKEMADK 233 Query 454 -------AQFFGHTHVD 463 A F GH H + Sbjct 234 FVEAGVKAVFSGHYHRN 250
>sp|Q8H5F8|ADPRM_ORYSJ Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0688000 PE=2 SV=1 Length=321 Score = 40.1 bits (92), Expect = 0.047, Method: Composition-based stats. Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 7/66 (11%) Query 402 AGQLQWLVGELQAAEDRGDKVHIIGHIP--PGH-CLKSWSWNYYR---IVARYENTLAAQ 455 QL WL LQ A R V + H+P PG + WNY IV +Y+ + A Sbjct 201 KEQLSWLNDVLQDASARRQNVILCSHLPMDPGSASFAALMWNYDEVMAIVRQYK-CVKAC 259 Query 456 FFGHTH 461 F GH H Sbjct 260 FAGHDH 265
>sp|Q29075|NKL_PIG Antimicrobial peptide NK-lysin (Fragment) OS=Sus
scrofa OX=9823 GN=NKL PE=1 SV=1 Length=129 Score = 37.8 bits (86), Expect = 0.072, Method: Composition-based stats. Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 12/104 (12%) Query 42 ALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPR-----LRDVFGWGNLTCPICKG 96 LA + + L A AHP + L P+ R+ G L C C+ Sbjct 2 GLAFSGLTPEHSAL---ARAHPCDGEQFCQNLAPEDPQGDQLLQREELG---LICESCRK 55 Query 97 LFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLF 140 + + + +PN V A ++C+ +KI VC+ I+ F Sbjct 56 IIQKLEDMVGPQPNEDTVTQAASRVCDKMKILR-GVCKKIMRTF 98
>sp|P9WL81|Y2577_MYCTU Uncharacterized protein Rv2577 OS=Mycobacterium
tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2577 PE=3 SV=1 Length=529 Score = 39.7 bits (91), Expect = 0.092, Method: Composition-based stats. Identities = 43/238 (18%), Positives = 71/238 (30%), Gaps = 40/238 (17%) Query 205 FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS------KCD----- 253 LT+L D DY+ D P + +G+ S D Sbjct 130 HLTNLTPDTDYVYAAVHDGTTPELGTARTAPSGRKPLRFTSFGDQSTPALGRLADGRYVS 189 Query 254 ----LPLR-TLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF 308 P + + + P GD+ ++ + T R Sbjct 190 DNIGSPFAGDITIAIERIAPL----FNLINGDLCYANLAQDRIRTWSDWFDNNTRSARYR 245 Query 309 LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGF 368 P PA GNHE N I Y+A + +P G + Sbjct 246 ----PWMPAAGNHE----NEVGNGPIG--------YDAYQTYFA--VPDSGSSPQLRGLW 287 Query 369 YALSPYPGLRLISL-NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 Y+ + +R+ISL N + C ++ + Q +WL EL A + ++ Sbjct 288 YSFTA-GSVRVISLHNDDVCYQDGGNSYVRGYSGGEQRRWLQAELANARRDSEIDWVV 344
>sp|P9WL80|Y2577_MYCTO Uncharacterized protein MT2654 OS=Mycobacterium
tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2654 PE=3 SV=1 Length=529 Score = 39.7 bits (91), Expect = 0.092, Method: Composition-based stats. Identities = 43/238 (18%), Positives = 71/238 (30%), Gaps = 40/238 (17%) Query 205 FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYS------KCD----- 253 LT+L D DY+ D P + +G+ S D Sbjct 130 HLTNLTPDTDYVYAAVHDGTTPELGTARTAPSGRKPLRFTSFGDQSTPALGRLADGRYVS 189 Query 254 ----LPLR-TLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKF 308 P + + + P GD+ ++ + T R Sbjct 190 DNIGSPFAGDITIAIERIAPL----FNLINGDLCYANLAQDRIRTWSDWFDNNTRSARYR 245 Query 309 LGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGF 368 P PA GNHE N I Y+A + +P G + Sbjct 246 ----PWMPAAGNHE----NEVGNGPIG--------YDAYQTYFA--VPDSGSSPQLRGLW 287 Query 369 YALSPYPGLRLISL-NMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHII 425 Y+ + +R+ISL N + C ++ + Q +WL EL A + ++ Sbjct 288 YSFTA-GSVRVISLHNDDVCYQDGGNSYVRGYSGGEQRRWLQAELANARRDSEIDWVV 344
>sp|B2W0D9|STS1_PYRTR Tethering factor for nuclear proteasome
sts1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=sts1 PE=3 SV=1 Length=310 Score = 38.2 bits (87), Expect = 0.16, Method: Composition-based stats. Identities = 35/198 (18%), Positives = 54/198 (27%), Gaps = 36/198 (18%) Query 177 NISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLP 236 NIS +P P P + + + H D T Sbjct 76 NISGRPLPLPRLLETLSPDDMRNLLQ--SICQRHPDISNEIVTTAPRPSIQSTLEVLAKY 133 Query 237 PASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH--DVWHQTRQDQ 294 AS A +G + D + L L + D H Q Sbjct 134 EASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLK--------DFTPHFLPPNEQQPATS 185 Query 295 LRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPW 354 L L T ++ + + N ++ N + YE MAKAW Sbjct 186 LTFLDGATNIIHR----------LPNWDTFQHN----------RHKQEAYEEMAKAWAMV 225 Query 355 LPAEALRT----LRIGGF 368 + A + L+ GG+ Sbjct 226 IQEAAKKAGGIQLQYGGW 243
>sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces
pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1020.05 PE=3 SV=1 Length=509 Score = 38.6 bits (88), Expect = 0.19, Method: Composition-based stats. Identities = 51/292 (17%), Positives = 89/292 (30%), Gaps = 73/292 (25%) Query 195 APGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDL 254 +IL L+DLH+ +D C DP ++ A Sbjct 202 DEEKKTIKILQLSDLHY-----SNSDRPCRDPYPYETAEDCMADAKTTA----------- 245 Query 255 PLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTALVRKFLGPVPV 314 + LL D V TGD+ D +R + + V+ V VP Sbjct 246 ---FVNELLQ----LEEPDFVLLTGDLINGDT---SRDARSSLMKAVSPFVDY---NVPF 292 Query 315 YPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPY 374 GNH+ G+ S L + +++ + + G + L Sbjct 293 AVNFGNHD-----------DLGDLSREELAKILSQIPG---SMGLIGNVSGVGNFVLHSP 338 Query 375 PGLRLISLNMNFCSRENFWLLINSTDPA------GQLQWLVGELQAAEDRGDKVHIIGHI 428 + L+ N L P QL+WL ++ + ++ ++ HI Sbjct 339 RKFAIYVLDTK-GDTSNRRLC-----PGYDAITEDQLEWLSSKVADFKYEPIQMAVL-HI 391 Query 429 P----------PGHCLKSWSW-----NYYRIVARYENTLAAQFFGHTHVDEF 465 P G + S+ N + + + GH HV++F Sbjct 392 PLKEFCETEDLVGAFREPCSYSICDPNTAKALKSLR--IPLAIAGHDHVNDF 441
>sp|E3RPB1|STS1_PYRTT Tethering factor for nuclear proteasome
sts1 OS=Pyrenophora teres f. teres (strain 0-1) OX=861557 GN=sts1 PE=3 SV=1 Length=310 Score = 37.4 bits (85), Expect = 0.34, Method: Composition-based stats. Identities = 35/198 (18%), Positives = 54/198 (27%), Gaps = 36/198 (18%) Query 177 NISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLP 236 NIS +P P P + + + H D T Sbjct 76 NISGRPLPLPRLLETLSPDEMRNLLQ--SICQRHPDISNEIVTTAPRPSIQSTLEVLAKY 133 Query 237 PASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH--DVWHQTRQDQ 294 AS A +G + D + L L + D H Q Sbjct 134 EASFQAAFPFGGRASSDYAYNRVRQQLDELLDSLK--------DFTPHFLPPNEQQPATS 185 Query 295 LRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPW 354 L L T ++ + + N ++ N + YE MAKAW Sbjct 186 LAFLDGATDIIHR----------LPNWDTFQHN----------RHKQEAYEEMAKAWAIV 225 Query 355 LPAEALRT----LRIGGF 368 + A + L+ GG+ Sbjct 226 IREAAKKAGGIQLQYGGW 243
>sp|A2RSY6|TRM1L_MOUSE TRMT1-like protein OS=Mus musculus OX=10090
GN=Trmt1l PE=1 SV=1 Length=728 Score = 37.4 bits (85), Expect = 0.44, Method: Composition-based stats. Identities = 34/201 (17%), Positives = 61/201 (30%), Gaps = 22/201 (11%) Query 168 GHWDIFSSWNISLPTVPKPPPKPPSPPAP---GAPVSRILFLTDLHWDHDYLEGTDPDCA 224 G D SS N P P P + L +LHW C Sbjct 97 GDVDSASSLNSDNPGTENSQTCPLCPKEKFRAYSSHKLRRHLQNLHWKISVEFEGYRMCI 156 Query 225 DPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH 284 L CR + G + C + T+ DM+ G + H Sbjct 157 CHLACRPVK-PTIVGEQISSKLGAHYHCIICSATI---------TRRTDML---GHVKRH 203 Query 285 DVWHQTRQDQLRALTTVT--ALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRW 342 +T+ + A T + ++++ + V+P + S P + + + + Sbjct 204 VNKGETKSRYIAASTAKSSNEILKETDTDIQVFP----NYSIPQKTDSYFNPKMKLNRQI 259 Query 343 LYEAMAKAWEPWLPAEALRTL 363 ++ +A + P E L Sbjct 260 IFCTLAALAKERKPLECLDAF 280
>sp|Q08I43|ERI1_SCHPO 3'-5' exonuclease eri1 OS=Schizosaccharomyces
pombe (strain 972 / ATCC 24843) OX=284812 GN=eri1 PE=1 SV=1 Length=313 Score = 37.0 bits (84), Expect = 0.50, Method: Composition-based stats. Identities = 24/158 (15%), Positives = 55/158 (35%), Gaps = 22/158 (14%) Query 439 WNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYR 498 + + ++ N L VDE E+ +++ R + + + + Sbjct 160 EELFIFLRKHSNILVPS------VDEIEIIEPLKSVPRTQPKNWAWACDGPWDMASFLAK 213 Query 499 VYQID--GNYSGSSHVVLDHETYILNLTQ---ANIPGAIPHWQLLYRARETYGLPNTLPT 553 ++ D +D ++ ++ + NI G + HW L + E G+ + Sbjct 214 QFKYDKMPIPDWIKGPFVDIRSFYKDVYRVPRTNINGMLEHWGLQFEGSEHRGIDDA--R 271 Query 554 AWHNLVYRMRGDMQLF--QTFWFLY-------HKGHPP 582 +V +M + F +W Y ++ +PP Sbjct 272 NLSRIVKKMCSENVEFECNRWWMEYEKNGWIPNRSYPP 309
>sp|P50405|PSPB_MOUSE Pulmonary surfactant-associated protein
B OS=Mus musculus OX=10090 GN=Sftpb PE=1 SV=1 Length=377 Score = 37.0 bits (84), Expect = 0.56, Method: Composition-based stats. Identities = 26/139 (19%), Positives = 57/139 (41%), Gaps = 8/139 (6%) Query 69 HPARLHRIVPRLRDVFGWG--NLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLK 126 H + + L++V+G N C C+ + + K++ + + C++L Sbjct 44 HAVQCRALGHCLQEVWGHAGANDLCQECEDIVHLLTKMTKEDAFQEAIRKFLEQECDILP 103 Query 127 IAPP-AVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLP-TVP 184 + C+ ++ ++ +++ + +S ++P C + C N +P VP Sbjct 104 LKLLVPRCRQVLDVYLPLVIDYF-QSQINPKAICNHV--GLCPRGQAKPEQNPGMPDAVP 160 Query 185 KPPP-KPPSPPAPGAPVSR 202 P K P PGA ++R Sbjct 161 NPLLDKLVLPVLPGALLAR 179
>sp|Q8H129|PPA3_ARATH Purple acid phosphatase 3 OS=Arabidopsis
thaliana OX=3702 GN=PAP3 PE=2 SV=1 Length=366 Score = 36.6 bits (83), Expect = 0.56, Method: Composition-based stats. Identities = 15/80 (19%), Positives = 22/80 (28%), Gaps = 4/80 (5%) Query 244 GYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTVTA 303 G WG + + +G D V TGD + + T Sbjct 80 GDWGRRGS--YNQSQVALQMGEIGEKLDIDFVISTGDNFYDNGLTSLHDPLFQDSFTNIY 137 Query 304 LVRKFLGPVPVYPAVGNHES 323 P Y +GNH+ Sbjct 138 TAPSLQK--PWYSVLGNHDY 155
>sp|Q7T291|ADPRM_DANRE Manganese-dependent ADP-ribose/CDP-alcohol
diphosphatase OS=Danio rerio OX=7955 GN=adprm PE=1 SV=1 Length=322 Score = 35.9 bits (81), Expect = 1.1, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 7/65 (11%) Query 403 GQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKS---WSWNY---YRIVARYENTLAAQF 456 QLQWL L ++ + ++V I H+P C +WN+ ++ +++ L Sbjct 204 QQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCF-I 262 Query 457 FGHTH 461 GH H Sbjct 263 AGHDH 267
>sp|E7QJD3|YIM1_YEASZ Protein YIM1 OS=Saccharomyces cerevisiae
(strain Zymaflore VL3) OX=764100 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|E7LYS5|YIM1_YEASV Protein YIM1 OS=Saccharomyces cerevisiae
(strain VIN 13) OX=764099 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|E7KGT3|YIM1_YEASA Protein YIM1 OS=Saccharomyces cerevisiae
(strain AWRI796) OX=764097 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|C8ZF09|YIM1_YEAS8 Protein YIM1 OS=Saccharomyces cerevisiae
(strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|B5VPS4|YIM1_YEAS6 Protein YIM1 OS=Saccharomyces cerevisiae
(strain AWRI1631) OX=545124 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|C7GQ91|YIM1_YEAS2 Protein YIM1 OS=Saccharomyces cerevisiae
(strain JAY291) OX=574961 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|B3LM39|YIM1_YEAS1 Protein YIM1 OS=Saccharomyces cerevisiae
(strain RM11-1a) OX=285006 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.9 bits (81), Expect = 1.2, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 33/97 (34%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + ++ +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|Q9SCX8|PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis
thaliana OX=3702 GN=PAP17 PE=2 SV=1 Length=338 Score = 35.5 bits (80), Expect = 1.5, Method: Composition-based stats. Identities = 20/107 (19%), Positives = 33/107 (31%), Gaps = 18/107 (17%) Query 244 GYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDI-------PAHDVWHQTRQDQLR 296 G WG + + +G D V TGD HD + Sbjct 52 GDWGRRGS--FNQSLVAYQMGKIGEKIDLDFVVSTGDNFYDNGLFSEHDPN---FEQSFS 106 Query 297 ALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWL 343 + T +L +++ Y +GNH+ + SRW+ Sbjct 107 NIYTAPSLQKQW------YSVLGNHDYRGDAEAQLSSVLREIDSRWI 147
>sp|A6ZML0|YIM1_YEAS7 Protein YIM1 OS=Saccharomyces cerevisiae
(strain YJM789) OX=307796 GN=YIM1 PE=3 SV=1 Length=365 Score = 35.1 bits (79), Expect = 2.0, Method: Composition-based stats. Identities = 25/145 (17%), Positives = 49/145 (34%), Gaps = 12/145 (8%) Query 290 TRQDQLRALTTVTALVRKFLGPVP---VYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYE 345 D+ + V L + L ++ +VGNH+ PV + F P + + Sbjct 217 VPYDEGSIVENVKKLKQSVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGN 276 Query 346 AMAKA----WEPWLP----AEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLIN 397 A W ++ +A+ + + PYP I + + + I+ Sbjct 277 NKADYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYPPNNFIEVGNEMIKKGTYKPPID 336 Query 398 STDPAGQLQWLVGELQAAEDRGDKV 422 S Q + + L + +G V Sbjct 337 SVYEFDQYKEAIDRLISNRAKGKVV 361
>sp|P28625|YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae
(strain ATCC 204508 / S288c) OX=559292 GN=YIM1 PE=1 SV=2 Length=365 Score = 35.1 bits (79), Expect = 2.0, Method: Composition-based stats. Identities = 18/98 (18%), Positives = 34/98 (35%), Gaps = 12/98 (12%) Query 290 TRQDQLRALTTVTALVRKFLGPVP---VYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYE 345 D+ + V L + L ++ +VGNH+ PV + F P + + Sbjct 217 VPYDEGSIVENVKKLKQSVLENDKFDMIFDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGN 276 Query 346 AMAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 277 NKADYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|E7NLM5|YIM1_YEASO Protein YIM1 OS=Saccharomyces cerevisiae
(strain FostersO) OX=764101 GN=YIM1 PE=3 SV=1 Length=365 Score = 34.0 bits (76), Expect = 4.7, Method: Composition-based stats. Identities = 15/97 (15%), Positives = 32/97 (33%), Gaps = 9/97 (9%) Query 288 HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPV-NSFPPPFIEGNHSSRWLYEA 346 + + + +V + + +VGNH+ PV + F P + + Sbjct 218 PYDEGSIVENVKKLKQIVLENDKFDMIXDSVGNHDFFPVIDQFLKPKAKNSFYVTIAGNN 277 Query 347 MAKA----WEPWLP----AEALRTLRIGGFYALSPYP 375 A W ++ +A+ + + PYP Sbjct 278 KANYKNISWRDFVSLSSILKAINPFKKYNWRFGHPYP 314
>sp|A5WBU9|CNPD3_PSYWF Probable cyclic nucleotide phosphodiesterase
PsycPRwf_0181 OS=Psychrobacter sp. (strain PRwf-1) OX=349106 GN=PsycPRwf_0181 PE=3 SV=1 Length=340 Score = 34.0 bits (76), Expect = 4.8, Method: Composition-based stats. Identities = 34/185 (18%), Positives = 52/185 (28%), Gaps = 34/185 (18%) Query 188 PKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWG 247 PP+ + IL LTDLH + D + + + G Sbjct 27 YHPPTEISTDDGTVNILQLTDLHL--YFDTPKATHEQDINKDSAHQTITGICQNNSAKRG 84 Query 248 EYSKCDL----------PLRTLESLL-SGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLR 296 D + E+ L L D++ TGD+ + ++ Q Q + Sbjct 85 NPHSADAINHSVTPVIHNYASFEACLTQALSEDVRCDLIVVTGDLVS-EIHPQLYQHLYQ 143 Query 297 ALTTVTALVRKFLGPVPVYPAVGNHES---------TPVNSFPPPFIEGNHSSRWLYEAM 347 L +P GNH+ SF P + SR Y Sbjct 144 RLHQ---------SGIPFACIAGNHDVTDEIGKDLPFEQRSFEPHEPDSRLLSR--YSMK 192 Query 348 AKAWE 352 WE Sbjct 193 LNGWE 197
>sp|Q05904|SM34_LYTPI 34 kDa spicule matrix protein OS=Lytechinus
pictus OX=7653 PE=2 SV=1 Length=335 Score = 33.2 bits (74), Expect = 7.9, Method: Composition-based stats. Identities = 20/90 (22%), Positives = 31/90 (34%), Gaps = 2/90 (2%) Query 154 SPSEACGLLLGSTCGHWDIFSSWNISLPTVPKP--PPKPPSPPAPGAPVSRILFLTDLHW 211 +P+ G G + + SW +PT P P P +PP APV + +T Sbjct 111 TPAYPNGFAGFHQSGSYTSWPSWRPGMPTSGWPVNPANPWTPPPGRAPVMKGQHVTPQQP 170 Query 212 DHDYLEGTDPDCADPLCCRRGSGLPPASRP 241 G + D + R A + Sbjct 171 GQRPNLGPEWDLVEATAMRAFVCEVAAGQN 200 Lambda K H a alpha 0.318 0.128 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0393 0.140 1.90 42.6 43.6 Effective search space used: 68951548263 Database: uniprot_sprot.fasta Posted date: Jun 2, 2024 1:37 PM Number of letters in database: 206,878,625 Number of sequences in database: 571,609 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40