[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: unitmol_20210210.fasta
           579,098 sequences; 157,014,639 total letters



Query= YP_009725298.1 nsp2 [Severe acute respiratory syndrome coronavirus
2]

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

1n7u_A A Adsorption protein P2                                        32.7    9.7  


>1n7u_A A Adsorption protein P2
Length=554 Score = 32.7 bits (73), Expect = 9.7, Method: Compositional matrix adjust. Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 16/91 (18%) Query 556 PKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLV-----GTPV-CINGLM 609 P E I + ET P + T++V+++T DL P P A EA ++ P+ + G + Sbjct 243 PVEFI-ADPETCPAQPTTDKVIIRTTDLNPEGSPC--AYEAGIILVRQTSNPMNAVAGRL 299 Query 610 LLEIKD-------TEKYCALAPNMMVTNNTF 633 + ++D T K+ L P + +TNN F Sbjct 300 VPYVEDIAVDIFLTGKFFTLNPPLRITNNYF 330 Lambda K H a alpha 0.319 0.136 0.409 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 44949934777 Database: unitmol_20210210.fasta Posted date: Feb 12, 2021 5:45 PM Number of letters in database: 157,014,639 Number of sequences in database: 579,098 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40