[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
BLASTP 2.11.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: unitmol_20210609.fasta
           599,558 sequences; 163,607,441 total letters

Query= sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens
OX=9606 GN=KPNA2 PE=1 SV=1

                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

5h43_A A Importin subunit alpha-1                                     875     0.0   
4e4v_A A Importin subunit alpha-2                                     874     0.0   
4e4v_B B Importin subunit alpha-2                                     874     0.0   
3fey_C C Importin subunit alpha-2                                     871     0.0   
4wv6_A A Importin subunit alpha-1                                     871     0.0   
3wpt_B B Importin subunit alpha-1                                     865     0.0   
3wpt_A A Importin subunit alpha-1                                     864     0.0   
3fex_C C Importin subunit alpha-2                                     862     0.0   
1ial_A A IMPORTIN ALPHA                                               850     0.0   
3tpo_A A Importin subunit alpha-2                                     844     0.0   
5b56_B B Importin subunit alpha-1                                     843     0.0   
5b56_A A Importin subunit alpha-1                                     837     0.0   
1q1s_C C Importin alpha-2 subunit                                     836     0.0   
5gxw_A A Importin subunit alpha-1                                     836     0.0   
4ba3_A A IMPORTIN SUBUNIT ALPHA-2                                     836     0.0   
3knd_A A Importin subunit alpha-2                                     836     0.0   
3btr_A C Importin subunit alpha-2                                     834     0.0   
1q1t_C C Importin alpha-2 subunit                                     834     0.0   
3l3q_A A Importin subunit alpha-2                                     834     0.0   
3ukz_A B Importin subunit alpha-2                                     834     0.0   
5hhg_B E Importin subunit alpha-1                                     834     0.0   
4htv_A A Importin subunit alpha-2                                     834     0.0   
3uky_A B Importin subunit alpha-2                                     834     0.0   
1pjm_B B Importin alpha-2 subunit                                     834     0.0   
5fc8_B E Importin subunit alpha-1                                     834     0.0   
4mz5_C E Importin subunit alpha-1                                     834     0.0   
6iwa_B C Importin subunit alpha-1                                     834     0.0   
3rzx_A A Importin subunit alpha-2                                     834     0.0   
3ve6_A A Importin subunit alpha-2                                     832     0.0   
3ul0_A B Importin subunit alpha-2                                     832     0.0   
4oih_A A Importin subunit alpha-1                                     832     0.0   
1ejl_C I IMPORTIN ALPHA                                               832     0.0   
4u5v_A A Importin subunit alpha-1                                     832     0.0   
4u5o_A A Importin subunit alpha-1                                     832     0.0   
5u5r_A A Importin subunit alpha-1                                     832     0.0   
3zin_A A IMPORTIN SUBUNIT ALPHA-2                                     832     0.0   
5klt_A B Importin subunit alpha-1                                     832     0.0   
6bvt_A E Importin subunit alpha-1                                     832     0.0   
5umz_A B Importin subunit alpha-1                                     832     0.0   
1iq1_C C IMPORTIN ALPHA-2 SUBUNIT                                     832     0.0   
5svz_A A Importin subunit alpha-1                                     832     0.0   
4u5s_A A Importin subunit alpha-1                                     832     0.0   
6mjl_A B Importin subunit alpha-1                                     832     0.0   
3zio_A A IMPORTIN SUBUNIT ALPHA-2                                     832     0.0   
5w41_A A Importin subunit alpha-1                                     832     0.0   
1pjn_B B Importin alpha-2 subunit                                     832     0.0   
4mz6_C E Importin subunit alpha-1                                     832     0.0   
4u5n_A A Importin subunit alpha-1                                     832     0.0   
5ctt_A A Importin subunit alpha-1                                     832     0.0   
6bw0_B E Importin subunit alpha-1                                     832     0.0   
4u5l_A A Importin subunit alpha-1                                     832     0.0   
6p6a_A B Importin subunit alpha-1                                     832     0.0   
3zip_A A IMPORTIN SUBUNIT ALPHA-2                                     832     0.0   
1ejy_B I IMPORTIN ALPHA                                               832     0.0   
7l04_B E Importin subunit alpha-1                                     832     0.0   
6wx7_A A Importin subunit alpha-1                                     832     0.0   
5wun_A A Importin subunit alpha-1                                     832     0.0   
3ukw_A B Importin subunit alpha-2                                     832     0.0   
4u5u_A A Importin subunit alpha-1                                     832     0.0   
4u58_A A Importin subunit alpha-1                                     832     0.0   
3ul1_A B Importin subunit alpha-2                                     832     0.0   
5wum_A A Importin subunit alpha-1                                     832     0.0   
5u5p_C A Importin subunit alpha-1                                     832     0.0   
3ziq_A A IMPORTIN SUBUNIT ALPHA-2                                     832     0.0   
6bw1_B E Importin subunit alpha-1                                     832     0.0   
5klr_A B Importin subunit alpha-1                                     832     0.0   
3zir_A A IMPORTIN SUBUNIT ALPHA-2                                     832     0.0   
3ukx_A B Importin subunit alpha-2                                     832     0.0   
5ekf_C A Importin subunit alpha-1                                     830     0.0   
5w4e_A B Importin subunit alpha-1,Importin subunit alpha-1            830     0.0   
5w4g_A B Importin subunit alpha-1                                     830     0.0   
3oqs_B A Importin subunit alpha-2                                     830     0.0   
5e6q_A B Importin subunit alpha-1                                     830     0.0   
4uaf_A B Importin subunit alpha-1                                     830     0.0   
3uvu_B A Importin subunit alpha-2                                     830     0.0   
3rz9_A A Importin subunit alpha-2                                     830     0.0   
5ekg_C A Importin subunit alpha-1                                     830     0.0   
7jk7_B B Importin subunit alpha-1                                     830     0.0   
5w4f_A B Importin subunit alpha-1                                     830     0.0   
2ynr_A A IMPORTIN SUBUNIT ALPHA                                       830     0.0   
5x8n_A A Importin subunit alpha-1                                     830     0.0   
4yi0_A C Importin subunit alpha-1                                     830     0.0   
4u54_A A Importin subunit alpha-1                                     829     0.0   
5k9s_A A Importin subunit alpha-1                                     829     0.0   
2c1m_A A IMPORTIN-ALPHA2 SUBUNIT                                      828     0.0   
6p6e_A A Importin subunit alpha-1                                     828     0.0   
5d5k_A C Importin subunit alpha-1                                     828     0.0   
7jvo_A A Importin subunit alpha-1                                     827     0.0   
5huy_A C Importin subunit alpha-1                                     826     0.0   
5v5o_A C Importin subunit alpha-1                                     826     0.0   
1y2a_A C Importin alpha-2 Subunit                                     826     0.0   
5huw_A C Importin subunit alpha-1                                     826     0.0   
5v5p_A C Importin subunit alpha-1                                     826     0.0   
3q5u_A A Importin subunit alpha-2                                     826     0.0   
6k06_B C Importin subunit alpha-1                                     825     0.0   
6iu7_A A Importin subunit alpha-1                                     825     0.0   
3tpm_A A Importin subunit alpha-2                                     825     0.0   
6iua_A A Importin subunit alpha-1                                     825     0.0   
7jjm_B B Importin subunit alpha-1                                     825     0.0   
6d7n_A B Peroxidase,Importin subunit alpha-1                          821     0.0   
6d7m_A B Peroxidase,Importin subunit alpha-1                          818     0.0   
6iw8_B C Importin subunit alpha-1                                     816     0.0   
4zdu_A A Importin subunit alpha-1                                     808     0.0   
4uae_A A Importin subunit alpha-3                                     470     2e-162
6wx8_C C Importin subunit alpha-3                                     471     5e-162
5xzx_A A Importin subunit alpha-3                                     468     8e-162
6bwb_A A Importin subunit alpha-3                                     470     8e-162
6bvv_A A Importin subunit alpha-3                                     470     8e-162
6bwa_A A Importin subunit alpha-3                                     470     8e-162
6bw9_A A Importin subunit alpha-3                                     470     8e-162
6bvz_A A Importin subunit alpha-3                                     470     9e-162
6wx8_A A Importin subunit alpha-3                                     469     2e-161
5tbk_H H Importin subunit alpha-3                                     470     6e-161
5tbk_G G Importin subunit alpha-3                                     470     6e-161
5tbk_A A Importin subunit alpha-3                                     470     6e-161
5tbk_C C Importin subunit alpha-3                                     470     6e-161
5tbk_B B Importin subunit alpha-3                                     470     8e-161
5tbk_D D Importin subunit alpha-3                                     470     8e-161
5tbk_E E Importin subunit alpha-3                                     470     8e-161
5tbk_F F Importin subunit alpha-3                                     470     8e-161
7jjl_A A Importin subunit alpha-3                                     464     2e-159
4uad_A A Importin subunit alpha-7                                     422     2e-142
1wa5_B B SRP1 isoform 1                                               412     4e-138
4bqk_A A IMPORTIN SUBUNIT ALPHA-1A                                    407     6e-137
4bpl_A A IMPORTIN SUBUNIT ALPHA-1A                                    406     8e-137
4bqk_B B IMPORTIN SUBUNIT ALPHA-1A                                    406     8e-137
4b8o_A A IMPORTIN SUBUNIT ALPHA-1A                                    406     3e-136
2yns_B B IMPORTIN SUBUNIT ALPHA-1A                                    406     3e-136
2yns_A A IMPORTIN SUBUNIT ALPHA-1A                                    406     3e-136
4b8j_A A IMPORTIN SUBUNIT ALPHA-1A                                    407     4e-136
4b8p_A A IMPORTIN SUBUNIT ALPHA-1A                                    406     4e-136
4b8p_B B IMPORTIN SUBUNIT ALPHA-1A                                    406     4e-136
2jdq_B B IMPORTIN ALPHA-1 SUBUNIT                                     403     8e-136
2jdq_A A IMPORTIN ALPHA-1 SUBUNIT                                     401     6e-135
3tj3_A A Importin subunit alpha-1                                     401     7e-135
3tj3_C B Importin subunit alpha-1                                     401     7e-135
5vqi_A B Importin subunit alpha                                       401     4e-134
4rxh_A B Importin subunit alpha                                       401     4e-134
6wx9_A A Importin subunit alpha-5                                     399     5e-134
4b18_A A IMPORTIN SUBUNIT ALPHA-1                                     399     6e-134
1un0_A A IMPORTIN ALPHA SUBUNIT                                       396     4e-133
1un0_B B IMPORTIN ALPHA SUBUNIT                                       396     6e-133
4xzr_B B Importin subunit alpha                                       394     1e-132
4pvz_A A Importin subunit alpha                                       394     1e-132
4pvz_B B Importin subunit alpha                                       394     1e-132
1bk5_B B KARYOPHERIN ALPHA                                            394     2e-132
1bk5_A A KARYOPHERIN ALPHA                                            394     2e-132
1bk6_D B KARYOPHERIN ALPHA                                            394     2e-132
1bk6_A A KARYOPHERIN ALPHA                                            394     2e-132
1ee4_D B KARYOPHERIN ALPHA                                            392     1e-131
1ee4_A A KARYOPHERIN ALPHA                                            392     1e-131
1ee5_A A KARYOPHERIN ALPHA                                            391     2e-131
5h2x_A A Importin subunit alpha                                       391     2e-131
5h2w_C C Importin subunit alpha                                       391     2e-131
5h2w_A A Importin subunit alpha                                       391     3e-131
2c1t_B B IMPORTIN ALPHA SUBUNIT                                       391     5e-131
2c1t_A A IMPORTIN ALPHA SUBUNIT                                       391     5e-131
5t94_B B Importin subunit alpha                                       394     6e-131
4tnm_A A Importin subunit alpha                                       385     1e-127
5mfm_A A YIIIM6AII_GS11_(KR)5                                         207     5e-61 
5mfl_B B (KR)5_GS10_YIIIM6AII                                         207     5e-61 
5mfl_A A (KR)5_GS10_YIIIM6AII                                         207     5e-61 
5mfm_D D YIIIM6AII_GS11_(KR)5                                         207     5e-61 
5mfm_E E YIIIM6AII_GS11_(KR)5                                         207     5e-61 
5mfm_B B YIIIM6AII_GS11_(KR)5                                         207     5e-61 
5mfm_C C Importin subunit alpha                                       207     6e-61 
5mfm_F F YIIIM6AII_GS11_(KR)5                                         207     6e-61 
5mfl_C C (KR)5_GS10_YIIIM6AII                                         207     6e-61 
5mfd_K K YIIIM''6AII                                                  201     3e-59 
5mfd_A A YIIIM''6AII                                                  201     3e-59 
5mfd_E E YIIIM''6AII                                                  201     3e-59 
5mfd_G G YIIIM''6AII                                                  201     3e-59 
5mfd_C C YIIIM''6AII                                                  201     3e-59 
5mfd_I I YIIIM''6AII                                                  201     3e-59 
5mfd_L L YIIIM''6AII                                                  201     3e-59 
6sa7_B B DARPin-Armadillo fusion C8long83                             207     3e-59 
6sa7_A A DARPin-Armadillo fusion C8long83                             207     3e-59 
5mfd_J J YIIIM''6AII                                                  201     3e-59 
6sa8_A A ring-like DARPin-Armadillo fusion H83_D01                    202     3e-56 
6s9p_B B internal Lock2 fused to target peptide KRKAKITWKR            192     1e-55 
6s9p_A A internal Lock2 fused to target peptide KRKAKITWKR            192     2e-55 
6s9o_A A designed Armadillo repeat protein with internal Lock1 fu...  190     1e-54 
6s9o_F F designed Armadillo repeat protein with internal Lock1 fu...  190     1e-54 
6s9o_C C designed Armadillo repeat protein with internal Lock1 fu...  189     3e-54 
6s9o_E E designed Armadillo repeat protein with internal Lock1 fu...  189     4e-54 
6s9o_B B designed Armadillo repeat protein with internal Lock1 fu...  189     4e-54 
6s9o_D D designed Armadillo repeat protein with internal Lock1 fu...  187     1e-53 
5mfh_C C YIIIM5AII                                                    177     1e-50 
5mfe_A A YIIIM5AII                                                    177     1e-50 
5aei_C C DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                  177     2e-50 
5mfe_D D YIIIM5AII                                                    177     2e-50 
5aei_B B DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                  177     2e-50 
5mfh_A A YIIIM5AII                                                    177     2e-50 
5mfg_A A YIIIM5AII                                                    177     2e-50 
5mfh_D D YIIIM5AII                                                    177     2e-50 
5mfe_B B YIIIM5AII                                                    177     2e-50 
5mfh_B B YIIIM5AII                                                    177     2e-50 
5mfe_C C YIIIM5AII                                                    177     2e-50 
5aei_A A DESIGNED ARMADILLO REPEAT PROTEIN YIIIM5AII                  177     2e-50 
5mfc_A A YIIIM5AII                                                    177     3e-50 
5mff_B B YIIIM5AII                                                    176     3e-50 
5mfn_A A YIIIM5AII                                                    176     3e-50 
5mff_A A YIIIM5AII                                                    176     3e-50 
4u2x_F F Importin subunit alpha-6                                     172     3e-50 
5mfc_C C YIIIM5AII                                                    176     3e-50 
5mfn_B B YIIIM5AII                                                    176     4e-50 
5mff_C C YIIIM5AII                                                    176     5e-50 
5mff_D D YIIIM5AII                                                    176     5e-50 
6s9l_B B KR4KLSF Lock1                                                175     1e-49 
5mfg_C C YIIIM5AII                                                    175     1e-49 
6s9l_A A KR4KLSF Lock1                                                175     1e-49 
4v3o_C C YIII_M5_AII                                                  174     2e-49 
4v3o_A A YIII_M5_AII                                                  174     2e-49 
4v3o_B B YIII_M5_AII                                                  174     2e-49 
4v3o_D D YIII_M5_AII                                                  174     2e-49 
5mfg_B B YIIIM5AII                                                    174     3e-49 
4rv1_F F Engineered Protein OR497                                     177     7e-49 
4rv1_C C Engineered Protein OR497                                     176     9e-49 
4rv1_E E Engineered Protein OR497                                     176     9e-49 
4u2x_E E Importin subunit alpha-6                                     169     1e-48 
4v3r_B B YIII_M5_AII                                                  172     1e-48 
4v3r_A A YIII_M5_AII                                                  172     1e-48 
4rv1_A A Engineered Protein OR497                                     176     1e-48 
4rv1_D D Engineered Protein OR497                                     176     1e-48 
4rv1_B B Engineered Protein OR497                                     176     1e-48 
4u2x_D D Importin subunit alpha-6                                     167     3e-48 
6s9n_D D Lock2_KRKRKAKLSF                                             168     5e-47 
6s9n_F F Lock2_KRKRKAKLSF                                             168     5e-47 
6s9n_B B Lock2_KRKRKAKLSF                                             168     5e-47 
6s9n_C C Lock2_KRKRKAKLSF                                             168     5e-47 
6s9n_A A Lock2_KRKRKAKLSF                                             168     6e-47 
6s9n_E E Lock2_KRKRKAKLSF                                             168     6e-47 
6s9m_C C Lock2_KRKRKAKITW                                             168     6e-47 
6s9m_A A Lock2_KRKRKAKITW                                             168     6e-47 
6s9m_E E Lock2_KRKRKAKITW                                             168     6e-47 
6s9m_D D Lock2_KRKRKAKITW                                             168     8e-47 
6s9m_F F Lock2_KRKRKAKITW                                             168     8e-47 
6s9m_B B Lock2_KRKRKAKITW                                             168     8e-47 
4db8_A A Armadillo-repeat Protein                                     158     1e-43 
4db8_C C Armadillo-repeat Protein                                     158     1e-43 
4db8_B B Armadillo-repeat Protein                                     158     1e-43 
4db8_D D Armadillo-repeat Protein                                     158     1e-43 
4pls_B B Arm00010                                                     159     1e-43 
4pls_C C Arm00010                                                     158     2e-43 
4pls_A A Arm00010                                                     158     2e-43 
4pls_D D Arm00010                                                     158     2e-43 
4plq_A A Arm00011                                                     158     2e-43 
4plr_A A Arm00008                                                     158     2e-43 
4plr_B B Arm00008                                                     158     2e-43 
4v3q_B B YIII_M4_AII                                                  156     4e-43 
4v3q_A A YIII_M4_AII                                                  156     4e-43 
4v3q_C C YIII_M4_AII                                                  155     9e-43 
4v3q_D D YIII_M4_AII                                                  155     1e-42 
5mfg_D D YIIIM5AII                                                    151     9e-41 
6sa6_A A DARPin-Armadillo fusion A5                                   154     1e-40 
5mfk_B B YIII(Dq.V1)4CPAF                                             143     3e-38 
4d49_F F ARMADILLO REPEAT PROTEIN ARM00027                            142     5e-38 
4d49_E E ARMADILLO REPEAT PROTEIN ARM00027                            142     5e-38 
4d49_A A ARMADILLO REPEAT PROTEIN ARM00027                            142     5e-38 
4d49_B B ARMADILLO REPEAT PROTEIN ARM00027                            142     5e-38 
5mfk_A A YIII(Dq.V1)4CPAF                                             142     9e-38 
4db6_A A Armadillo repeat protein                                     136     4e-36 
5mfj_B B YIII(Dq.V2)4CqI                                              132     3e-34 
5mfi_B B YIII(Dq.V2)4CqI                                              132     3e-34 
5mfj_A A YIII(Dq.V2)4CqI                                              132     3e-34 
5mfi_A A YIII(Dq.V2)4CqI                                              132     3e-34 
4rzp_B B Engineered Protein OR366                                     130     3e-33 
4rzp_A A Engineered Protein OR366                                     130     3e-33 
4dba_B B Designed Armadillo repeat protein, YIIM3AII                  128     3e-33 
4dba_D D Designed Armadillo repeat protein, YIIM3AII                  128     3e-33 
4dba_C C Designed Armadillo repeat protein, YIIM3AII                  128     3e-33 
4dba_A A Designed Armadillo repeat protein, YIIM3AII                  128     3e-33 
4hxt_A A De Novo Protein OR329                                        129     7e-33 
5mfo_C C YIIIM3AIII                                                   126     1e-32 
5mfo_A A YIIIM3AIII                                                   126     1e-32 
5mfo_B B YIIIM3AIII                                                   126     1e-32 
5mfo_F F YIIIM3AIII                                                   126     1e-32 
5mfo_E E YIIIM3AIII                                                   126     2e-32 
5mfo_D D YIIIM3AIII                                                   126     2e-32 
4db9_F F Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
4db9_C C Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
4db9_B B Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
4db9_D D Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
4db9_E E Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
4db9_A A Armadillo repeat protein, YIIIM3AIII                         126     2e-32 
1qgk_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)                           93.6    1e-22 
2ru4_A A Armadillo Repeat Protein, N-terminal fragment, YIIM2         89.0    4e-20 
4d4e_A A ARMADILLO REPEAT PROTEIN ARM00016                            73.2    2e-13 
4d4e_B B ARMADILLO REPEAT PROTEIN ARM00016                            73.2    2e-13 
2ru5_A B Armadillo repeat protein C-terminal fragment                 59.3    5e-10 
2ru4_B B Armadillo Repeat Protein, C-terminal fragment, MAII          59.3    5e-10 
5mfb_B B YIII(Dq)4CqI                                                 62.4    1e-09 
5mfb_A A YIII(Dq)4CqI                                                 62.0    1e-09 
1qgr_B B PROTEIN (IMPORTIN ALPHA-2 SUBUNIT)                           53.1    2e-08 
6kbm_A A Vacuolar protein 8                                           57.4    1e-07 
6kbn_A A Vacuolar protein 8                                           57.4    2e-07 
5xjg_A A Vacuolar protein 8                                           57.4    2e-07 
5xjg_C C Vacuolar protein 8                                           57.4    2e-07 
6kbn_C C Vacuolar protein 8                                           57.0    2e-07 
1qz7_A A Beta-catenin                                                 50.1    3e-05 
1v18_A A BETA-CATENIN                                                 48.5    9e-05 
1th1_A A Beta-catenin                                                 48.5    1e-04 
1i7x_A A BETA-CATENIN                                                 48.5    1e-04 
1th1_B B Beta-catenin                                                 48.1    1e-04 
1m1e_A A Beta-catenin                                                 48.1    1e-04 
1g3j_A A BETA-CATENIN ARMADILLO REPEAT REGION                         48.1    1e-04 
1t08_A A Beta-catenin                                                 48.1    1e-04 
1g3j_C C BETA-CATENIN ARMADILLO REPEAT REGION                         47.8    1e-04 
2gl7_A A Beta-catenin                                                 47.4    2e-04 
1i7x_C C BETA-CATENIN                                                 47.4    2e-04 
7ar4_A AAA Catenin beta-1                                             47.4    2e-04 
2z6h_A A Catenin beta-1                                               47.4    2e-04 
3oux_A A Catenin beta-1                                               47.4    2e-04 
3ouw_A A Catenin beta-1                                               47.4    2e-04 
2z6g_A A B-catenin                                                    47.4    2e-04 
1i7w_C C BETA-CATENIN                                                 47.0    2e-04 
2bct_A A BETA-CATENIN                                                 47.0    3e-04 
4evt_A A Catenin beta-1                                               47.0    3e-04 
1jpw_C B BETA-CATENIN                                                 47.0    3e-04 
1jpw_E C BETA-CATENIN                                                 47.0    3e-04 
1jpw_A A BETA-CATENIN                                                 47.0    3e-04 
4eva_A A Catenin beta-1                                               47.0    3e-04 
4evp_A A Catenin beta-1                                               47.0    3e-04 
2gl7_D D Beta-catenin                                                 47.0    3e-04 
4djs_A A Catenin beta-1                                               47.0    3e-04 
1luj_A A Catenin beta-1                                               47.0    3e-04 
4eva_B C Catenin beta-1                                               47.0    3e-04 
4ev9_A A Catenin beta-1                                               46.6    3e-04 
4ev8_A A Catenin beta-1                                               46.6    3e-04 
1i7w_A A BETA-CATENIN                                                 46.6    4e-04 
3bct_A A BETA-CATENIN                                                 46.6    4e-04 
3tx7_A A Catenin beta-1                                               45.8    6e-04 
7nsc_B E Isoform 2 of Armadillo repeat-containing protein 8           45.8    6e-04 
1jdh_A A BETA-CATENIN                                                 45.4    8e-04 
5xgc_A A Rap1 GTPase-GDP dissociation stimulator 1                    43.9    0.002 
1jpp_B B BETA-CATENIN                                                 43.5    0.003 
1jpp_A A BETA-CATENIN                                                 43.5    0.004 
5zhx_D D Rap1 GTPase-GDP dissociation stimulator 1                    42.7    0.006 
5zhx_B B Rap1 GTPase-GDP dissociation stimulator 1                    42.7    0.006 
5zhx_C C Rap1 GTPase-GDP dissociation stimulator 1                    42.7    0.006 
5zhx_A A Rap1 GTPase-GDP dissociation stimulator 1                    42.7    0.006 
3ifq_A A plakoglobin                                                  38.1    0.17  
3ifq_B B plakoglobin                                                  37.7    0.19  
6ke6_GB RI Ribosome biogenesis protein UTP30                          35.4    0.74  
5wlc_GB SN Utp30                                                      35.4    0.74  
6lqu_FB RI Ribosome biogenesis protein UTP30                          35.4    0.74  
6lqp_GB RI Ribosome biogenesis protein UTP30                          35.4    0.74  
7ajt_CA UZ Ribosome biogenesis protein UTP30                          35.4    0.74  
6zqa_W UZ Ribosome biogenesis protein UTP30                           35.4    0.74  
6zqc_CA UZ Ribosome biogenesis protein UTP30                          35.4    0.74  
6zqb_X UZ Ribosome biogenesis protein UTP30                           35.4    0.74  
5wyj_IB U5 Ribosome biogenesis protein UTP30                          35.4    0.79  
5wyk_CB U5 Ribosome biogenesis protein UTP30                          35.4    0.79  
5ydt_A U5 Ribosome biogenesis protein UTP30                           35.4    0.80  
5ydu_B B Ribosome biogenesis protein UTP30                            35.4    0.80  
5ydu_A A Ribosome biogenesis protein UTP30                            35.0    1.0   
3l6y_A A Catenin delta-1                                              34.7    2.1   
3l6y_E E Catenin delta-1                                              34.3    2.3   
3l6y_C C Catenin delta-1                                              34.3    2.4   
3l6x_A A Catenin delta-1                                              34.3    2.5   
5mfm_H Q YIIIM6AII_GS11_(KR)5                                         33.9    2.8   
5mfm_G P YIIIM6AII_GS11_(KR)5                                         33.9    2.8   

>5h43_A A Importin subunit alpha-1
>4e4v_A A Importin subunit alpha-2
>4e4v_B B Importin subunit alpha-2
>3fey_C C Importin subunit alpha-2
>4wv6_A A Importin subunit alpha-1
>3wpt_B B Importin subunit alpha-1
>3wpt_A A Importin subunit alpha-1
>3fex_C C Importin subunit alpha-2
>3tpo_A A Importin subunit alpha-2
>5b56_B B Importin subunit alpha-1
>5b56_A A Importin subunit alpha-1
>1q1s_C C Importin alpha-2 subunit
>5gxw_A A Importin subunit alpha-1
>3knd_A A Importin subunit alpha-2
>3btr_A C Importin subunit alpha-2
>1q1t_C C Importin alpha-2 subunit
>3l3q_A A Importin subunit alpha-2
>3ukz_A B Importin subunit alpha-2
>5hhg_B E Importin subunit alpha-1
>4htv_A A Importin subunit alpha-2
>3uky_A B Importin subunit alpha-2
>1pjm_B B Importin alpha-2 subunit
>5fc8_B E Importin subunit alpha-1
>4mz5_C E Importin subunit alpha-1
>6iwa_B C Importin subunit alpha-1
>3rzx_A A Importin subunit alpha-2
>3ve6_A A Importin subunit alpha-2
>3ul0_A B Importin subunit alpha-2
>4oih_A A Importin subunit alpha-1
>4u5v_A A Importin subunit alpha-1
>4u5o_A A Importin subunit alpha-1
>5u5r_A A Importin subunit alpha-1
>5klt_A B Importin subunit alpha-1
>6bvt_A E Importin subunit alpha-1
>5umz_A B Importin subunit alpha-1
>5svz_A A Importin subunit alpha-1
>4u5s_A A Importin subunit alpha-1
>6mjl_A B Importin subunit alpha-1
>5w41_A A Importin subunit alpha-1
>1pjn_B B Importin alpha-2 subunit
>4mz6_C E Importin subunit alpha-1
>4u5n_A A Importin subunit alpha-1
>5ctt_A A Importin subunit alpha-1
>6bw0_B E Importin subunit alpha-1
>4u5l_A A Importin subunit alpha-1
>6p6a_A B Importin subunit alpha-1
>7l04_B E Importin subunit alpha-1
>6wx7_A A Importin subunit alpha-1
>5wun_A A Importin subunit alpha-1
>3ukw_A B Importin subunit alpha-2
>4u5u_A A Importin subunit alpha-1
>4u58_A A Importin subunit alpha-1
>3ul1_A B Importin subunit alpha-2
>5wum_A A Importin subunit alpha-1
>5u5p_C A Importin subunit alpha-1
>6bw1_B E Importin subunit alpha-1
>5klr_A B Importin subunit alpha-1
>3ukx_A B Importin subunit alpha-2
>5ekf_C A Importin subunit alpha-1
>5w4e_A B Importin subunit alpha-1,Importin subunit alpha-1
>5w4g_A B Importin subunit alpha-1
>3oqs_B A Importin subunit alpha-2
>5e6q_A B Importin subunit alpha-1
>4uaf_A B Importin subunit alpha-1
>3uvu_B A Importin subunit alpha-2
>3rz9_A A Importin subunit alpha-2
>5ekg_C A Importin subunit alpha-1
>7jk7_B B Importin subunit alpha-1
>5w4f_A B Importin subunit alpha-1
>5x8n_A A Importin subunit alpha-1
>4yi0_A C Importin subunit alpha-1
>4u54_A A Importin subunit alpha-1
>5k9s_A A Importin subunit alpha-1
>6p6e_A A Importin subunit alpha-1
>5d5k_A C Importin subunit alpha-1
>7jvo_A A Importin subunit alpha-1
>5huy_A C Importin subunit alpha-1
>5v5o_A C Importin subunit alpha-1
>1y2a_A C Importin alpha-2 Subunit
>5huw_A C Importin subunit alpha-1
>5v5p_A C Importin subunit alpha-1
>3q5u_A A Importin subunit alpha-2
>6k06_B C Importin subunit alpha-1
>6iu7_A A Importin subunit alpha-1
>3tpm_A A Importin subunit alpha-2
>6iua_A A Importin subunit alpha-1
>7jjm_B B Importin subunit alpha-1
>6d7n_A B Peroxidase,Importin subunit alpha-1
>6d7m_A B Peroxidase,Importin subunit alpha-1
>6iw8_B C Importin subunit alpha-1
>4zdu_A A Importin subunit alpha-1
>4uae_A A Importin subunit alpha-3
>6wx8_C C Importin subunit alpha-3
>5xzx_A A Importin subunit alpha-3
>6bwb_A A Importin subunit alpha-3
>6bvv_A A Importin subunit alpha-3
>6bwa_A A Importin subunit alpha-3
>6bw9_A A Importin subunit alpha-3
>6bvz_A A Importin subunit alpha-3
>6wx8_A A Importin subunit alpha-3
>5tbk_H H Importin subunit alpha-3
>5tbk_G G Importin subunit alpha-3
>5tbk_A A Importin subunit alpha-3
>5tbk_C C Importin subunit alpha-3
>5tbk_B B Importin subunit alpha-3
>5tbk_D D Importin subunit alpha-3
>5tbk_E E Importin subunit alpha-3
>5tbk_F F Importin subunit alpha-3
>7jjl_A A Importin subunit alpha-3
>4uad_A A Importin subunit alpha-7
>1wa5_B B SRP1 isoform 1
>3tj3_A A Importin subunit alpha-1
>3tj3_C B Importin subunit alpha-1
>5vqi_A B Importin subunit alpha
>4rxh_A B Importin subunit alpha
>6wx9_A A Importin subunit alpha-5
>4xzr_B B Importin subunit alpha
>4pvz_A A Importin subunit alpha
>4pvz_B B Importin subunit alpha
>5h2x_A A Importin subunit alpha
>5h2w_C C Importin subunit alpha
>5h2w_A A Importin subunit alpha
>5t94_B B Importin subunit alpha
>4tnm_A A Importin subunit alpha
>5mfm_A A YIIIM6AII_GS11_(KR)5
>5mfl_B B (KR)5_GS10_YIIIM6AII
>5mfl_A A (KR)5_GS10_YIIIM6AII
>5mfm_D D YIIIM6AII_GS11_(KR)5
>5mfm_E E YIIIM6AII_GS11_(KR)5
>5mfm_B B YIIIM6AII_GS11_(KR)5
>5mfm_C C Importin subunit alpha
>5mfm_F F YIIIM6AII_GS11_(KR)5
>5mfl_C C (KR)5_GS10_YIIIM6AII
>5mfd_K K YIIIM''6AII
>5mfd_A A YIIIM''6AII
>5mfd_E E YIIIM''6AII
>5mfd_G G YIIIM''6AII
>5mfd_C C YIIIM''6AII
>5mfd_I I YIIIM''6AII
>5mfd_L L YIIIM''6AII
>6sa7_B B DARPin-Armadillo fusion C8long83
>6sa7_A A DARPin-Armadillo fusion C8long83
>5mfd_J J YIIIM''6AII
>6sa8_A A ring-like DARPin-Armadillo fusion H83_D01
>6s9p_B B internal Lock2 fused to target peptide KRKAKITWKR
>6s9p_A A internal Lock2 fused to target peptide KRKAKITWKR
>6s9o_A A designed Armadillo repeat protein with internal Lock1
>6s9o_F F designed Armadillo repeat protein with internal Lock1
>6s9o_C C designed Armadillo repeat protein with internal Lock1
>6s9o_E E designed Armadillo repeat protein with internal Lock1
>6s9o_B B designed Armadillo repeat protein with internal Lock1
>6s9o_D D designed Armadillo repeat protein with internal Lock1
>4u2x_F F Importin subunit alpha-6
>6s9l_B B KR4KLSF Lock1
>6s9l_A A KR4KLSF Lock1
>4v3o_C C YIII_M5_AII
>4v3o_A A YIII_M5_AII
>4v3o_B B YIII_M5_AII
>4v3o_D D YIII_M5_AII
>4rv1_F F Engineered Protein OR497
>4rv1_C C Engineered Protein OR497
>4rv1_E E Engineered Protein OR497
>4u2x_E E Importin subunit alpha-6
>4v3r_B B YIII_M5_AII
>4v3r_A A YIII_M5_AII
>4rv1_A A Engineered Protein OR497
>4rv1_D D Engineered Protein OR497
>4rv1_B B Engineered Protein OR497
>4u2x_D D Importin subunit alpha-6
>6s9n_D D Lock2_KRKRKAKLSF
>6s9n_F F Lock2_KRKRKAKLSF
>6s9n_B B Lock2_KRKRKAKLSF
>6s9n_C C Lock2_KRKRKAKLSF
>6s9n_A A Lock2_KRKRKAKLSF
>6s9n_E E Lock2_KRKRKAKLSF
>6s9m_C C Lock2_KRKRKAKITW
>6s9m_A A Lock2_KRKRKAKITW
>6s9m_E E Lock2_KRKRKAKITW
>6s9m_D D Lock2_KRKRKAKITW
>6s9m_F F Lock2_KRKRKAKITW
>6s9m_B B Lock2_KRKRKAKITW
>4db8_A A Armadillo-repeat Protein
>4db8_C C Armadillo-repeat Protein
>4db8_B B Armadillo-repeat Protein
>4db8_D D Armadillo-repeat Protein
>4pls_B B Arm00010
>4pls_C C Arm00010
>4pls_A A Arm00010
>4pls_D D Arm00010
>4plq_A A Arm00011
>4plr_A A Arm00008
>4plr_B B Arm00008
>4v3q_B B YIII_M4_AII
>4v3q_A A YIII_M4_AII
>4v3q_C C YIII_M4_AII
>4v3q_D D YIII_M4_AII
>6sa6_A A DARPin-Armadillo fusion A5
>5mfk_B B YIII(Dq.V1)4CPAF
>5mfk_A A YIII(Dq.V1)4CPAF
>4db6_A A Armadillo repeat protein
>5mfj_B B YIII(Dq.V2)4CqI
>5mfi_B B YIII(Dq.V2)4CqI
>5mfj_A A YIII(Dq.V2)4CqI
>5mfi_A A YIII(Dq.V2)4CqI
>4rzp_B B Engineered Protein OR366
>4rzp_A A Engineered Protein OR366
>4dba_B B Designed Armadillo repeat protein, YIIM3AII
>4dba_D D Designed Armadillo repeat protein, YIIM3AII
>4dba_C C Designed Armadillo repeat protein, YIIM3AII
>4dba_A A Designed Armadillo repeat protein, YIIM3AII
>4hxt_A A De Novo Protein OR329
>4db9_F F Armadillo repeat protein, YIIIM3AIII
>4db9_C C Armadillo repeat protein, YIIIM3AIII
>4db9_B B Armadillo repeat protein, YIIIM3AIII
>4db9_D D Armadillo repeat protein, YIIIM3AIII
>4db9_E E Armadillo repeat protein, YIIIM3AIII
>4db9_A A Armadillo repeat protein, YIIIM3AIII
Length=44 Score = 93.6 bits (231), Expect = 1e-22, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%) Query 11 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS 54 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS Sbjct 1 AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS 44
>2ru4_A A Armadillo Repeat Protein, N-terminal fragment, YIIM2
>2ru5_A B Armadillo repeat protein C-terminal fragment
Length=84 Score = 59.3 bits (142), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%) Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 58.9 bits (141), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%) Query 152 SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPL 209 +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ + V + GA++ L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKL 59 Score = 58.5 bits (140), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%) Query 283 NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS 342 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 343 LLTNPKTNIQKEATWTMSNITA 364 L ++ IQKEA + + + Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 48.1 bits (113), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 5 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 63 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 64 SHENEKIQKEAQEAL 78 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%) Query 368 DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN 427 +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQ 61 Query 428 LLTAKDTKI 436 L + ++ KI Sbjct 62 LQSHENEKI 70 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 6/87 (7%) Query 411 EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAL 56 Query 471 DKIEALQNHENESVYKASLSLIEKYFS 497 +K+E LQ+HENE + K + +EK S Sbjct 57 EKLEQLQSHENEKIQKEAQEALEKLQS 83 Score = 38.5 bits (88), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/49 (35%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LP LV+LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 14 LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 62
>2ru4_B B Armadillo Repeat Protein, C-terminal fragment, MAII
Length=84 Score = 59.3 bits (142), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 0/82 (0%) Query 325 DEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS 384 +EQ Q VIDAGAL LL++P I +EA W +SNI +G +Q Q V G + L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 385 VLSKADFKTQKEAVWAVTNYTS 406 + S + K QKEA A+ S Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 58.9 bits (141), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%) Query 152 SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPL 209 +EQ +AV+D GA+PA + LL+SP+ I ++A+WAL NIA G+ + V + GA++ L Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKL 59 Score = 58.5 bits (140), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 0/82 (0%) Query 283 NERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPS 342 NE+I V+ G +P LV+LL + I+ AL A+ NI +G +EQ Q V +AGAL Sbjct 2 NEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQ 61 Query 343 LLTNPKTNIQKEATWTMSNITA 364 L ++ IQKEA + + + Sbjct 62 LQSHENEKIQKEAQEALEKLQS 83 Score = 48.1 bits (113), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query 112 IDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL 171 I +I AG +P V L + +Q E+ WAL+NIASG +EQ +AV + GA+ L Sbjct 5 IQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQKQAVKEAGALEKLEQLQ 63 Query 172 ASPHAHISEQAVWAL 186 + + I ++A AL Sbjct 64 SHENEKIQKEAQEAL 78 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 1/69 (1%) Query 368 DQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMN 427 +QIQ V++ G +P LV +LS + + +EA+WA++N SGG EQ + G +E L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQ 61 Query 428 LLTAKDTKI 436 L + ++ KI Sbjct 62 LQSHENEKI 70 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 6/87 (7%) Query 411 EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL 470 EQI ++ G + L+ LL++ + +I+ L A+SNI G +K ++ +E G L Sbjct 3 EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQAV--KEAGAL 56 Query 471 DKIEALQNHENESVYKASLSLIEKYFS 497 +K+E LQ+HENE + K + +EK S Sbjct 57 EKLEQLQSHENEKIQKEAQEALEKLQS 83 Score = 38.5 bits (88), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/49 (35%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 253 LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKL 301 LP LV+LL + ++L + WA+S + G NE+ V + G + +L +L Sbjct 14 LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQL 62
>5mfb_B B YIII(Dq)4CqI
>5mfb_A A YIII(Dq)4CqI
Length=27 Score = 53.1 bits (126), Expect = 2e-08, Method: Composition-based stats. Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 0/24 (0%) Query 28 RRRRIEVNVELRKAKKDDQMLKRR 51 RRRRIEVNVELRKAKKDDQMLKRR Sbjct 1 RRRRIEVNVELRKAKKDDQMLKRR 24
>6kbm_A A Vacuolar protein 8
>6kbn_A A Vacuolar protein 8
>5xjg_A A Vacuolar protein 8
>5xjg_C C Vacuolar protein 8
>6kbn_C C Vacuolar protein 8
>1qz7_A A Beta-catenin
>1th1_A A Beta-catenin
>1th1_B B Beta-catenin
>1m1e_A A Beta-catenin
>1t08_A A Beta-catenin
>2gl7_A A Beta-catenin
>7ar4_A AAA Catenin beta-1
>2z6h_A A Catenin beta-1
>3oux_A A Catenin beta-1
>3ouw_A A Catenin beta-1
>2z6g_A A B-catenin
>4evt_A A Catenin beta-1
>4eva_A A Catenin beta-1
>4evp_A A Catenin beta-1
>2gl7_D D Beta-catenin
>4djs_A A Catenin beta-1
>1luj_A A Catenin beta-1
>4eva_B C Catenin beta-1
>4ev9_A A Catenin beta-1
>4ev8_A A Catenin beta-1
>3tx7_A A Catenin beta-1
>7nsc_B E Isoform 2 of Armadillo repeat-containing protein 8
>5xgc_A A Rap1 GTPase-GDP dissociation stimulator 1
>5zhx_D D Rap1 GTPase-GDP dissociation stimulator 1
>5zhx_B B Rap1 GTPase-GDP dissociation stimulator 1
>5zhx_C C Rap1 GTPase-GDP dissociation stimulator 1
>5zhx_A A Rap1 GTPase-GDP dissociation stimulator 1
>3ifq_A A plakoglobin
>3ifq_B B plakoglobin
>6ke6_GB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5wlc_GB SN Utp30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>6lqu_FB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>6lqp_GB RI Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>7ajt_CA UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>6zqa_W UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>6zqc_CA UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>6zqb_X UZ Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.74, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5wyj_IB U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.79, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5wyk_CB U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.79, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5ydt_A U5 Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5ydu_B B Ribosome biogenesis protein UTP30
Length=274 Score = 35.4 bits (80), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>5ydu_A A Ribosome biogenesis protein UTP30
Length=274 Score = 35.0 bits (79), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (3%) Query 233 LSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKT 292 L ++C+N + P D + ++ H PE+L + I++LTD G V+K Sbjct 180 LRSICKNTSYIPNNDNCLSVRVGYIQ--KHSIPEILQNIQDTINFLTDKSKRPQGGVIKG 237 Query 293 GVVPQLVKLLGASELPI 309 G++ VK ++ LPI Sbjct 238 GIISIFVKTSNSTSLPI 254
>3l6y_A A Catenin delta-1
>3l6y_E E Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.3, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
>3l6y_C C Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.4, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
>3l6x_A A Catenin delta-1
Length=584 Score = 34.3 bits (77), Expect = 2.5, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 44/96 (46%), Gaps = 1/96 (1%) Query 295 VPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKE 354 +P+++ +LG + + A + ++ D+ V + V LL +PK + Sbjct 50 LPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLG 109 Query 355 ATWTMSNITAGR-QDQIQQVVNHGLVPFLVSVLSKA 389 A + NI+ GR QD + N VP LV +L KA Sbjct 110 ACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKA 145
>5mfm_H Q YIIIM6AII_GS11_(KR)5
Length=348 Score = 33.9 bits (76), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%) Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEK 494 ++E G L+K+E LQ+HENE + K + +EK Sbjct 294 VKEAGALEKLEQLQSHENEKIQKEAQEALEK 324
>5mfm_G P YIIIM6AII_GS11_(KR)5
Length=348 Score = 33.9 bits (76), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 0/31 (0%) Query 464 IEECGGLDKIEALQNHENESVYKASLSLIEK 494 ++E G L+K+E LQ+HENE + K + +EK Sbjct 294 VKEAGALEKLEQLQSHENEKIQKEAQEALEK 324 Lambda K H a alpha 0.315 0.132 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 37489136729 Database: unitmol_20210609.fasta Posted date: Jun 9, 2021 5:21 PM Number of letters in database: 163,607,441 Number of sequences in database: 599,558 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40