Contact Molecules for Homologous Proteins
[Summary Bars]	[Full Bars]	Site Table[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[Sites by Variants]	[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
30979	222	12	P0DTC5(VME1_SARS2)	RecName: Full=Membrane protein ; Short=M;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ;
QUERYSEQ	MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ

  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.

n	a	s	e	acc	pdb	contact_mols	observed aa	feature table	variant
1	M	-	-	-	-		M	DISORDER predicted by DISOPRED
2	A	-	-	-	-		AS	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
3	D	-	-	-	-		SDNE	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
4	S	-	-	-	-		SCTDAGL	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
5	N	-	-	-	-		NTE	CARBOHYD /note="N-linked (GlcNAc...) asparagine; by host" TOPO_DOM /note="Virion surface" CARBOHYD /note="N-linked (GlcNAc...) asparagine; by host" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
6	G	-	-	-	-		GCSNVMQ	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
7	T	-	-	-	-		TSC	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
8	I	-	-	-	-		LVIFAEGKST	TOPO_DOM /note="Virion surface" DISORDER predicted by DISOPRED TOPO_DOM /note="Virion surface"
9	T		e	89.0	7vgr_E	homo	TPGNDSAL	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
10	V		e	70.7	7vgr_E	homo	VARFLTNEKSG	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
11	E	H	e	67.8	7vgr_E		DEGPLA	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
12	E	H	e	33.2	7vgr_E		EQDV	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
13	L	H	e	47.8	7vgr_E	homo	VALIS	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
14	K	H	e	58.0	7vgr_E	homo	IVKLY	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
15	K	H	e	52.8	7vgr_E	homo	KTAREQWVN	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
16	L	H	e	40.4	7vgr_E		LHFIA	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
17	L	H	e	59.6	7vgr_E	homo	LFIV	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
18	E	H	e	56.3	7vgr_E	homo	KARE	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
19	Q	H	e	51.5	7vgr_E	homo	NEDQ	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
20	W	H	e	61.8	7vgr_E	homo	WY	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
21	N	H	e	67.3	7vgr_E	homo	N	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
22	L	H	e	61.8	7vgr_E	homo	FL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
23	V	H	e	44.7	7vgr_E		SFATVGL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
24	I	H	e	47.4	7vgr_E	homo	WLIV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
25	G	H	e	41.7	7vgr_E	homo	SGNT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
26	F	H	e	57.9	7vgr_E	homo	VIAFL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
27	L	H	e	58.4	7vgr_E	homo	IFLV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
28	F	H	e	50.7	7vgr_E	homo	LFV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
29	L	H	e	54.5	7vgr_E	homo	LTI	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
30	T	H	e	36.4	7vgr_E	homo	FILVAT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
31	W	H	e	61.4	7vgr_E	homo	IFLWV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
32	I	H	e	55.0	7vgr_E	homo	TIL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
33	C	H	e	32.0	7vgr_E	homo	IVTCM	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
34	L	H	b	18.0	7vgr_E	homo	VIL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
35	L	H	e	56.7	7vgr_E	homo	L	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
36	Q	H	e	52.6	7vgr_E	homo	Q	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
37	F	T	e	40.7	7vgr_E	homo	YFW	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
38	A		b	0.0	7vgr_E		GA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
39	Y		e	35.2	7vgr_E	homo	YHR	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
40	A	T	e	21.4	7vgr_E	homo	PYTAS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
41	N	T	e	89.1	7vgr_E	homo	SKQTN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
42	R	T	e	58.9	7vgr_E	homo	RYF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
43	N		e	38.2	7vgr_E		SNC	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
44	R	H	e	73.9	7vgr_E		MRKWV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
45	F	H	e	67.9	7vgr_E		FLVPMT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
46	L	H	e	22.5	7vgr_E		VLIF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
47	Y	H	b	8.3	7vgr_E		YW	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
48	I	H	e	37.4	7vgr_E		GVIL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
49	I	H	e	25.1	7vgr_E		ILVF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
50	K	H	b	15.1	7vgr_E	homo	K	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
51	L	H	b	11.2	7vgr_E		ML	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
52	I	H	e	50.9	7vgr_E		IFLAVS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
53	F	H	e	36.4	7vgr_E	homo	IVFL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
54	L	H	e	30.3	7vgr_E	homo	LM	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
55	W	H	e	45.4	7vgr_E		W	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
56	L	H	e	44.4	7vgr_E		LCI	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
57	L	H	e	43.3	7vgr_E	homo	LMF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
58	W	H	e	21.1	7vgr_E	homo	W	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
59	P	H	e	41.1	7vgr_E		P	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
60	V	H	e	55.3	7vgr_E	homo	LIAVS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
61	T	H	e	29.9	7vgr_E	homo	VTSN	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
62	L	H	e	28.7	7vgr_E		LIM	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
63	A	H	e	48.2	7vgr_E		AISVT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
64	C	H	e	48.0	7vgr_E	homo	LCVIA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
65	F	H	e	24.4	7vgr_E	homo	FTSGAC	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
66	V	H	e	48.7	7vgr_E	compound N8E	IVDA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
67	L	H	e	56.2	7vgr_E	homo	FILAT	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
68	A	H	e	49.1	7vgr_E	homo	NSAWCL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
69	A	H	b	17.9	7vgr_E		ACL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
70	V	H	e	63.3	7vgr_E	compound N8E	VIYNSF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
71	Y	S	e	72.2	7vgr_E	homo	YFHW	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
72	R		e	58.1	7vgr_E	homo	PAQNRDE	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
73	I	S	e	90.1	7vgr_E	homo	IVLPS	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
74	N	S	e	43.0	7vgr_E		NSD	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
75	W	T	e	89.2	7vgr_E	compound N8E	WNYLSQADEFGIKPRTV	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
76	I	T	e	63.7	7vgr_E		VAIDEFGKLNPQRST	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
77	T	H	e	36.4	7vgr_E	homo	FTMYSAI	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
78	G	H	b	3.6	7vgr_E	homo	FGLQVS	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
79	G	H	e	48.8	7vgr_E	compound N8E	GAI	TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface"
80	I	H	e	58.5	7vgr_E	homo	FILV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
81	A	H	b	10.7	7vgr_E	homo	SAL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
82	I	H	e	57.3	7vgr_E	compound N8E	IGVFA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
83	A	H	e	37.5	7vgr_E	compound N8E	AILVF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
84	M	H	e	37.7	7vgr_E	homo	MFLGTV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
85	A	H	b	8.9	7vgr_E	homo	ATS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
86	C	H	e	54.7	7vgr_E	compound N8E	ICVA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
87	L	H	e	44.9	7vgr_E	compound N8E	VIFSAL	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
88	V	H	e	26.0	7vgr_E	homo	TSAVC	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
89	G	H	b	17.9	7vgr_E		IGLFAC	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
90	L	H	e	60.7	7vgr_E		VLIMCA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
91	M	H	e	57.0	7vgr_E	homo	MLSI	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
92	W	H	e	27.9	7vgr_E		WF	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
93	L	H	e	48.3	7vgr_E	compound N8E	ILVM	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
94	S	H	e	53.9	7vgr_E		MSGLVA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
95	Y	H	b	18.3	7vgr_E	homo	Y	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
96	F	H	e	26.8	7vgr_E		FW	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
97	I	H	e	55.0	7vgr_E		VIA	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
98	A	H	e	28.6	7vgr_E	homo	NQRAS	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
99	S	H	b	3.1	7vgr_E		S	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
100	F	H	e	61.2	7vgr_E		IFV	TRANSMEM /note="Helical" TRANSMEM /note="Helical"
101	R	H	e	25.3	7vgr_E		RQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
102	L	H	b	4.5	7vgr_E		L	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
103	F	H	e	25.8	7vgr_E		FWYL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
104	A	H	e	40.2	7vgr_E		RIMKAC	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
105	R	H	b	2.0	7vgr_E		R	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
106	T	S	b	2.6	7vgr_E		TCAV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
107	R		e	70.0	7vgr_E		GRKH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
108	S		b	12.5	7vgr_E		ST	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
109	M	G	e	65.7	7vgr_E		WFMA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
110	W	G	e	32.7	7vgr_E		W	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
111	S	G	b	3.9	7vgr_E		SA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
112	F	G	b	15.3	7vgr_E		FWY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
113	N		b	2.4	7vgr_E		NM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
114	P	T	e	55.0	7vgr_E	homo	P	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
115	E	T	e	40.7	7vgr_E	homo	E	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
116	T		b	14.9	7vgr_E		TSVI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
117	N	S	e	55.2	7vgr_E	homo	ND	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
118	I	E	b	13.5	7vgr_E	homo	ANCIMS	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
119	L	E	b	0.0	7vgr_E	homo	LIV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
120	L	E	b	2.2	7vgr_E	homo	LMGIT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
121	N	E	b	1.2	7vgr_E	homo	CNSVT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
122	V	E	b	1.3	7vgr_E	homo	VITL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
123	P	E	e	35.7	7vgr_E	hetero homo	PSDLTQN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
124	L	S	b	17.4	7vgr_E	homo	LVMAIF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
125	H	S	e	73.3	7vgr_E		LKGTYHMR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
126	G	S	e	90.5	7vgr_E	hetero	GN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
127	T	S	e	56.5	7vgr_E		RTGQHK	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
128	I	E	e	57.9	7vgr_E	hetero	TQSMINVH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
129	L	E	e	21.3	7vgr_E	homo	YVQLF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
130	T	E	b	7.1	7vgr_E		VCTY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
131	R	E	e	27.7	7vgr_E	homo	RLNQI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
132	P	E	e	23.3	7vgr_E	homo	PF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
133	L	E	b	7.9	7vgr_E	homo	LIVA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
134	L	S	e	89.3	7vgr_E	homo	ILVMEQD	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
135	E	S	e	70.9	7vgr_E	homo	EGQSA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
136	S		e	48.4	7vgr_E	homo	DSAVT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
137	E		e	47.7	7vgr_E	homo	PSYE	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
138	L	S	e	65.2	7vgr_E	hetero homo	THMLP	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
139	V	E	e	57.3	7vgr_E	homo	GVTSA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
140	I	E	b	9.9	7vgr_E	homo	VLI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
141	G		e	47.6	7vgr_E	homo	TSGQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
142	A		b	3.6	7vgr_E	homo	ALPVF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
143	V		e	36.0	7vgr_E	homo	TVIL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
144	I		b	0.6	7vgr_E	homo	ILVN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
145	L	T	e	46.1	7vgr_E	homo	LIKTNV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
146	R	T	e	80.2	7vgr_E	hetero homo	RSND	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
147	G	T	b	14.3	7vgr_E	homo	G	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
148	H		e	32.5	7vgr_E	hetero	HVNTEY	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
149	L	E	b	0.0	7vgr_E	homo	L	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
150	R	E	e	40.7	7vgr_E	homo	YRKLF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
151	I	E	b	0.0	7vgr_E	homo	MVIACF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
152	A	T	e	37.5	7vgr_E	homo	EADQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
153	G	T	e	72.6	7vgr_E	homo	G	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
154	H	E	e	24.6	7vgr_E	homo	HFMQVYI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
155	H	E	e	53.9	7vgr_E	homo	KHWRTQS	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
156	L	E	b	9.0	7vgr_E	homo	LIFVM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
157	G	E	e	21.4	7vgr_E		GA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
158	R		e	71.9	7vgr_E	hetero homo	TRGKAS	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
159	C		b	10.7	7vgr_E	homo	CVMYFLG	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
160	D		e	53.7	7vgr_E	homo	DQTESN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
161	I	S	b	11.1	7vgr_E	homo	IVPLYFW	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
162	K	S	e	82.5	7vgr_E	homo	DSGKHANQE	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
163	D		b	11.7	7vgr_E		DNHRQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
164	L		b	17.4	7vgr_E	homo	LM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
165	P	S	e	65.1	7vgr_E	hetero homo	P	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
166	K		e	52.4	7vgr_E	hetero homo	KANDEVGSM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
167	E	E	b	0.5	7vgr_E	homo	YEDIF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
168	I	E	b	16.4	7vgr_E	homo	VIM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
169	T	E	b	1.3	7vgr_E	homo	TMFI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
170	V	E	b	0.0	7vgr_E	homo	VI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
171	A		b	14.3	7vgr_E	homo	AC	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
172	T	S	e	43.5	7vgr_E	homo	KTPARV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
173	S	S	e	48.4	7vgr_E	homo	SPVT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
174	R	S	e	51.8	7vgr_E		TRNDSQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
175	T		e	30.5	7vgr_E	homo	TVHRA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
176	L		b	0.0	7vgr_E	homo	LIR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
177	S	E	b	0.0	7vgr_E	homo	VICNSH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
178	Y	E	b	10.4	7vgr_E	hetero homo	YTAIWC	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
179	Y	E	b	0.9	7vgr_E	homo	YTLSDGQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
180	K	E	e	48.6	7vgr_E	hetero homo	KRL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
181	L	E	e	32.0	7vgr_E	hetero homo	VMRL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
182	G	E	e	35.7	7vgr_E	hetero homo	GAVIDEFKLNPQRST	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
183	A		e	63.4	7vgr_E	hetero homo	KRFALDEGINPQSTV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
184	S		e	46.1	7vgr_E	hetero homo	SLRVQKT	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
185	Q		e	63.8	7vgr_E	homo	QDVLRM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
186	R	B	e	69.6	7vgr_E	hetero homo	KNRSA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
187	V		e	57.3	7vgr_E	hetero homo	YAVMSEIL	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
188	A	S	e	105.4	7vgr_E	hetero homo	TGSDQYAN	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
189	G	S	e	53.6	7vgr_E	hetero homo	TGSNDV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
190	D	S	e	74.1	7vgr_E	hetero homo	DNASRQTVG	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
191	S		e	22.7	7vgr_E	hetero homo	STQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
192	G	B	b	14.3	7vgr_E	homo	GA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
193	F		e	54.5	7vgr_E	homo	WFVI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
194	A		b	0.9	7vgr_E	homo	ALV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
195	A	E	b	8.0	7vgr_E	homo	VFIYA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
196	Y	E	b	0.0	7vgr_E	homo	YF	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
197	S	E	e	50.8	7vgr_E	hetero homo	VHINS	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
198	R	E	e	30.8	7vgr_E	hetero homo	KR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
199	Y	E	e	45.2	7vgr_E	hetero homo	SYVA	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
200	R	E	e	32.8	7vgr_E	hetero	KR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
201	I		e	43.9	7vgr_E	hetero	AVHI	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
202	G		e	26.2	7vgr_E	hetero	G	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
203	N	S	e	62.4	7vgr_E	hetero	ND	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
204	Y		e	45.2	7vgr_E		YFH	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
205	K		e	47.6	7vgr_E		RSKE	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
206	L		e	85.4	7vgr_E		LVTAR	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
207	N	-	-	-	-		PNQSDVER	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
208	T	-	-	-	-		STADEGIKLPRV	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
209	D	-	-	-	-		NDRPST	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
210	H	-	-	-	-		THKMNPQ	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
211	S	-	-	-	-		SPDTLK	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
212	S	-	-	-	-		SGNEAT	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
213	S	-	-	-	-		SGMDLE	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
214	S	-	-	-	-		GSMTQNA	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
215	D	-	-	-	-		DEM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
216	N	-	-	-	-		NTHRKD	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
217	I	-	-	-	-		ELITA	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
218	A	-	-	-	-		ALKR	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
219	L	-	-	-	-		LHM	TOPO_DOM /note="Intravirion" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion"
220	L	-	-	-	-		LFM	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
221	V	-	-	-	-		V	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"
222	Q	-	-	-	-		Q	TOPO_DOM /note="Intravirion" TOPO_DOM /note="Intravirion"