#WARNING:no index is registered index 'YP_009725298.1' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
25858 638 0 YP_009725298.1()
QUERYSEQ
AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETS
WQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDW
LEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1A----
A
2Y----
YVF
3T----
T
4R----
R
5Y----
Y
6V----
VI
7D----
D
8N----
QN
9N----
YN
10F----
MF
11C----
C
12G----
G
13P----
KPV
14D----
DN
15G----
G
16Y----
KY
17P----
P
18L----
IL
19E----
AESD
20C----
CDAE
21I----
YIF
22K----
AK
23D----
DKFA
24L----
LIF
25L----
LMV
26A----
A
27R----
KRS
28A----
AED
DISORDER predicted by DISOPRED
29G----
G
30K----
KLD
31A----
STVLA
32S----
MEASGLVDFHIKNPQRTY
33C----
CADEGLSVFHIKMNPQRTY
DISORDER predicted by DISOPRED
34T----
TDV
35L----
LVE
36S----
AS
37E----
EDA
38Q----
QERV
39L----
LVAK
40D----
DS
41F----
YVRFLADEGIKNPQST
42I----
IMTLADEFGKNPQRSVY
43D----
DELAFGIKNPQRSTVY
44T----
STLADEFGIKNPQRVY
45K----
DK
46R----
RE
47G----
GFY
48V----
IVF
49Y----
YILAEGSVDFKNPQRTCHMW
50C----
CVT
51C----
LCF
52R----
RKN
53E----
NEKD
54H----
HKN
55E----
LE
56H----
YH
57E----
RE
58I----
IVL
59A----
VA
60W----
W
61Y----
NFHY
62T----
VT
63E----
ETQ
64R----
R
65S----
SKR
66E----
DEN
67K----
VK
68S----
PSA
69Y----
Y
70E----
EPS
71L----
KHLR
72Q----
Q
73T----
TS
74P----
API
75F----
F
76E----
TE
77I----
IMV
78K----
KNV
79L----
SL
80A----
VAI
81K----
VKI
82K----
QK
83F----
FCKL
84D----
D
85T----
TDG
86F----
FVMAEGLSDHIKNPQRTY
87N----
KEN
88G----
GNDELAFIKPQRSTVY
89E----
ESTD
90C----
CVP
91P----
P
92N----
KEHRN
93F----
FHY
94V----
VTSLADEFGIKNPQRY
95F----
F
96P----
TP
97L----
LI
98N----
GN
99S----
SC
100I----
KQEI
101I----
IV
102K----
LKQ
103T----
VTM
104I----
IVL
105Q----
QSTA
106P----
P
107R----
RSADEGIKLNPQTV
108V----
VLT
109E----
EKAN
110K----
KQVAN
111K----
KQT
112K----
KNLA
113L----
LNTF
114D----
EYGDKN
115G----
GTHLN
116F----
FLK
117M----
MNYQ
118G----
GLR
119R----
KRL
120I----
IQLADEFGKNPRSTVY
121R----
RHLADEFGIKNPQSTVY
122S----
SLTADEFGIKNPQRVY
123V----
VLFADEGIKNPQRSTY
124Y----
YLADEFGIKNPQRSTV
125P----
PAGTLDEFIKNQRSVY
126V----
VFKLADEGINPQRSTY
127A----
AEQY
128S----
SATG
129P----
PVLK
130N----
QESDN
131E----
ENAQ
132C----
PCV
133N----
NTGQ
134Q----
YQDN
135M----
IM
136C----
YHC
137L----
HL
138S----
S
139T----
AT
140L----
LYF
141M----
MVLI
142K----
KDE
143C----
C
144D----
NSGTD
145H----
HSYA
146C----
C
147G----
GD
148E----
EYRNK
149T----
GVYDT
150S----
SGT
151W----
W
152Q----
QLTC
153T----
TP
154G----
GCL
155D----
NDK
156F----
AFD
157V----
IVL
158K----
QKG
159A----
GAT
160T----
FTV
161C----
ACN
162E----
CE
163F----
DLGQFH
164C----
C
165G----
G
166T----
AT
167E----
ENSH
168N----
YNALDEFGIKPQRSTV
169L----
LSTCADEFGIKNPQRVY
170T----
AVTLDEFGIKNPQRSY
171K----
NFCKI
172E----
DEQ
173G----
DGLE
174A----
LPTVA
175T----
QTS
176T----
ST
177C----
CS
178G----
GV
179Y----
LYDM
180L----
LVAI
181P----
PEKR
182Q----
KSPTQRA
183N----
NA
184A----
AG
185V----
VL
186V----
VLIF
187K----
KLC
188I----
AMTILDEFGKNPQRSVY
189Y----
TPNYALDEFGIKQRSV
190C----
CALDEFGIKNPQRSTVY
191P----
P
192A----
ACGF
193C----
CAN
194H----
KQNHALDEFGIPRSTVY
195N----
DNGALEFIKPQRSTVY
196S----
GPDSALEFIKNQRTVY
197E----
EASLDFGIKNPQRTVY
198V----
CVIALDEFGKNPQRSTY
199G----
GSLADEIKPRTVFNQYCHMW
200P----
PSLAGDEIKRTVFNQYCHMW
201E----
EKSALDFGINPQRTVY
202H----
HALDEFGIKNPQRSTVY
203S----
STNALDEFGIKPQRVY
204L----
VLA
205A----
AMP
206E----
QDLE
207Y----
YLV
208H----
HDYLV
209N----
NSK
210E----
EHSIM
211S----
SPLRM
212G----
GNDTAEFIKLPQRSV
213L----
IMGCDL
214K----
KERN
215T----
TLAVC
216I----
IRCD
217L----
LVADEFGIKNPQRSTY
218R----
ERDALFGIKNPQSTVY
219K----
KVPS
220G----
GKV
221G----
GNS
222R----
RKF
223T----
T
224I----
LVKIR
225A----
TCSIA
226F----
FY
227G----
G
228G----
G
229C----
VCA
230V----
VIA
231F----
YFW
232S----
AS
233Y----
YP
234V----
MVIF
235G----
G
236C----
CK
237H----
YVCESH
238N----
NDEG
239K----
GK
240C----
TRVC
241A----
MAT
242Y----
YVH
243W----
WF
244V----
VI
245P----
P
246R----
R
247A----
A
248S----
KSY
249A----
SA
250N----
CNIVD
251I----
VI
252G----
SGA
253C----
AGRCSLDEFIKNPQTVY
254N----
IERNGS
255H----
HIGF
256T----
TSGD
257G----
GDS
258V----
AICV
259V----
TVIF
260G----
GFADEIKLNPQRSTV
261E----
TSED
262G----
GNW
263S----
CSVD
264E----
TEK
265G----
GTAV
266L----
LITSC
267N----
NWE
268D----
DEKNT
269N----
KDEAN
270L----
LVN
271L----
LVTM
272E----
EQADFGIKLNPRSTV
273I----
IFY
274L----
L
275Q----
EINQS
276K----
RKEQ
277E----
AETDLFGIKNPQRSVY
278K----
QRKALDEFGINPSTVY
279V----
HVRALDEFGIKNPQSTY
280N----
NSGA
281I----
IL
282N----
NR
283I----
FIV
284V----
VDC
285G----
GAQN
286D----
DEQ
287F----
FT
288K----
VLAHKR
289L----
LDVF
290N----
NT
291E----
EPD
292E----
TEVLADFGIKNPQRSY
293I----
VCILADEFGKNPQRSTY
294A----
ALVDEFGIKNPQRSTY
295I----
IATV
296I----
IFVL
297L----
LI
298A----
AS
299S----
SGNI
300F----
LFT
301S----
STD
302A----
ACGTS
303S----
SDTN
304T----
TVIP
305S----
SKDEC
306A----
ATKE
307F----
FTIL
308V----
VREI
309E----
EDQ
310T----
LTS
311V----
LVRCI
312K----
KQDR
313G----
GLNS
314L----
LCVA
315D----
DTHALEFGIKNPQRSVY
316Y----
YNLFADEGIKPQRSTV
317K----
KADELFGINPQRSTVY
318A----
SKATLDEFGINPQRVY
319F----
FYLVADEGIKNPQRST
320K----
KREALDFGINPQSTVY
321Q----
DKQTVALEFGINPRSY
322I----
IYVALDEFGKNPQRST
323V----
VLRADEFGIKNPQSTY
324E----
EDATLFGIKNPQRSVY
325S----
SHDPALEFGIKNQRTVY
326C----
CLYR
327G----
GLVADEFIKNPQRST
328N----
NADEFGIKLPQRSTV
329F----
FNVYW
330K----
KVAI
331V----
VI
332T----
TM
333K----
LIKAMNR
334G----
G
335K----
DKPSR
336A----
YKAFP
337K----
IPKMV
338K----
KLRDET
339G----
GPDN
340A----
ATV
341W----
IWALDEFGKNPQRSTVY
342N----
NALDEFGIKPQRSTVY
343I----
IVALDEFGKNPQRSTY
344G----
GD
345E----
QAE
346Q----
NQFYE
347K----
AHKR
348S----
SAPT
349I----
IFLV
350L----
LNIT
351S----
ATVS
352P----
PG
353L----
LFY
354Y----
IYCVALDEFGKNPQRST
355A----
AGVS
356F----
FYL
357A----
TPHKA
358S----
GSVK
359E----
EQV
360A----
ASR
361A----
AF
362R----
KGCTR
363V----
KVWP
364V----
VIYW
365R----
RAGKS
366S----
SAT
367I----
ILS
368F----
FALPDEGIKNQRSTVY
369S----
SRYATLDEFGIKNPQV
370R----
RKELADFGINPQSTVY
371T----
TPVA
372L----
LFWC
373E----
DEKN
374T----
AITSH
375A----
AFCVY
376Q----
NRSKAQ
377N----
DNH
378S----
SFLT
379V----
IVKL
380R----
RSPL
381V----
VDTA
382L----
LEF
383Q----
QEDYAFGIKLNPRSTV
384K----
REYKADFGILNPQSTV
385A----
ARYVDEFGIKLNPQST
386A----
AFPSCLDEGIKNQRTVY
387I----
SIVPYALDEFGKNQRT
388T----
TNDYALEFGIKPQRSV
389I----
IDTALEFGKNPQRSVY
390L----
LMPADEFGIKNQRSTVY
391D----
DFCALEGIKNPQRSTVY
392G----
GRDALEFIKNPQSTVY
393I----
VIF
394S----
SAFT
395Q----
QEPSD
396Y----
YFQ
397S----
SFDT
398L----
LGIEA
399R----
RLKP
400L----
LVADEFGIKNPQRSTY
401I----
CIFVL
402D----
DA
403A----
ACPV
404M----
MIVANS
405M----
VDMNAGLEIKPRSTCFHQY
406F----
FYLAGDEIKNPRSTVCHMQ
407T----
TVAGLDEIKNPRSCFHMQY
408S----
SEGALDIKNPRTVCFHMQY
409D----
DLAEFGIKNPQRSTVY
410L----
LSADEFGIKNPQRTVY
411A----
LASDEFGIKNPQRTVY
412T----
TDAGLEKPSVFINQRYCHMW
413N----
NCLADEGKSTVFHIMPQRY
414N----
GSNLADEKTVCFHIMPQRY
415L----
VCKYLADEFGINPQRST
416V----
VLIF
417V----
VYTAI
418M----
MLVSA
419A----
ATR
420Y----
YLADEFGIKNPQRSTV
421I----
TVFI
422T----
TSLD
423G----
GYVE
424G----
RGFK
425V----
VL
426V----
LVTE
427Q----
QLR
428L----
LQFYK
429T----
TSLI
430S----
ADSGNMT
431Q----
QYEDL
432W----
WQKFADEGILNPRSTV
433L----
LVFMADEGIKNPQRST
434T----
SLDTAEFGIKNPQRV
435N----
NTADEFGIKLPQRSV
436I----
VIML
437F----
LFAI
438G----
GATS
439T----
TSI
440V----
VCTA
441Y----
VQSY
442E----
DSETN
443K----
AKM
444L----
LV
445K----
KSAR
446P----
PSKA
447V----
FIVL
448L----
LFV
449D----
EDNTQ
450W----
WAT
451L----
CVLI
452E----
ELVFM
453E----
AEKS
454K----
KAT
455F----
LSTYFADEGIKNPQRV
456K----
KSREALDFGINPQTVY
457E----
AELDFGIKNPQRSTVY
458G----
TGALDEFIKNPQRSVY
459V----
AVMFI
460E----
ESGNK
461F----
FI
462L----
LIA
463R----
KRSLN
464D----
DG
465G----
AMLG
466W----
WFA
467E----
EKGT
468I----
LIG
469V----
LFIV
470K----
KLR
471F----
FVAI
472I----
LFVI
473S----
SFMILV
474T----
TKHRE
475C----
GAKNRC
476A----
LAVQ
477C----
YFC
478E----
VDTE
479I----
YVI
480V----
TVI
481G----
SKG
482G----
GCQV
483Q----
GQK
484I----
FIY
485V----
VQ
486T----
VFAT
487C----
VALC
488A----
ARNSGT
489K----
DAEGK
490E----
NSHKYE
491I----
SLIV
492K----
SKN
493E----
ESKTQD
494S----
LCKIS
495V----
VCL
496Q----
KQH
497T----
QSTACI
498F----
FVL
499F----
LCMFI
500K----
DHKG
501L----
LIV
502V----
LVM
503N----
NST
504K----
KT
505F----
AIGF
506L----
ML
507A----
QESKA
508L----
LMK
509C----
LC
510A----
HLIA
511D----
TD
512S----
SQNKT
513I----
VI
514I----
SKIT
515I----
WI
516G----
AG
517G----
G
518A----
STAC
519K----
KN
520L----
LVI
521K----
SRDPK
522A----
AST
523L----
LVI
524N----
NIY
525L----
LYTG
526G----
GR
527E----
ERTD
528T----
VEYST
529F----
FAYL
530V----
VILY
531T----
FALT
532H----
QFSPH
533S----
SNR
534K----
KSGR
535G----
GT
536L----
LTVY
537Y----
YL
538R----
RTFLADEGIKNPQSVY
539K----
QEKLADGPSTVCFHIMNRY
540C----
CVA
541V----
VIQKL
542K----
SRLTK
543S----
TGCLS
544R----
KQAR
545E----
EDKA
546E----
QREK
547T----
LTFM
548G----
GQND
549L----
L
550L----
LV
551M----
LMI
552P----
P
553L----
GLK
554K----
DKQR
555A----
AYQS
556P----
KPN
557K----
KM
558E----
EKQ
559I----
VIT
560I----
TLEGI
561F----
FGVI
562L----
LIF
563E----
END
564G----
GAS
565E----
DTE
566T----
TFSA
567L----
HIDVL
568P----
DAP
569T----
TVPK
570E----
VKTEN
571V----
ATILVF
572L----
NLT
573T----
TS
574E----
ETDN
575E----
VE
576V----
V
577V----
VDE
578L----
VL
579K----
VK
580T----
HNVTS
581G----
G
582D----
QED
583L----
L
584Q----
EQLADGIKPRSTVCFHMNY
585P----
PALDEGIKRSTVCFHMNQY
586L----
LTADEGIKPRSVCFHMNQY
587E----
EKLADGIPRSTVCFHMNQY
588Q----
ETQ
589P----
PH
590T----
TSVI
591S----
DNPS
592E----
ES
593A----
FHLA
594V----
VTG
595E----
PNESAGLDFIKQRTVY
596A----
GSALDEFIKNPQRTVY
597P----
AMPGLSDEFIKNQRTVY
598L----
IVLAGSDEFKNPQRTY
599V----
VI
600G----
G
601T----
TND
602P----
YP
603V----
V
604C----
CLI
605I----
VI
606N----
NS
607G----
GDK
608L----
LKI
609M----
MLF
610L----
LFV
611L----
LVR
612E----
ERS
613I----
TILV
614K----
EKD
615D----
DN
616T----
KEST
617E----
E
618K----
QFTK
619Y----
YF
620C----
CYLADEGIKPRSTVFHMNQ
621A----
PA
622L----
L
623A----
CSA
624P----
PTI
625N----
NGD
626M----
GLM
627M----
KLM
628V----
VAI
629T----
VT
630N----
NSP
631N----
TN
632T----
LVT
633F----
F
634T----
RTS
635L----
L
636K----
K
637G----
G
638G----
G