#WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/22923.bltA' #WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/22923.psiA'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
22923 84 0 Q80H93(NS8B_SARS) RecName: Full=ORF8b protein;AltName: Full=Accessory protein 8b;AltName: Full=Non-structural protein 8b; Short=ns8b;
QUERYSEQ
MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols feature table variant
1M----
2C----
3L----
4K----
5I----
6L----
7V----
8R----
9Y----
10N----
11T----
12R----
13G----
14N----
15T----
16Y----
17S----
18T----
19A----
20W----
21L----
22C----
23A----
24L----
25G----
26K----
27V----
28L----
29P----
30F----
31H----
32R----
33W----
34H----
35T----
36M----
37V----
38Q----
39T----
40C----
41T----
42P----
43N----
44V----
45T----
46I----
47N----
48C----
49Q----
50D----
51P----
52A----
53G----
54G----
55A----
56L----
57I----
58A----
59R----
60C----
61W----
62Y----
63L----
64H----
65E----
66G----
67H----
68Q----
69T----
70A----
71A----
72F----
73R----
74D----
75V----
76L----
77V----
78V----
79L----
80N----
81K----
82R----
83T----
84N----