#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4636 527 13 YP_009725309.1()
QUERYSEQ
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1A e125.9 5c8s_B
SA
DISORDER predicted by DISOPRED
2E e 77.4 5c8s_B hetero Q1T6X8_CVHSA
EQS
DISORDER predicted by DISOPRED
3N e 86.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
INQSV
DISORDER predicted by DISOPRED
4V e 68.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
VST
DISORDER predicted by DISOPRED
5T e 72.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
TCV
DISORDER predicted by DISOPRED
6G e 51.2 5c8s_B hetero Q1T6X8_CVHSA precipitant
GN
7LSe 20.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
L
8FSe 52.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
FY
DISORDER predicted by DISOPRED
9K e 46.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
K
10DBe 35.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
DIN
DISORDER predicted by DISOPRED
11C b 2.0 5c8s_B
C
12SBb 14.1 5c8s_B precipitant
SANTY
13K e 54.2 5c8s_B precipitant
KR
14V e 39.2 5c8s_B precipitant
ESGANTIV
15ISe 80.1 5c8s_B
EPDIYFCSTAGL
16TSe 48.7 5c8s_B precipitant
SDLTEIQAV
17G b 19.0 5c8s_B precipitant
GNPDYL
18L b 4.5 5c8s_B
LYVI
19H b 6.3 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
HPGS
20PSe 26.4 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
P
21TSe 50.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
AST
22QSe 25.5 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
HYQ
23A b 15.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
A
24PSe 69.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
PTVHN
25TSe 47.4 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
TS
26HTe 48.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
FYHT
27LTe 64.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
LMVK
28SSe 26.6 5c8s_B hetero R1AB_CVHSA R1AB_SARS2
SA
29VSb 4.7 5c8s_B hetero Q1T6X8_CVHSA R1AB_CVHSA R1AB_SARS2
VL
30D b 6.8 5c8s_B
DSAN
31TGe 70.8 5c8s_B
DAT
32KGe 56.1 5c8s_B
KNTQR
33FGb 2.9 5c8s_B
FY
34KEe 33.5 5c8s_B
K
35TEe 50.6 5c8s_B hetero Q1T6X8_CVHSA
TVNA
36ETe 91.5 5c8s_B hetero R1AB_SARS2
DETNSG
37GTe 71.4 5c8s_B
GEDSNQ
38LEe 56.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
LEDY
39CEe 32.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
ACL
40V e 46.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
VA
41D e 61.1 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
NQVDAHC
42I e 37.4 5c8s_B
LIFCQ
43PTe 83.7 5c8s_B
NPVDGLIASEKQRTCFHMWY
44GTe 82.1 5c8s_B
GNTIVALS
45ISe 22.2 5c8s_B
VITACLNSG
46P e 73.6 5c8s_B
NPETGD
47K e 57.1 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
KSNGAPLD
48D e 32.7 5c8s_B precipitant
VDNPEQSA
49MSe 70.0 5c8s_B precipitant
VMICL
50T e 66.9 5c8s_B
TKP
51Y b 7.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
Y
52R e 41.9 5c8s_B precipitant
SERKNA
53REb 3.2 5c8s_B precipitant
RHN
54LEb 3.9 5c8s_B
VL
55IEb 12.9 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
I
56S b 1.6 5c8s_B
S
57M b 8.2 5c8s_B
LFRYMK
58M e 26.6 5c8s_B precipitant
ML
59G e 54.8 5c8s_B hetero Q1T6X8_CVHSA precipitant
G
60F e 21.1 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
F
61K e 89.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
KR
62M e 32.4 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
FLM
63N e 79.4 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
DNSE
64Y e 33.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
AVILY
65Q e 75.0 5c8s_B hetero Q1T6X8_CVHSA R1AB_CVHSA R1AB_SARS2 precipitant
NTSQ
66VBe 44.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
IVLM
67NTe105.5 5c8s_B hetero Q1T6X8_CVHSA R1AB_SARS2 R1AB_CVHSA precipitant
PDNE
68GTe 59.5 5c8s_B
GN
69YBe 47.8 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
YSCQH
70P e 20.2 5c8s_B precipitant
HPSC
71N e 59.4 5c8s_B precipitant
KNTS
72MSb 6.8 5c8s_B precipitant
LM
73FBe 29.2 5c8s_B precipitant
F
74I b 7.6 5c8s_B
IC
75T e 51.9 5c8s_B
T
76RHe 37.5 5c8s_B precipitant
RK
77EHe 67.3 5c8s_B
DE
78EHe 27.6 5c8s_B
EFQ
79AHb 0.0 5c8s_B
A
80IHb 15.8 5c8s_B
IMV
81RHe 51.4 5c8s_B
RK
82HSb 18.8 5c8s_B precipitant
NHRQE
83VTb 15.3 5c8s_B
VA
84RTb 16.6 5c8s_B precipitant
R
85ASb 0.0 5c8s_B
GAS
86WEb 0.0 5c8s_B
W
87IEb 0.6 5c8s_B
VLI
88GEb 0.0 5c8s_B
G
89FEb 0.0 5c8s_B
FM
90DEb 9.3 5c8s_B metal MG
D
91VEb 2.7 5c8s_B metal MG
VA
92EEb 8.5 5c8s_B metal MG precipitant
E
93GEb 10.7 5c8s_B
GAS
94CEb 0.0 5c8s_B
ACT
95HEe 27.2 5c8s_B hetero Q1T6X8_CVHSA precipitant
H
96A b 0.0 5c8s_B
AV
97T e 26.6 5c8s_B precipitant
TCSIV
98RSe 67.6 5c8s_B precipitant
GR
99ESe 50.0 5c8s_B
DNSETP
100ABb 2.7 5c8s_B
NAS
101V e 48.0 5c8s_B hetero R1AB_CVHSA R1AB_SARS2 Q1T6X8_CVHSA
IVC
102GSe 35.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
G
103T b 5.2 5c8s_B precipitant
T
104NEe 21.8 5c8s_B hetero Q1T6X8_CVHSA precipitant
N
105LEb 2.2 5c8s_B
VLF
106PEb 0.0 5c8s_B
P
107LEb 0.0 5c8s_B
LF
108QEb 6.6 5c8s_B
Q
109LEb 0.0 5c8s_B
LVI
110GEb 0.0 5c8s_B
G
111FEb 0.5 5c8s_B
F
112SSb 17.2 5c8s_B
S
113TSe 24.0 5c8s_B
TN
114GSe 71.4 5c8s_B
G
115V e 26.0 5c8s_B
VIA
116NEe 41.2 5c8s_B
DN
117LEb 11.8 5c8s_B
FL
118VEb 11.3 5c8s_B
V
119A b 0.0 5c8s_B
VA
120V b 12.7 5c8s_B
QETRIV
121P b 3.9 5c8s_B
PAT
122TEb 3.9 5c8s_B
ETVS
123GEb 1.2 5c8s_B
G
124YEb 12.6 5c8s_B hetero Q1T6X8_CVHSA R1AB_CVHSA
CLYVM
125VEb 4.7 5c8s_B precipitant
VFI
126DEe 21.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
DASVL
127T b 6.5 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
TED
128PSe 32.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
ERNSP
129NSe 73.3 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
DWSNIFKTV
130N e 48.5 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
GNC
131TEe 53.2 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
SNDYT
132DEe 34.2 5c8s_B
VMSNRDETY
133FEe 37.3 5c8s_B
FILV
134SEb 18.2 5c8s_B precipitant
KTEAQS
135REe 56.1 5c8s_B precipitant
PKRNVGST
136V b 8.0 5c8s_B precipitant
VIAT
137S e 43.0 5c8s_B
VRNASCK
138A e 22.3 5c8s_B
AS
139KBe 45.8 5c8s_B precipitant
RK
140P e 28.7 5c8s_B
APS
141P b 13.2 5c8s_B
P
142PSe 93.8 5c8s_B
P
143G e 22.6 5c8s_B
G
144DGe 90.7 5c8s_B
ED
145QGe 56.1 5c8s_B
QK
146FGe 24.9 5c8s_B
F
147KGe 67.5 5c8s_B
KATNR
148HGe 29.8 5c8s_B
H
149LGb 0.6 5c8s_B
LI
150IGe 49.7 5c8s_B
IVLR
151PGe 53.5 5c8s_B
PA
152LGb 15.7 5c8s_B
L
153MGb 10.1 5c8s_B
MLF
154YTe 80.9 5c8s_B
RKSNYTH
155KSe 69.8 5c8s_B
KRS
156G b 11.9 5c8s_B
GA
157L e 34.3 5c8s_B
QALKE
158P e 49.6 5c8s_B
PKART
159WHb 2.8 5c8s_B
W
160NHe 68.5 5c8s_B
DSPHNL
161VHe 30.7 5c8s_B
VI
162VHb 0.0 5c8s_B
VIL
163RHb 7.5 5c8s_B
R
164IHe 29.8 5c8s_B
RIKP
165KHe 42.0 5c8s_B
RK
166IHb 1.2 5c8s_B
I
167VHb 0.7 5c8s_B
V
168QHe 53.6 5c8s_B
QE
169MHb 11.1 5c8s_B
M
170LHb 1.1 5c8s_B
LICFV
171SHb 7.0 5c8s_B precipitant
SAC
172DHe 58.6 5c8s_B precipitant
D
173THe 20.8 5c8s_B
TYHNF
174LHb 0.0 5c8s_B
LF
175KTe 40.6 5c8s_B
DAKCISLV
176NTe 48.8 5c8s_B
NGDK
177LTe 27.5 5c8s_B
LVS
178S b 15.6 5c8s_B precipitant
SA
179DSe 37.0 5c8s_B
DN
180RSb 13.8 5c8s_B
RIYTCSV
181V b 1.3 5c8s_B
VLC
182VEb 0.0 5c8s_B
VTI
183FEb 1.0 5c8s_B
FYL
184VEb 0.0 5c8s_B
VI
185LEb 1.1 5c8s_B
LTC
186WSb 10.4 5c8s_B
WY
187ASe 45.5 5c8s_B metal MG precipitant
ASGC
188HHe 30.4 5c8s_B precipitant
HAGC
189GHe 51.2 5c8s_B precipitant
GSN
190FHb 15.8 5c8s_B
FNL
191EHb 1.0 5c8s_B metal MG
ED
192LHb 10.1 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2 precipitant
L
193THb 1.3 5c8s_B
TKR
194SHb 0.0 5c8s_B
STAC
195MHb 3.4 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
LMA
196KHe 40.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
RKTSH
197YHb 0.9 5c8s_B
YFN
198FHb 0.5 5c8s_B
FYL
199VBb 14.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
VANC
200K e 50.0 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
KEI
201I e 42.7 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
IVFL
202G b 4.8 5c8s_B
GD
203PSb 18.6 5c8s_B hetero R1AB_SARS2 precipitant
PKTRAEGLSVDFHIMNQY
204E e 40.2 5c8s_B metal CL
EDNVIQSAGKLPRT
205R e 41.1 5c8s_B
YQKRILVADEGPST
206TBe 67.5 5c8s_B
TFKRSVNYH
207C b 2.7 5c8s_B metal ZN
CAGLSDEFIKMNPQRTVY
208CTe 36.7 5c8s_B metal ZN
CSENF
209LTe 80.3 5c8s_B metal ZN precipitant
MKVSDLEQYAFGINPRT
210CSe 30.0 5c8s_B metal ZN precipitant
C
211DSe 99.4 5c8s_B
GTNSDP
212RSe 35.8 5c8s_B
KRENST
213RBb 13.4 5c8s_B
REMLSV
214A b 0.0 5c8s_B
A
215T b 1.9 5c8s_B
TISA
216CEb 0.0 5c8s_B
CFTAL
217FEb 8.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
YFL
218SEb 3.9 5c8s_B precipitant
NSTMADEGKLV
219TTe 48.1 5c8s_B
SIRMT
220ATe 82.0 5c8s_B precipitant
RHVPDAST
221STe 53.9 5c8s_B precipitant
TLSRGDNYQ
222DTe 76.5 5c8s_B
GNEQHDC
223TEe 24.7 5c8s_B
TISYALEDVGKPR
224YEe 20.4 5c8s_B hetero Q1T6X8_CVHSA R1AB_CVHSA R1AB_SARS2
YVF
225AEb 0.9 5c8s_B
AKHCGS
226C b 0.0 5c8s_B metal ZN
C
227WTb 0.8 5c8s_B precipitant
WFRN
228HTe 41.8 5c8s_B precipitant
KYHRSNT
229HTe 30.9 5c8s_B metal ZN precipitant
HG
230S b 7.8 5c8s_B precipitant
ASGNCH
231I e 82.0 5c8s_B precipitant
LMFSVYRCI
232GSe 60.7 5c8s_B precipitant
GPSLT
233F b 11.0 5c8s_B precipitant
CILFYAS
234D b 13.6 5c8s_B
DSM
235YEb 11.7 5c8s_B
YKGF
236VEb 0.0 5c8s_B
VLTI
237YSb 2.6 5c8s_B hetero R1AB_CVHSA Q1T6X8_CVHSA R1AB_SARS2
YVI
238NSb 1.2 5c8s_B
N
239P b 0.8 5c8s_B
PCA
240FEb 3.8 5c8s_B
FYKLQ
241MEb 0.0 5c8s_B
YACFILMV
242IEb 5.8 5c8s_B
IVLF
243DEb 1.2 5c8s_B
D
244VGb 0.0 5c8s_B
IV
245QGe 41.3 5c8s_B
Q
246QGe 63.3 5c8s_B precipitant
QKH
247WGe 21.5 5c8s_B precipitant
WEA
248GTe 79.8 5c8s_B
GRS
249F b 18.7 5c8s_B
YAVIF
250TSe 87.7 5c8s_B precipitant
TVNISKALDEFGPQRY
251GSe 42.9 5c8s_B
GKALDEFINPQRSTVY
252N e 62.4 5c8s_B
SNK
253LHb 4.5 5c8s_B
L
254QHe 29.1 5c8s_B
QSTA
255SHe 35.9 5c8s_B precipitant
SDTNMFQVL
256NHb 3.0 5c8s_B precipitant
NAT
257HHb 1.0 5c8s_B metal ZN
H
258DHe 32.7 5c8s_B
DHA
259LHe 71.4 5c8s_B precipitant
EALRNTIQ
260YHe 31.9 5c8s_B
IVYHF
261C b 0.7 5c8s_B metal ZN
C
262Q e 74.0 5c8s_B
QNSDG
263VSe 55.3 5c8s_B
VFIQ
264H e 23.6 5c8s_B metal ZN precipitant
H
265G e 71.4 5c8s_B precipitant
GRKQA
266N e 33.9 5c8s_B
DGNH
267A e 48.2 5c8s_B
AES
268HSe 31.9 5c8s_B precipitant
H
269V e 28.0 5c8s_B precipitant
VETD
270AHb 0.0 5c8s_B
A
271SHb 11.7 5c8s_B
SL
272CHb 12.7 5c8s_B precipitant
CAGSN
273DHb 11.7 5c8s_B metal MG precipitant
D
274AHb 0.0 5c8s_B
AT
275IHe 25.1 5c8s_B precipitant
IVA
276MHb 0.0 5c8s_B
M
277THb 0.0 5c8s_B
T
278RHb 4.0 5c8s_B precipitant
RKG
279CHb 3.3 5c8s_B metal ZN precipitant
C
280LHb 1.1 5c8s_B
L
281AHb 0.0 5c8s_B
A
282VHb 0.0 5c8s_B
IV
283HHe 23.6 5c8s_B precipitant
HYN
284EHe 24.1 5c8s_B precipitant
DENS
285CHb 9.3 5c8s_B precipitant
CA
286FHb 11.5 5c8s_B
F
287VSe 28.7 5c8s_B
VCI
288KSe 54.7 5c8s_B
KEQGN
289R e 55.7 5c8s_B
RNSDE
290V e 33.3 5c8s_B
VI
291D e 55.6 5c8s_B
DNE
292WSe 36.7 5c8s_B compound SAH SAM
W
293TSe 68.0 5c8s_B
SDNT
294I e 25.3 5c8s_B
IVL
295E e 70.4 5c8s_B
TEV
296Y b 10.4 5c8s_B
Y
297P e 94.6 5c8s_B
P
298I e 31.0 5c8s_B
IFYHM
299I e 59.6 5c8s_B
I
300GSe 31.0 5c8s_B
ASGD
301DSe 48.1 5c8s_B
NHD
302EHb 5.5 5c8s_B
E
303LHe 60.1 5c8s_B
LKVQDENA
304KHe 56.9 5c8s_B
KASEFRV
305IHb 6.0 5c8s_B
ILV
306NHe 26.7 5c8s_B compound G3A
N
307AHe 46.9 5c8s_B
SKTRGA
308AHb 0.9 5c8s_B
SACG
309CHb 3.3 5c8s_B compound G3A
CG
310RHe 55.7 5c8s_B compound G3A
R
311KHe 54.2 5c8s_B
ILTKYSNVA
312VHb 0.7 5c8s_B
VL
313QHb 16.8 5c8s_B compound G3A
QE
314HHe 30.9 5c8s_B
RSHG
315MHb 7.7 5c8s_B
HVMN
316VHb 2.7 5c8s_B
VMYIT
317VHb 0.0 5c8s_B
VLMF
318KHe 33.5 5c8s_B
RKN
319AHb 0.0 5c8s_B
AS
320AHb 0.0 5c8s_B
AVC
321LHb 9.6 5c8s_B
LVMI
322LHe 29.2 5c8s_B
LKD
323AHb 5.4 5c8s_B
ALCIS
324DHe 31.5 5c8s_B
YNGLDF
325K e 68.4 5c8s_B
KNRHS
326F b 16.3 5c8s_B
PFYVI
327PSe 76.0 5c8s_B
KDNEPAST
328VEb 4.7 5c8s_B
VALKTR
329LEb 0.0 5c8s_B
IVCL
330HEb 3.7 5c8s_B
YH
331DEb 3.1 5c8s_B
D
332IEb 3.5 5c8s_B
IV
333GSe 22.6 5c8s_B compound SAH SAM
G
334N b 13.9 5c8s_B compound SAH G3A SAM
N
335PSb 11.6 5c8s_B compound SAH SAM
P
336KSe 41.0 5c8s_B compound G3A SAH
K
337A b 7.1 5c8s_B
GA
338I e 55.6 5c8s_B compound G3A
ILV
339K e 46.2 5c8s_B
RKAP
340CSb 12.0 5c8s_B
CIV
341VSb 4.7 5c8s_B
VAYIGL
342PSe 69.8 5c8s_B
KVPDRGATSL
343Q e 89.3 5c8s_B
VDQRTEGAKLSCFHIMNPY
344A e 35.7 5c8s_B
TPAGNYDEFIKLQRSV
345DSe104.5 5c8s_B
DVEAGIKLNPQRST
346VSb 9.3 5c8s_B
VALNFIY
347EEe 61.8 5c8s_B
EKDNPSL
348WEb 9.2 5c8s_B
WF
349KEe 46.2 5c8s_B
KYHFRN
350FEb 7.2 5c8s_B
FCY
351YEb 10.9 5c8s_B
YF
352DEb 14.8 5c8s_B compound SAH SAM
D
353ASe 29.5 5c8s_B compound SAH SAM
AKTR
354QSe 61.2 5c8s_B compound SAH SAM
QNDFS
355P b 18.6 5c8s_B
P
356C e 23.3 5c8s_B
IVLTC
357SSe 81.2 5c8s_B
NSVTALDEFGIKPQRY
358DTe 64.8 5c8s_B
SNDPETKRALFGIQVY
359KTe 35.4 5c8s_B
NKLAGSDEIPRTVFQYCHMW
360A e 40.2 5c8s_B
VALDEGIKPRSTCFHMNQY
361YSe 76.5 5c8s_B
KYRALDEGIPSTVCFHMNQ
362KSe 47.6 5c8s_B
KSTQGCMN
363IEb 9.9 5c8s_B
VLIF
364EEe 62.3 5c8s_B
EKQ
365EEe 76.4 5c8s_B
QELTKAGSDINPRVCFHMY
366L e 21.3 5c8s_B compound SAH SAM
LFAGSDEIKNPQRTVCHMY
367F e 56.9 5c8s_B compound SAH SAM
FLDVHAGSEIKNPQRTCMY
368Y b 3.9 5c8s_B compound SAH SAM
Y
369S e 23.4 5c8s_B
DSTVK
370YHe 22.6 5c8s_B
YFDEL
371AHe 63.4 5c8s_B
DAEMIN
372THe 47.4 5c8s_B
TVAQDM
373HHb 13.6 5c8s_B
HACL
374STe 48.7 5c8s_B
GKASRH
375DTe 53.7 5c8s_B
DQKL
376KTe 59.9 5c8s_B
KQNSRALDEGIPTVCFHMY
377F b 9.6 5c8s_B
FALDEGIKPRSTVCHMNQY
378T e 63.0 5c8s_B
KLAMTEFS
379DSe 54.9 5c8s_B
DN
380GSb 17.9 5c8s_B
G
381VEb 0.0 5c8s_B
LV
382CEb 0.0 5c8s_B
CAM
383LEb 0.0 5c8s_B
LM
384FEb 0.0 5c8s_B
F
385WEb 13.9 5c8s_B compound SAH G3A SAM
W
386NSe 37.6 5c8s_B compound SAH G3A SAM
N
387C b 18.7 5c8s_B compound SAH SAM
C
388N e 26.1 5c8s_B compound G3A SAH SAM
N
389V b 18.0 5c8s_B compound SAH SAM
V
390DSe 45.1 5c8s_B
DPS
391RSe 34.0 5c8s_B
MKRC
392Y b 0.0 5c8s_B
Y
393P b 3.9 5c8s_B
P
394ASe 44.6 5c8s_B
EANSDHP
395NSe 20.6 5c8s_B
NF
396SEb 0.0 5c8s_B
SA
397IEb 3.5 5c8s_B
IVL
398VEb 0.7 5c8s_B
V
399CEb 0.0 5c8s_B
C
400REb 1.6 5c8s_B
R
401F b 1.4 5c8s_B compound G3A
FY
402D b 9.9 5c8s_B
D
403TTb 7.8 5c8s_B
T
404RTe 68.8 5c8s_B
R
405VSe 29.3 5c8s_B
VTNMC
406L e 69.1 5c8s_B
LRH
407SBe 28.1 5c8s_B
SN
408NTe 37.0 5c8s_B
KNEVTP
409LTb 7.9 5c8s_B
LF
410NEb 0.6 5c8s_B
NS
411LEb 4.5 5c8s_B
L
412PEe 45.7 5c8s_B
PEA
413G b 11.9 5c8s_B
G
414CTb 5.3 5c8s_B
CV
415DTe 37.0 5c8s_B
ND
416GSe 39.3 5c8s_B
G
417G b 7.1 5c8s_B
G
418SEb 3.1 5c8s_B
SA
419LEb 0.0 5c8s_B
L
420YEb 5.2 5c8s_B compound G3A
Y
421V b 16.7 5c8s_B
V
422NSb 7.3 5c8s_B compound G3A
N
423KSb 17.0 5c8s_B compound G3A
KNQ
424HSe 20.4 5c8s_B
H
425A b 10.7 5c8s_B
A
426FEe 35.4 5c8s_B compound G3A SAM
F
427HEb 18.3 5c8s_B
H
428TEb 2.6 5c8s_B compound G3A
T
429P e 44.2 5c8s_B
PDKNS
430A e 35.7 5c8s_B
APK
431F b 16.3 5c8s_B
FY
432D e 48.1 5c8s_B
DTNS
433KGe 74.5 5c8s_B
KRAIV
434SGe 39.1 5c8s_B
RSTAN
435AGb 0.9 5c8s_B
ASV
436FGb 3.3 5c8s_B
FM
437VTe 48.7 5c8s_B
RAVET
438NTe 22.4 5c8s_B
NKDH
439LSb 3.4 5c8s_B
L
440KEe 61.8 5c8s_B
K
441QEe 64.3 5c8s_B
PAQ
442L b 7.9 5c8s_B
MLA
443P e 63.6 5c8s_B
P
444F e 20.1 5c8s_B
F
445F b 1.0 5c8s_B
F
446Y b 1.7 5c8s_B
YF
447Y b 2.6 5c8s_B
YF
448S b 7.8 5c8s_B
SD
449D e 70.4 5c8s_B
DTS
450SSe 32.0 5c8s_B
TSG
451P e 71.3 5c8s_B
PEADNS
452C e 27.3 5c8s_B metal ZN
C
453E e 74.4 5c8s_B
EVD
454S----
VYSTLNADEGIKPQR
455H----
HVMIADEGKLNPQRST
456G----
GDQSEHAIKLNPRTV
457K----
GKNLETDSAIPQRV
458Q----
QNKMDLS
459V----
VMELGYDP
460V----
VLQSAIGDEFKNPRTY
461S----
KSEDAGLFINPQRTVY
462D----
DQEASGLFIKNPRTVY
463I----
IVLADEGKPRSTCFHMNQY
464D----
DN
465Y e 99.1 5c8s_B
YL
466V e 56.7 5c8s_B
V
467P e 64.3 5c8s_B
PS
468L e 42.1 5c8s_B
L
469K e 68.4 5c8s_B
KRA
470S e 20.3 5c8s_B
SAT
471ASe 81.2 5c8s_B
ASNKT
472TSe 30.5 5c8s_B
VTNDS
473C b 10.7 5c8s_B
C
474I b 0.0 5c8s_B
IV
475T b 1.3 5c8s_B metal ZN
T
476RSb 12.3 5c8s_B
RKA
477C e 26.7 5c8s_B metal ZN
C
478N e 43.0 5c8s_B
N
479LSe101.1 5c8s_B
LIV
480GSe 51.2 5c8s_B
G
481GSe 71.4 5c8s_B
G
482A e 20.5 5c8s_B
A
483V e 43.3 5c8s_B
V
484C b 10.7 5c8s_B metal ZN
C
485RHe 69.6 5c8s_B
SRKL
486HHe 36.6 5c8s_B
KH
487HHb 3.1 5c8s_B metal ZN
H
488AHb 9.8 5c8s_B
AC
489NHe 46.1 5c8s_B
ANEQDT
490EHe 33.7 5c8s_B
ELMD
491YHb 8.7 5c8s_B
Y
492RHe 26.1 5c8s_B
RHAQC
493LHe 62.8 5c8s_B
DNEAKLQS
494YHb 5.7 5c8s_B
YF
495LHe 23.6 5c8s_B
VLM
496DHe 63.6 5c8s_B
EDTMN
497AHb 14.3 5c8s_B
ASD
498YHb 8.7 5c8s_B
Y
499NHe 50.9 5c8s_B
N
500MHe 21.7 5c8s_B
TIMLA
501MHb 0.0 5c8s_B
FVAM
502IHe 36.8 5c8s_B
TSVIM
503SHe 78.9 5c8s_B
TSQA
504ATb 13.4 5c8s_B
AS
505GTb 10.7 5c8s_B
G
506F b 4.8 5c8s_B compound G3A
F
507SEb 9.4 5c8s_B
TRNS
508LEb 5.1 5c8s_B
LIF
509WEb 12.0 5c8s_B
W
510VEb 3.5 5c8s_B
VCI
511Y b 1.3 5c8s_B
YPTD
512KTe 41.0 5c8s_B
KNTHQ
513QTe 75.5 5c8s_B
TSNQ
514F b 10.5 5c8s_B
F
515D e 48.8 5c8s_B
DN
516TGe 33.1 5c8s_B
TVFIPCM
517YGe 60.4 5c8s_B
YF
518NGe 34.5 5c8s_B
NM
519LGb 0.0 5c8s_B
L
520WGe 30.7 5c8s_B
W
521NGe 53.3 5c8s_B
NQSKH
522TGe 26.6 5c8s_B
TSGI
523FSe 32.5 5c8s_B
F
524T e 72.7 5c8s_B
TSV
525R e108.7 5c8s_B
KRAENT
526L----
LVI
527Q----
QN