[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
29141 61 6 P0DTC6(NS6_SARS2) RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3;
QUERYSEQ 
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 61
Buired or ExposedBuried 0.0 (%) [0]
Exposed 100.0 (%) [8]
Ave relacc 94.9 %
SD relacc 17.12 %
Contact Molhetero 14.8 (%) [9]
nucleotide 0.0 (%) [0]
compound 0.0 (%) [0]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 0.0 (%) [0]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)