Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
29518 | 121 | 4 | YP_009724395.1() | |
QUERYSEQ |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
All | ||
Number of sites | 121 | |
Buired or Exposed | Buried | 31.8 (%) [27] |
Exposed | 68.2 (%) [58] | |
Ave relacc | 41.0 % | |
SD relacc | 27.39 % | |
Contact Mol | hetero | 0.0 (%) [0] |
nucleotide | 0.0 (%) [0] | |
compound | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | |
homo | 0.0 (%) [0] | |
precipitant | 0.0 (%) [0] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |