[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[95 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
15960 98 8 P59636(ORF9B_SARS) RecName: Full=ORF9b protein;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b;
QUERYSEQ 
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 98
Buired or ExposedBuried 13.9 (%) [11]
Exposed 86.1 (%) [68]
Ave relacc 49.5 %
SD relacc 26.33 %
Contact Molhetero 34.7 (%) [34]
nucleotide 0.0 (%) [0]
compound 7.1 (%) [7]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 32.7 (%) [32]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)