[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2080 221 12 P59596(VME1_SARS) RecName: Full=Membrane protein ; Short=M protein ;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ;
QUERYSEQ 
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRM
AGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 221
Buired or ExposedBuried 26.3 (%) [52]
Exposed 73.7 (%) [146]
Ave relacc 39.1 %
SD relacc 24.16 %
Contact Molhetero 12.7 (%) [28]
nucleotide 0.0 (%) [0]
compound 4.1 (%) [9]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 57.5 (%) [127]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)