[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1122913 132 0 Q01629(IFM2_HUMAN) RecName: Full=Interferon-induced transmembrane protein 2 ;AltName: Full=Dispanin subfamily A member 2c; Short=DSPA2c;AltName: Full=Interferon-inducible protein 1-8D;
QUERYSEQ 
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All LB/B (likely benign or benign)
Number of sites 132 3
Ave relacc 0.0 % 0.0 %
SD relacc 0.00 % 0.00 %
Contact Molhetero 0.0 (%) [0] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0]
compound 0.0 (%) [0] 0.0 (%) [0]
metal 0.0 (%) [0] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 0.0 (%) [0] 0.0 (%) [0]
precipitant 0.0 (%) [0] 0.0 (%) [0]
Number of variants 3 3
N_Freq(AAvariant)==0 % 0.0 % [0]
N_Freq(AAvariant)>0 % 100.0 % [3]
Ave Freq(AAvariant) 22.7 %
SD Freq(AAvariant) 3.09 %

Site Table for OMIM:LB/B [3 variants]

3 sites 33,41,121
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
33V---- 
AGVSEPLDFIKNQRTY
 TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" V->A:(27.0 %):LB/B - dbSNP:rs1058900
41M---- 
RGTMALDEFIKNPQSVY
 TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" M->T:(20.0 %):LB/B - dbSNP:rs14408
121I---- 
IFVC
 TRANSMEM /note="Helical" TRANSMEM /note="Helical" I->V:(21.0 %):LB/B - dbSNP:rs1059091