Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Site Table[100 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
26616 61 6 P0DTC6(NS6_SARS2) RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3;
QUERYSEQ
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
1M----
M
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
2F----
F
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
3H----
H
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
4L----
L
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
5V----
V
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
6D----
D
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
7F----
F
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
8Q----
Q
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
9V----
V
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
10T----
T
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
11I----
I
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
12A----
A
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
13E----
E
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
14I----
I
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
15L----
L
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
16L----
IL
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
17I----
I
18I----
I
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization."
19M----
M
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization."
20R----
RK
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization."
21T----
T
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization."
22F----
F
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
23K----
RK
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
24V----
VI
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
25S----
AS
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
26I----
I
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
27W----
W
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
28N----
N
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
29L----
L
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
30D----
D
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell."
31Y----
YIV
32I----
IL
33I----
I
34N----
SN
35L----
SL
36I----
I
37I----
VI
38K----
RK
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
39N----
QN
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
40L----
L
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
41S----
FS
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
42K----
K
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
43S----
PS
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
44L----
L
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
45T----
T
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
46E----
KE
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
47N----
KN
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
48K----
KN
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
49Y----
Y
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
50S----
S
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
51Q----
EQ
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
52L----
L
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
53D e126.5 7vph_I hetero RAE1L_HUMAN
D
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
54E e 77.9 7vph_I hetero RAE1L_HUMAN
DE
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
55E e 97.0 7vph_I hetero RAE1L_HUMAN
E
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
56Q e 77.0 7vph_I hetero RAE1L_HUMAN
EQ
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
57P e 92.2 7vph_I hetero RAE1L_HUMAN
P
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
58M e 77.8 7vph_I hetero RAE1L_HUMAN
M
MUTAGEN /note="M->A: Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors." ECO:0000269|PubMed:35096974" MUTAGEN /note="M->R: Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function." ECO:0000269|PubMed:35096974" MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="M->A: Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors." ECO:0000269|PubMed:35096974" MUTAGEN /note="M->R: Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function." ECO:0000269|PubMed:35096974" MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
59E e 96.0 7vph_I hetero RAE1L_HUMAN NUP98_HUMAN
E
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
60I e 81.9 7vph_I hetero RAE1L_HUMAN
LI
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." DISORDER predicted by DISOPRED MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."
61D e128.4 7vph_I hetero RAE1L_HUMAN
D
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." DISORDER predicted by DISOPRED MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell."