#WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/2080.bltA' #WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/2080.psiA'

[Summary Bars]

[Full Bars]


Site Table[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[Sites by Variants]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2080 221 0 P59596(VME1_SARS) RecName: Full=Membrane protein ; Short=M protein ;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ;
QUERYSEQ
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRM
AGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols feature table variant
1M---- TOPO_DOM /note="Virion surface"
2A---- TOPO_DOM /note="Virion surface"
3D---- TOPO_DOM /note="Virion surface"
4N---- TOPO_DOM /note="Virion surface"
5G---- TOPO_DOM /note="Virion surface"
6T---- TOPO_DOM /note="Virion surface"
7I---- TOPO_DOM /note="Virion surface"
8T---- TOPO_DOM /note="Virion surface"
9V---- TOPO_DOM /note="Virion surface"
10E---- TOPO_DOM /note="Virion surface"
11E---- TOPO_DOM /note="Virion surface"
12L---- TOPO_DOM /note="Virion surface"
13K---- TOPO_DOM /note="Virion surface"
14Q---- TOPO_DOM /note="Virion surface"
15L---- TOPO_DOM /note="Virion surface"
16L---- TOPO_DOM /note="Virion surface"
17E---- TOPO_DOM /note="Virion surface"
18Q---- TOPO_DOM /note="Virion surface"
19W---- TRANSMEM /note="Helical"
20N---- TRANSMEM /note="Helical"
21L---- TRANSMEM /note="Helical"
22V---- TRANSMEM /note="Helical"
23I---- TRANSMEM /note="Helical"
24G---- TRANSMEM /note="Helical"
25F---- TRANSMEM /note="Helical"
26L---- TRANSMEM /note="Helical"
27F---- TRANSMEM /note="Helical"
28L---- TRANSMEM /note="Helical"
29A---- TRANSMEM /note="Helical"
30W---- TRANSMEM /note="Helical"
31I---- TRANSMEM /note="Helical"
32M---- TRANSMEM /note="Helical"
33L---- TRANSMEM /note="Helical"
34L---- TRANSMEM /note="Helical"
35Q---- TRANSMEM /note="Helical"
36F---- TRANSMEM /note="Helical"
37A---- TRANSMEM /note="Helical"
38Y---- TRANSMEM /note="Helical"
39S---- TRANSMEM /note="Helical"
40N---- TOPO_DOM /note="Intravirion"
41R---- TOPO_DOM /note="Intravirion"
42N---- TOPO_DOM /note="Intravirion"
43R---- TOPO_DOM /note="Intravirion"
44F---- TOPO_DOM /note="Intravirion"
45L---- TOPO_DOM /note="Intravirion"
46Y---- TOPO_DOM /note="Intravirion"
47I---- TOPO_DOM /note="Intravirion"
48I---- TOPO_DOM /note="Intravirion"
49K---- TOPO_DOM /note="Intravirion"
50L---- TRANSMEM /note="Helical"
51V---- TRANSMEM /note="Helical"
52F---- TRANSMEM /note="Helical"
53L---- TRANSMEM /note="Helical"
54W---- TRANSMEM /note="Helical"
55L---- TRANSMEM /note="Helical"
56L---- TRANSMEM /note="Helical"
57W---- TRANSMEM /note="Helical"
58P---- TRANSMEM /note="Helical"
59V---- TRANSMEM /note="Helical"
60T---- TRANSMEM /note="Helical"
61L---- TRANSMEM /note="Helical"
62A---- TRANSMEM /note="Helical"
63C---- TRANSMEM /note="Helical"
64F---- TRANSMEM /note="Helical"
65V---- TRANSMEM /note="Helical"
66L---- TRANSMEM /note="Helical"
67A---- TRANSMEM /note="Helical"
68A---- TRANSMEM /note="Helical"
69V---- TRANSMEM /note="Helical"
70Y---- TRANSMEM /note="Helical"
71R---- TOPO_DOM /note="Virion surface"
72I---- TOPO_DOM /note="Virion surface"
73N---- TOPO_DOM /note="Virion surface"
74W---- TOPO_DOM /note="Virion surface"
75V---- TOPO_DOM /note="Virion surface"
76T---- TOPO_DOM /note="Virion surface"
77G---- TOPO_DOM /note="Virion surface"
78G---- TOPO_DOM /note="Virion surface"
79I---- TRANSMEM /note="Helical"
80A---- TRANSMEM /note="Helical"
81I---- TRANSMEM /note="Helical"
82A---- TRANSMEM /note="Helical"
83M---- TRANSMEM /note="Helical"
84A---- TRANSMEM /note="Helical"
85C---- TRANSMEM /note="Helical"
86I---- TRANSMEM /note="Helical"
87V---- TRANSMEM /note="Helical"
88G---- TRANSMEM /note="Helical"
89L---- TRANSMEM /note="Helical"
90M---- TRANSMEM /note="Helical"
91W---- TRANSMEM /note="Helical"
92L---- TRANSMEM /note="Helical"
93S---- TRANSMEM /note="Helical"
94Y---- TRANSMEM /note="Helical"
95F---- TRANSMEM /note="Helical"
96V---- TRANSMEM /note="Helical"
97A---- TRANSMEM /note="Helical"
98S---- TRANSMEM /note="Helical"
99F---- TRANSMEM /note="Helical"
100R---- TOPO_DOM /note="Intravirion"
101L---- TOPO_DOM /note="Intravirion"
102F---- TOPO_DOM /note="Intravirion"
103A---- TOPO_DOM /note="Intravirion"
104R---- TOPO_DOM /note="Intravirion"
105T---- TOPO_DOM /note="Intravirion"
106R---- TOPO_DOM /note="Intravirion"
107S---- TOPO_DOM /note="Intravirion"
108M---- TOPO_DOM /note="Intravirion"
109W---- TOPO_DOM /note="Intravirion"
110S---- TOPO_DOM /note="Intravirion"
111F---- TOPO_DOM /note="Intravirion"
112N---- TOPO_DOM /note="Intravirion"
113P---- TOPO_DOM /note="Intravirion"
114E---- TOPO_DOM /note="Intravirion"
115T---- TOPO_DOM /note="Intravirion"
116N---- TOPO_DOM /note="Intravirion"
117I---- TOPO_DOM /note="Intravirion"
118L---- TOPO_DOM /note="Intravirion"
119L---- TOPO_DOM /note="Intravirion"
120N---- TOPO_DOM /note="Intravirion"
121V---- TOPO_DOM /note="Intravirion"
122P---- TOPO_DOM /note="Intravirion"
123L---- TOPO_DOM /note="Intravirion"
124R---- TOPO_DOM /note="Intravirion"
125G---- TOPO_DOM /note="Intravirion"
126T---- TOPO_DOM /note="Intravirion"
127I---- TOPO_DOM /note="Intravirion"
128V---- TOPO_DOM /note="Intravirion"
129T---- TOPO_DOM /note="Intravirion"
130R---- TOPO_DOM /note="Intravirion"
131P---- TOPO_DOM /note="Intravirion"
132L---- TOPO_DOM /note="Intravirion"
133M---- TOPO_DOM /note="Intravirion"
134E---- TOPO_DOM /note="Intravirion"
135S---- TOPO_DOM /note="Intravirion"
136E---- TOPO_DOM /note="Intravirion"
137L---- TOPO_DOM /note="Intravirion"
138V---- TOPO_DOM /note="Intravirion"
139I---- TOPO_DOM /note="Intravirion"
140G---- TOPO_DOM /note="Intravirion"
141A---- TOPO_DOM /note="Intravirion"
142V---- TOPO_DOM /note="Intravirion"
143I---- TOPO_DOM /note="Intravirion"
144I---- TOPO_DOM /note="Intravirion"
145R---- TOPO_DOM /note="Intravirion"
146G---- TOPO_DOM /note="Intravirion"
147H---- TOPO_DOM /note="Intravirion"
148L---- TOPO_DOM /note="Intravirion"
149R---- TOPO_DOM /note="Intravirion"
150M---- TOPO_DOM /note="Intravirion"
151A---- TOPO_DOM /note="Intravirion"
152G---- TOPO_DOM /note="Intravirion"
153H---- TOPO_DOM /note="Intravirion"
154S---- TOPO_DOM /note="Intravirion"
155L---- TOPO_DOM /note="Intravirion"
156G---- TOPO_DOM /note="Intravirion"
157R---- TOPO_DOM /note="Intravirion"
158C---- TOPO_DOM /note="Intravirion"
159D---- TOPO_DOM /note="Intravirion"
160I---- TOPO_DOM /note="Intravirion"
161K---- TOPO_DOM /note="Intravirion"
162D---- TOPO_DOM /note="Intravirion"
163L---- TOPO_DOM /note="Intravirion"
164P---- TOPO_DOM /note="Intravirion"
165K---- TOPO_DOM /note="Intravirion"
166E---- TOPO_DOM /note="Intravirion"
167I---- TOPO_DOM /note="Intravirion"
168T---- TOPO_DOM /note="Intravirion"
169V---- TOPO_DOM /note="Intravirion"
170A---- TOPO_DOM /note="Intravirion"
171T---- TOPO_DOM /note="Intravirion"
172S---- TOPO_DOM /note="Intravirion"
173R---- TOPO_DOM /note="Intravirion"
174T---- TOPO_DOM /note="Intravirion"
175L---- TOPO_DOM /note="Intravirion"
176S---- TOPO_DOM /note="Intravirion"
177Y---- TOPO_DOM /note="Intravirion"
178Y---- TOPO_DOM /note="Intravirion"
179K---- TOPO_DOM /note="Intravirion"
180L---- TOPO_DOM /note="Intravirion"
181G---- TOPO_DOM /note="Intravirion"
182A---- TOPO_DOM /note="Intravirion"
183S---- TOPO_DOM /note="Intravirion"
184Q---- TOPO_DOM /note="Intravirion"
185R---- TOPO_DOM /note="Intravirion"
186V---- TOPO_DOM /note="Intravirion"
187G---- TOPO_DOM /note="Intravirion"
188T---- TOPO_DOM /note="Intravirion"
189D---- TOPO_DOM /note="Intravirion"
190S---- TOPO_DOM /note="Intravirion"
191G---- TOPO_DOM /note="Intravirion"
192F---- TOPO_DOM /note="Intravirion"
193A---- TOPO_DOM /note="Intravirion"
194A---- TOPO_DOM /note="Intravirion"
195Y---- TOPO_DOM /note="Intravirion"
196N---- TOPO_DOM /note="Intravirion"
197R---- TOPO_DOM /note="Intravirion"
198Y---- TOPO_DOM /note="Intravirion"
199R---- TOPO_DOM /note="Intravirion"
200I---- TOPO_DOM /note="Intravirion"
201G---- TOPO_DOM /note="Intravirion"
202N---- TOPO_DOM /note="Intravirion"
203Y---- TOPO_DOM /note="Intravirion"
204K---- TOPO_DOM /note="Intravirion"
205L---- TOPO_DOM /note="Intravirion"
206N---- TOPO_DOM /note="Intravirion"
207T---- TOPO_DOM /note="Intravirion"
208D---- TOPO_DOM /note="Intravirion"
209H---- TOPO_DOM /note="Intravirion"
210A---- TOPO_DOM /note="Intravirion"
211G---- TOPO_DOM /note="Intravirion"
212S---- TOPO_DOM /note="Intravirion"
213N---- TOPO_DOM /note="Intravirion"
214D---- TOPO_DOM /note="Intravirion"
215N---- TOPO_DOM /note="Intravirion"
216I---- TOPO_DOM /note="Intravirion"
217A---- TOPO_DOM /note="Intravirion"
218L---- TOPO_DOM /note="Intravirion"
219L---- TOPO_DOM /note="Intravirion"
220V---- TOPO_DOM /note="Intravirion"
221Q---- TOPO_DOM /note="Intravirion"