Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
7920 | 419 | 269 | P0DTC9(NCAP_SARS2) | RecName: Full=Nucleoprotein ; Short=N;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ; |
QUERYSEQ |
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA |
All | ||
Number of sites | 419 | |
Buired or Exposed | Buried | 40.3 (%) [169] |
Exposed | 59.7 (%) [250] | |
Ave relacc | 33.9 % | |
SD relacc | 27.55 % | |
Contact Mol | hetero | 27.7 (%) [116] |
nucleotide | 9.1 (%) [38] | |
compound | 13.1 (%) [55] | |
metal | 15.0 (%) [63] | |
otherpoly | 0.0 (%) [0] | |
homo | 51.1 (%) [214] | |
precipitant | 32.7 (%) [137] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |