Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
30831 | 313 | 27 | O43765(SGTA_HUMAN) | RecName: Full=Small glutamine-rich tetratricopeptide repeat-containing protein alpha;AltName: Full=Alpha-SGT;AltName: Full=Vpu-binding protein; Short=UBP; |
QUERYSEQ |
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCER AICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR SRTPSASNDDQQE |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | e | 98.1 | 4cpg_B | M |
DISORDER predicted by DISOPRED | |||
2 | D | e | 70.4 | 4cpg_B | SDE |
DISORDER predicted by DISOPRED | |||
3 | N | H | e | 55.2 | 4cpg_B | homo | NSQ |
DISORDER predicted by DISOPRED | |
4 | K | H | e | 55.7 | 4cpg_B | homo | KQVR |
DISORDER predicted by DISOPRED | |
5 | K | H | e | 31.1 | 4cpg_B | KEQT |
|||
6 | R | H | e | 39.9 | 4cpg_B | RKPE |
|||
7 | L | H | e | 37.6 | 4cpg_B | homo precipitant | LIV |
||
8 | A | H | b | 0.0 | 4cpg_B | ATV |
|||
9 | Y | H | b | 3.5 | 4cpg_B | YALV |
|||
10 | A | H | b | 8.0 | 4cpg_B | precipitant | ALS |
||
11 | I | H | e | 21.6 | 4cpg_B | homo precipitant | IV |
||
12 | I | H | b | 4.7 | 4cpg_B | ILVA |
|||
13 | Q | H | e | 33.2 | 4cpg_B | precipitant | NQDR |
||
14 | F | H | e | 34.0 | 4cpg_B | homo precipitant | FYW |
||
15 | L | H | b | 14.0 | 4cpg_B | homo | LF |
||
16 | H | H | e | 41.9 | 4cpg_B | metal CL | KHSNRADEFGILPQTV |
||
17 | D | H | e | 61.7 | 4cpg_B | precipitant | SVDQEGAFIKLNPRT |
||
18 | Q | H | e | 21.4 | 4cpg_B | homo | QSIA |
||
19 | L | H | b | 8.4 | 4cpg_B | LMVQIS |
|||
20 | R | H | e | 82.2 | 4cpg_B | metal CL | RSKETQ |
||
21 | H | H | e | 87.4 | 4cpg_B | DHRESKTM |
|||
22 | G | T | e | 34.5 | 4cpg_B | homo | GKATDEILPSV |
||
23 | G | e | 52.4 | 4cpg_B | GSETADIKLPV |
||||
24 | L | S | e | 52.2 | 4cpg_B | homo | ILNVYADEGKPST |
||
25 | S | e | 69.5 | 4cpg_B | STADP |
||||
26 | S | H | e | 60.9 | 4cpg_B | ASEHF |
|||
27 | D | H | e | 77.2 | 4cpg_B | homo | DEAQ |
||
28 | A | H | e | 29.5 | 4cpg_B | homo | KEADNQG |
||
29 | Q | H | e | 25.5 | 4cpg_B | AQK |
|||
30 | E | H | e | 51.8 | 4cpg_B | EGNAD |
|||
31 | S | H | e | 54.7 | 4cpg_B | homo precipitant | SRDK |
||
32 | L | H | b | 17.4 | 4cpg_B | homo | LYI |
||
33 | E | H | e | 35.7 | 4cpg_B | ESQN |
|||
34 | V | H | e | 76.0 | 4cpg_B | homo precipitant | VQLI |
||
35 | A | H | e | 25.9 | 4cpg_B | homo | A |
||
36 | I | H | b | 9.4 | 4cpg_B | VIAQM |
|||
37 | Q | H | e | 56.6 | 4cpg_B | precipitant | QMSEKD |
||
38 | C | H | e | 41.3 | 4cpg_B | homo precipitant | CLWS |
MUTAGEN /note="C->A: Reduces tail-anchored proteins transfer." MUTAGEN /note="C->A: Reduces tail-anchored proteins transfer." | |
39 | L | H | e | 36.5 | 4cpg_B | homo | LIFV |
||
40 | E | H | e | 35.7 | 4cpg_B | ESHARQ |
|||
41 | T | H | e | 89.0 | 4cpg_B | homo precipitant | DTEQR |
||
42 | A | H | e | 60.7 | 4cpg_B | homo | AVST |
||
43 | F | T | e | 33.0 | 4cpg_B | homo | FYL |
||
44 | G | T | e | 58.3 | 4cpg_B | GKDAEFILNPQRSTV |
|||
45 | V | b | 0.7 | 4cpg_B | VIAFDEGKLPRST |
||||
46 | T | e | 43.5 | 4cpg_B | DETKSAGILPRV |
||||
47 | V | T | e | 92.7 | 4cpg_B | PLAERVTDGIKS |
|||
48 | E | H | e | 60.8 | 4cpg_B | ESFDKNAGLTV |
|||
49 | D | H | b | 0.6 | 4cpg_B | DNSAGLVEFHIKMPQRTY |
|||
50 | S | H | e | 36.7 | 4cpg_B | SVKYATDEFGILNPQR |
|||
51 | D | H | e | 91.4 | 4cpg_B | DETHAFGIKLNPQRSV |
|||
52 | L | T | e | 42.7 | 4cpg_B | precipitant | LVAIFQDEGKNPRST |
||
53 | A | e | 46.4 | 4cpg_B | precipitant | AQVLR |
|||
54 | L | e | 40.4 | 4cpg_B | homo precipitant | VLEGIDMA |
|||
55 | P | S | e | 98.4 | 4cpg_B | PSHGQADEIKLNRTV |
|||
56 | Q | S | e | 52.6 | 4cpg_B | EQDALTG |
|||
57 | T | e | 39.6 | 4cpg_B | TSGPIKNDAL |
||||
58 | L | H | b | 5.6 | 4cpg_B | homo | LEIKV |
||
59 | P | H | b | 6.2 | 4cpg_B | PAKSFGT |
|||
60 | E | H | e | 43.2 | 4cpg_B | EKRYDSNL |
|||
61 | I | H | e | 44.4 | 4cpg_B | homo | IVLNFTMADEGKPQRS |
||
62 | F | H | e | 25.8 | 4cpg_B | homo | FNKLWGADEIPQRSTVY |
||
63 | E | H | e | 64.3 | 4cpg_B | homo | ESTDALQHGKVCFIMNPRY |
||
64 | A | H | e | 58.9 | 4cpg_B | APGKVSLDEFHIMNQRTY |
|||
65 | A | H | e | 31.2 | 4cpg_B | AETQVFYGLSDHIKMNPR |
|||
66 | A | T | e | 72.3 | 4cpg_B | homo | EAVKNSILQPFRTGDY |
REGION /note="Disordered" REGION /note="Disordered" | |
67 | T | T | e | 94.2 | 4cpg_B | homo | ATRKSENHVGLDFIPQY |
REGION /note="Disordered" REGION /note="Disordered" | |
68 | G | e | 54.8 | 4cpg_B | GALKREYNSDFIPQTV |
REGION /note="Disordered" REGION /note="Disordered" | |||
69 | K | e | 106.1 | 4cpg_B | homo | KRTDSFAHQEGILNPVY |
REGION /note="Disordered" REGION /note="Disordered" | ||
70 | E | - | - | - | - | ERKSQHVAGLT |
REGION /note="Disordered" REGION /note="Disordered" | ||
71 | M | - | - | - | - | LITEKMNSCAGV |
REGION /note="Disordered" REGION /note="Disordered" | ||
72 | P | - | - | - | - | PESLKADV |
REGION /note="Disordered" REGION /note="Disordered" | ||
73 | Q | - | - | - | - | QEDKSYAGNP |
REGION /note="Disordered" REGION /note="Disordered" | ||
74 | D | - | - | - | - | DAEQGTIKPRLNSV |
REGION /note="Disordered" REGION /note="Disordered" | ||
75 | L | - | - | - | - | LETMDYGQAFRIPKNSV |
REGION /note="Disordered" REGION /note="Disordered" | ||
76 | R | - | - | - | - | RKALPEGTSFNVY |
REGION /note="Disordered" REGION /note="Disordered" | ||
77 | S | - | - | - | - | SEDALRCTPG |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:23186163" REGION /note="Disordered" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:23186163" REGION /note="Disordered" | ||
78 | P | - | - | - | - | PLAEKQRSTVY |
REGION /note="Disordered" REGION /note="Disordered" | ||
79 | A | - | - | - | - | AESDNGTKVFRQL |
REGION /note="Disordered" REGION /note="Disordered" | ||
80 | R | - | - | - | - | RNKDGSYAEQHFILPTV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
81 | T | - | - | - | - | ATSLVQGCPENRDK |
MOD_RES /note="Phosphothreonine" ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="Phosphothreonine" ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
82 | P | - | - | - | - | PEVTASCKMHGYL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
83 | P | - | - | - | - | PDRAKSVLEFGTYINQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
84 | S | - | - | - | - | STAEKNQRGIMVDLP |
MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
85 | E | - | - | - | - | EDKVAHQNSRGIPYL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
86 | E | e | 87.4 | 2vyi_A | EADGKVPIQTFLS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | |||
87 | D | H | e | 62.3 | 2vyi_A | DNEKRVCPAGLT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
88 | S | H | b | 16.4 | 2vyi_A | SAKELRVFPDTGIQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
89 | A | H | b | 19.6 | 2vyi_A | AEKSTQVCDHPGLRF |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
90 | E | H | e | 39.2 | 2vyi_A | EKQLDRYNSAMT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
91 | A | H | b | 0.0 | 2vyi_A | ASVPKLFGEIM |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
92 | E | H | e | 20.6 | 2vyi_A | precipitant | ELQKDSANRTVPFGI |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | |
93 | R | H | e | 55.7 | 2vyi_A | ERQAKVTDNSLWGHIM |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
94 | L | H | b | 16.3 | 2vyi_A | LYEAFIKMVWHQSCRT |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
95 | K | H | b | 15.1 | 2vyi_A | hetero HS904_ARATH precipitant | KYRAELFNTVH |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | |
96 | T | H | e | 38.3 | 2vyi_A | ENADLQSHKRTGMV |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
97 | E | H | e | 38.7 | 2vyi_A | KEQLRIADSFMT |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
98 | G | H | b | 0.0 | 2vyi_A | GAKS |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
99 | N | H | e | 28.5 | 2vyi_A | hetero HS904_ARATH | NTVRASHIKLM |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | |
100 | E | H | e | 42.7 | 2vyi_A | EKASDQTRNVLCWFH |
COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REPEAT /note="TPR 1" REGION /note="Disordered" | ||
101 | Q | H | b | 16.3 | 2vyi_A | ALYQFHCKMERS |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
102 | M | H | b | 18.8 | 2vyi_A | hetero HS904_ARATH | FLMVYEGKDSACI |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
103 | K | H | e | 74.5 | 2vyi_A | KRAQSGLVENTHIY |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
104 | V | T | e | 68.7 | 2vyi_A | KSAEQDLINVRGCMTH |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
105 | E | T | e | 70.9 | 2vyi_A | homo precipitant | GKQERDNHMST |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
106 | N | e | 40.6 | 2vyi_A | metal ZN precipitant | DNKQRELCHSVY |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
107 | F | H | b | 12.4 | 2vyi_A | precipitant | YFWLPVHIQT |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
108 | E | H | e | 59.3 | 2vyi_A | precipitant | EDQKNASPTGLRHVIM |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
109 | A | H | b | 19.6 | 2vyi_A | precipitant | EAKQLDGMTVNRSI |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
110 | A | H | b | 0.0 | 2vyi_A | AGS |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
111 | V | H | b | 16.7 | 2vyi_A | IVLAYMEKRSTFQ |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
112 | H | H | e | 50.3 | 2vyi_A | EKDLNQAHRSTFMIPVYG |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
113 | F | H | e | 23.0 | 2vyi_A | metal ZN | CLYAKHSFEMRDIV |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
114 | Y | H | b | 1.3 | 2vyi_A | hetero HS904_ARATH | YFLW |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
115 | G | H | b | 14.3 | 2vyi_A | precipitant | TSGNDQELAIYR |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
116 | K | H | e | 33.0 | 2vyi_A | metal ZN | KERQDLWHTVY |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
117 | A | H | b | 0.0 | 2vyi_A | AGVSCL |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
118 | I | H | b | 9.4 | 2vyi_A | precipitant | ILVAMKR |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |
119 | E | H | e | 67.3 | 2vyi_A | EKSQRDLTANGHYIMV |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
120 | L | H | e | 30.9 | 2vyi_A | LIARKCEMQTVYDFNS |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
121 | N | b | 14.5 | 2vyi_A | DNKLSQACRTEGHY |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | |||
122 | P | T | e | 41.9 | 2vyi_A | PKSGACENRDHLT |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
123 | A | T | e | 66.1 | 2vyi_A | NTKADEILRHQYCSVFGMP |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
124 | N | e | 24.2 | 2vyi_A | precipitant | NDYFERSVAKLTIQCGM |
REPEAT /note="TPR 1" REPEAT /note="TPR 1" | ||
125 | A | H | b | 5.4 | 2vyi_A | APHVSLYCFEGIKT |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
126 | V | H | e | 28.0 | 2vyi_A | hetero HS904_ARATH homo precipitant | VIAESTLPDMQRKNGY |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
127 | Y | H | b | 0.0 | 2vyi_A | precipitant | LAYFCITVGSEMNP |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
128 | F | H | b | 1.0 | 2vyi_A | precipitant | YFHLWIPRV |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
129 | C | H | b | 0.0 | 2vyi_A | SCATGNLVYEQRFIM |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
130 | N | H | b | 6.1 | 2vyi_A | hetero HS904_ARATH | NKCGSADFMQRT |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
131 | R | H | b | 15.8 | 2vyi_A | precipitant | RLICKMV |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
132 | A | H | b | 0.9 | 2vyi_A | AGS |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
133 | A | H | b | 14.3 | 2vyi_A | hetero HS904_ARATH | AQVSLGNTYEFMCW |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
134 | A | H | b | 0.0 | 2vyi_A | ACVILSTF |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
135 | Y | H | e | 20.9 | 2vyi_A | YHLFQREKGNW |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
136 | S | H | b | 19.5 | 2vyi_A | hetero HS904_ARATH compound IPT homo precipitant | LIMASYEFTNVKQDR |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
137 | K | H | e | 67.0 | 2vyi_A | hetero homo precipitant | KQESALNRTFVYHM |
MOD_RES /note="N6-acetyllysine" REPEAT /note="TPR 2" MOD_RES /note="N6-acetyllysine" REPEAT /note="TPR 2" | |
138 | L | T | e | 40.4 | 2vyi_A | precipitant | LQMIKRSTVYE |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
139 | G | T | e | 46.4 | 2vyi_A | metal NI homo precipitant | GKEQSNCDMRAHILV |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
140 | N | e | 41.8 | 2vyi_A | precipitant | NQEKDRHSYCAGLM |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
141 | Y | H | e | 31.7 | 2vyi_A | homo precipitant | YFLWHPKVISDMN |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
142 | A | H | e | 56.2 | 2vyi_A | precipitant | EDAQNRSGTFHKPLCIVWY |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
143 | G | H | b | 15.5 | 2vyi_A | precipitant | KEDSAQLGNVMRTWY |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
144 | A | H | b | 0.0 | 2vyi_A | AVSGTCI |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
145 | V | H | b | 13.3 | 2vyi_A | LIVAEKFY |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
146 | Q | H | e | 69.4 | 2vyi_A | QESDANKRHTGVL |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
147 | D | H | b | 2.5 | 2vyi_A | DSCEAHMNYFL |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
148 | C | H | b | 0.0 | 2vyi_A | CAYFGLSVIT |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
149 | E | H | e | 51.3 | 2vyi_A | ETDNKSLQRMCI |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
150 | R | H | e | 49.0 | 2vyi_A | KRELQAIVMNSTW |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
151 | A | H | b | 0.0 | 2vyi_A | ACSTVGI |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
152 | I | H | b | 9.9 | 2vyi_A | LIVCTARYKMS |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
153 | C | H | e | 71.3 | 2vyi_A | EKRSTADHLQGIVCF |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
154 | I | H | e | 37.4 | 2vyi_A | LIVMYACEFRKNS |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
155 | D | e | 40.1 | 2vyi_A | metal ZN homo | DNKREQSTGACPV |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
156 | P | T | e | 59.7 | 2vyi_A | PSKGADNREH |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
157 | A | T | e | 59.8 | 2vyi_A | homo | NDTSKGAMYIRCEFHLQ |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | |
158 | Y | b | 12.6 | 2vyi_A | hetero homo | YNFWSHDRLIACEGM |
REPEAT /note="TPR 2" REPEAT /note="TPR 2" | ||
159 | S | H | e | 22.7 | 2vyi_A | hetero HS904_ARATH homo | SVAITGLPNEFMRWCHKY |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
160 | K | H | e | 33.5 | 2vyi_A | hetero HS904_ARATH homo precipitant | KERLQDINTA |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
161 | A | H | b | 0.0 | 2vyi_A | AGVSYPCFT |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
162 | Y | H | b | 10.9 | 2vyi_A | YLHWKRFIEM |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
163 | G | H | b | 0.0 | 2vyi_A | hetero HS904_ARATH precipitant | YLFKNSIARCGQTVEHW |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
164 | R | H | e | 23.7 | 2vyi_A | hetero HS904_ARATH | RNKSADYFTHMVW |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
165 | M | H | b | 0.0 | 2vyi_A | RLKMEFGIYAQST |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
166 | G | H | b | 0.0 | 2vyi_A | GACST |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
167 | L | H | e | 33.1 | 2vyi_A | hetero HS904_ARATH compound IPT precipitant | QATKILRNVEFDGMSYCH |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
168 | A | H | b | 0.0 | 2vyi_A | ACLSTINGQV |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
169 | L | H | b | 1.7 | 2vyi_A | LYHQRFNCEKWA |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
170 | S | H | b | 10.2 | 2vyi_A | hetero compound IPT precipitant | ELAKFYQMRSTCIVDGHN |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
171 | S | H | e | 43.0 | 2vyi_A | compound IPT homo precipitant | AEKSQGDHLMNTFRY |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
172 | L | T | e | 36.0 | 2vyi_A | precipitant | LMQEICRASTKV |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
173 | N | T | e | 73.9 | 2vyi_A | GKNEDHRQSTACFV |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
174 | K | e | 54.2 | 2vyi_A | precipitant | KRDENQHLTIMSY |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
175 | H | H | b | 10.5 | 2vyi_A | precipitant | YFLHWIKVAQCNPS |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
176 | V | H | e | 67.3 | 2vyi_A | precipitant | EDKAQVSRTLNFGIMWY |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
177 | E | H | e | 44.7 | 2vyi_A | precipitant | EDKQSALNTVGWFIMR |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
178 | A | H | b | 0.0 | 2vyi_A | ASGCLEN |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
179 | V | H | b | 8.0 | 2vyi_A | LVIAKEMFTRWCQSY |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
180 | A | H | e | 50.9 | 2vyi_A | AEKRQDNSGPTCHL |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
181 | Y | H | e | 24.8 | 2vyi_A | DATYCSEHVMNWI |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
182 | Y | H | b | 0.0 | 2vyi_A | hetero | YFLVCAINHS |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
183 | K | H | e | 53.8 | 2vyi_A | EQKLRTNSADIVYCH |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
184 | K | H | e | 33.5 | 2vyi_A | KREAQSVYLDFIMHNT |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
185 | A | H | b | 0.0 | 2vyi_A | AGVCLISERT |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
186 | L | H | b | 16.3 | 2vyi_A | LVAQICSNYEFKMRT |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
187 | E | H | e | 65.8 | 2vyi_A | EKQDSATVRHNFGI |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
188 | L | H | e | 34.3 | 2vyi_A | LIVKAFHMTYCEQ |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
189 | D | S | e | 28.4 | 2vyi_A | hetero HS904_ARATH metal ZN homo precipitant | DENSQAHLPVCKRT |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
190 | P | T | e | 62.8 | 2vyi_A | PGAYSVFHW |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
191 | D | T | e | 86.4 | 2vyi_A | metal ZN homo | NDKESTHQRAGYL |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | |
192 | N | e | 21.2 | 2vyi_A | hetero HS904_ARATH homo precipitant | NDESFHALYV |
REPEAT /note="TPR 3" REPEAT /note="TPR 3" | ||
193 | E | H | e | 54.3 | 2vyi_A | homo precipitant | EKADQPRLTSFGVY |
||
194 | T | H | e | 50.0 | 2vyi_A | hetero HS904_ARATH precipitant | TVAENDQSILHGKMR |
||
195 | Y | H | b | 7.8 | 2vyi_A | AFLIYVHMW |
|||
196 | K | H | e | 38.7 | 2vyi_A | KQRELASHMDGNTW |
|||
197 | S | H | e | 43.0 | 2vyi_A | ENSQKTARLDCGVY |
|||
198 | N | H | e | 24.2 | 2vyi_A | compound IPT precipitant | NGESDAKTMWQRLY |
||
199 | L | H | b | 8.4 | 2vyi_A | LIMAKRVCF |
|||
200 | K | H | e | 57.5 | 2vyi_A | KRAEQSFLDGNVIT |
|||
201 | I | H | e | 42.1 | 2vyi_A | IVLEKNRADHTMWPQS |
|||
202 | A | H | b | 0.0 | 2vyi_A | AVCEILMSDQKT |
|||
203 | E | H | e | 33.7 | 2vyi_A | EQKDNTASLRVGH |
|||
204 | L | H | e | 69.7 | 2vyi_A | hetero | LIRKAQVDEMFHNY |
||
205 | K | H | e | 43.4 | 2vyi_A | homo precipitant | KREAQSLYND |
||
206 | L | H | e | 33.1 | 2vyi_A | LIAFKENMYQTVR |
|||
207 | R | T | e | 88.9 | 2vyi_A | homo | KREQASNPTYDV |
||
208 | E | T | e | 75.4 | 2vyi_A | homo precipitant | EKQSHADGNVR |
||
209 | A | e | 52.7 | 2vyi_A | ASCDKPTVEFGILNQR |
||||
210 | P | e | 155.8 | 2vyi_A | PKSAHVGILTNQDEFRY |
||||
211 | S | e | 50.0 | 5jjt_B | SPDNREKAFGILQTVY |
||||
212 | P | - | - | - | - | PDEQIKLAGTSVCFHMNRY |
|||
213 | T | - | - | - | - | TAESLWIRFGPQDKNVY |
|||
214 | G | - | - | - | - | GSKQDAEPFILNRTV |
|||
215 | G | - | - | - | - | GAFDNTLKRSEIPQV |
|||
216 | V | - | - | - | - | AMKVDLTGYIFENPQRS |
|||
217 | G | - | - | - | - | GANQSKPLT |
|||
218 | S | - | - | - | - | DSRPAGMNQILEKTV |
|||
219 | F | - | - | - | - | FLPEVMCYGAS |
|||
220 | D | - | - | - | - | DESKNAQMVGL |
|||
221 | I | - | - | - | - | LMTIGVAFSD |
|||
222 | A | - | - | - | - | ASPGQRT |
|||
223 | G | - | - | - | - | SGKNAQEPD |
|||
224 | L | - | - | - | - | LIYMQFD |
|||
225 | L | - | - | - | - | LIMSNYAF |
|||
226 | N | - | - | - | - | SNRQEDK |
|||
227 | N | - | - | - | - | NDQKSH |
|||
228 | P | - | - | - | - | PLDE |
|||
229 | G | - | - | - | - | GDAEMKRSNQVH |
|||
230 | F | - | - | - | - | FVIMNPLAKS |
|||
231 | M | - | - | - | - | MVIRQAEDLN |
|||
232 | S | - | - | - | - | NEQPSDTAGMIK |
|||
233 | M | - | - | - | - | MIKVARLN |
|||
234 | A | - | - | - | - | AMLTKSYIQ |
|||
235 | S | - | - | - | - | NQRSEDAKV |
|||
236 | N | - | - | - | - | NKEQGRDTS |
|||
237 | L | - | - | - | - | LAIMF |
|||
238 | M | - | - | - | - | MQSPGLAN |
|||
239 | N | - | - | - | - | NKSQAETR |
|||
240 | N | - | - | - | - | NDS |
|||
241 | P | - | - | - | - | P |
|||
242 | Q | - | - | - | - | EQSVMKTNRAGL |
|||
243 | I | - | - | - | - | ILVYMATDEGKPS |
|||
244 | Q | - | - | - | - | QRALMHK |
|||
245 | Q | - | - | - | - | QENS |
|||
246 | L | - | - | - | - | LMIPKA |
|||
247 | M | - | - | - | - | MALITV |
|||
248 | S | - | - | - | - | ESALQTDNR |
|||
249 | G | - | - | - | - | QGKNDTR |
|||
250 | M | - | - | - | - | LFMPI |
REGION /note="Disordered" REGION /note="Disordered" | ||
251 | I | - | - | - | - | IAGNKQMDEFLPRSTV |
REGION /note="Disordered" REGION /note="Disordered" | ||
252 | S | - | - | - | - | SDAGRTEFIKLNPQVY |
REGION /note="Disordered" REGION /note="Disordered" | ||
253 | G | - | - | - | - | GQSILYADEFKNPRTV |
REGION /note="Disordered" REGION /note="Disordered" | ||
254 | G | - | - | - | - | GRLNK |
REGION /note="Disordered" REGION /note="Disordered" | ||
255 | N | - | - | - | - | NGSVHQLADEIKPRTCFMY |
REGION /note="Disordered" REGION /note="Disordered" | ||
256 | N | - | - | - | - | NKMIADEGLPQRSTV |
REGION /note="Disordered" REGION /note="Disordered" | ||
257 | P | - | - | - | - | PRADEGIKLNQSTV |
REGION /note="Disordered" REGION /note="Disordered" | ||
258 | L | - | - | - | - | LMIADEFGKNPQRSTVY |
REGION /note="Disordered" REGION /note="Disordered" | ||
259 | G | - | - | - | - | GNS |
REGION /note="Disordered" REGION /note="Disordered" | ||
260 | T | - | - | - | - | TISMG |
REGION /note="Disordered" REGION /note="Disordered" | ||
261 | P | - | - | - | - | PKRL |
REGION /note="Disordered" REGION /note="Disordered" | ||
262 | G | - | - | - | - | ILAGND |
REGION /note="Disordered" REGION /note="Disordered" | ||
263 | T | - | - | - | - | QSLNTMA |
REGION /note="Disordered" REGION /note="Disordered" | ||
264 | S | - | - | - | - | SDANG |
REGION /note="Disordered" REGION /note="Disordered" | ||
265 | P | - | - | - | - | PQDSV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
266 | S | - | - | - | - | SQLMG |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
267 | Q | - | - | - | - | MLAQH |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
268 | N | - | - | - | - | NQTS |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
269 | D | - | - | - | - | DNA |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
270 | L | - | - | - | - | LPT |
DISORDER predicted by DISOPRED | ||
271 | A | - | - | - | - | AS |
DISORDER predicted by DISOPRED | ||
272 | S | - | - | - | - | SL |
DISORDER predicted by DISOPRED | ||
273 | L | - | - | - | - | LMR |
DISORDER predicted by DISOPRED | ||
274 | I | - | - | - | - | IVN |
DISORDER predicted by DISOPRED | ||
275 | Q | - | - | - | - | QM |
DISORDER predicted by DISOPRED | ||
276 | A | - | - | - | - | AQ |
DISORDER predicted by DISOPRED | ||
277 | G | - | - | - | - | GLADEKPSTVCFHIMNQRY |
|||
278 | Q | - | - | - | - | QN |
|||
279 | Q | - | - | - | - | QHL |
|||
280 | F | - | - | - | - | FP |
|||
281 | A | - | - | - | - | A |
|||
282 | Q | - | - | - | - | Q |
|||
283 | Q | - | - | - | - | Q |
|||
284 | M | - | - | - | - | MI |
|||
285 | Q | - | - | - | - | Q |
|||
286 | Q | - | - | - | - | Q |
|||
287 | Q | - | - | - | - | Q |
|||
288 | N | - | - | - | - | N |
|||
289 | P | - | - | - | - | P |
|||
290 | E | - | - | - | - | E |
|||
291 | L | - | - | - | - | LF |
|||
292 | I | - | - | - | - | IV |
|||
293 | E | - | - | - | - | E |
|||
294 | Q | - | - | - | - | Q |
|||
295 | L | - | - | - | - | LI |
|||
296 | R | - | - | - | - | R |
|||
297 | S | - | - | - | - | SN |
|||
298 | Q | - | - | - | - | QH |
DISORDER predicted by DISOPRED | ||
299 | I | - | - | - | - | IV |
DISORDER predicted by DISOPRED | ||
300 | R | - | - | - | - | R |
DISORDER predicted by DISOPRED | ||
301 | S | - | - | - | - | S |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" DISORDER predicted by DISOPRED | ||
302 | R | - | - | - | - | R |
DISORDER predicted by DISOPRED | ||
303 | T | - | - | - | - | TS |
MOD_RES /note="Phosphothreonine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:24275569" MOD_RES /note="Phosphothreonine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:24275569" DISORDER predicted by DISOPRED | ||
304 | P | - | - | - | - | PF |
DISORDER predicted by DISOPRED | ||
305 | S | - | - | - | - | S |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:24275569" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:24275569" DISORDER predicted by DISOPRED | ||
306 | A | - | - | - | - | AS |
DISORDER predicted by DISOPRED | ||
307 | S | - | - | - | - | S |
DISORDER predicted by DISOPRED | ||
308 | N | - | - | - | - | NAH |
DISORDER predicted by DISOPRED | ||
309 | D | - | - | - | - | DE |
DISORDER predicted by DISOPRED | ||
310 | D | - | - | - | - | ED |
DISORDER predicted by DISOPRED | ||
311 | Q | - | - | - | - | QH |
DISORDER predicted by DISOPRED | ||
312 | Q | - | - | - | - | Q |
DISORDER predicted by DISOPRED | ||
313 | E | - | - | - | - | E |
DISORDER predicted by DISOPRED |