Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
29161 | 61 | 6 | P0DTC6(NS6_SARS2) | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
QUERYSEQ |
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | - | - | - | - | M |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | F | - | - | - | - | F |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | H | - | - | - | - | H |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | V | - | - | - | - | V |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | D | - | - | - | - | D |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | F | - | - | - | - | F |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | Q | - | - | - | - | Q |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | V | - | - | - | - | V |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | T | - | - | - | - | T |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | I | - | - | - | - | I |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | A | - | - | - | - | A |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | E | - | - | - | - | E |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | I | - | - | - | - | I |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | L | - | - | - | - | IL |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | I | - | - | - | - | I |
|||
![]() | I | - | - | - | - | I |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." | ||
![]() | M | - | - | - | - | M |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." | ||
![]() | R | - | - | - | - | RK |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." | ||
![]() | T | - | - | - | - | T |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." | ||
![]() | F | - | - | - | - | F |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | K | - | - | - | - | RK |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | V | - | - | - | - | VI |
REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." REGION /note="Important for host Golgi localization" MUTAGEN /note="IMRTFKV->AAAAAAA: Complete loss of Golgi localization." MUTAGEN /note="Missing: Complete loss of Golgi localization." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | S | - | - | - | - | AS |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | I | - | - | - | - | I |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | W | - | - | - | - | W |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | N | - | - | - | - | N |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | D | - | - | - | - | D |
MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." MUTAGEN /note="Missing: Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell." | ||
![]() | Y | - | - | - | - | YIV |
|||
![]() | I | - | - | - | - | IL |
|||
![]() | I | - | - | - | - | I |
|||
![]() | N | - | - | - | - | SN |
|||
![]() | L | - | - | - | - | SL |
|||
![]() | I | - | - | - | - | I |
|||
![]() | I | - | - | - | - | VI |
|||
![]() | K | - | - | - | - | RK |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | N | - | - | - | - | QN |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | S | - | - | - | - | FS |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | K | - | - | - | - | K |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | S | - | - | - | - | PS |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | T | - | - | - | - | T |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | E | - | - | - | - | KE |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | N | - | - | - | - | KN |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | K | - | - | - | - | KN |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | Y | - | - | - | - | Y |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | S | - | - | - | - | S |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | Q | - | - | - | - | EQ |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | L | - | - | - | - | L |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | D | e | 126.5 | ![]() |
hetero RAE1L_HUMAN | D |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | E | e | 77.9 | ![]() |
hetero RAE1L_HUMAN | DE |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | E | e | 97.0 | ![]() |
hetero RAE1L_HUMAN | E |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | Q | e | 77.0 | ![]() |
hetero RAE1L_HUMAN | EQ |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | P | e | 92.2 | ![]() |
hetero RAE1L_HUMAN | P |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | M | e | 77.8 | ![]() |
hetero RAE1L_HUMAN | M |
MUTAGEN /note="M->A: Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors." ECO:0000269|PubMed:35096974" MUTAGEN /note="M->R: Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function." ECO:0000269|PubMed:35096974" MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="M->A: Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors." ECO:0000269|PubMed:35096974" MUTAGEN /note="M->R: Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function." ECO:0000269|PubMed:35096974" MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | E | e | 96.0 | ![]() |
hetero RAE1L_HUMAN NUP98_HUMAN | E |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | I | e | 81.9 | ![]() |
hetero RAE1L_HUMAN | LI |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." DISORDER predicted by DISOPRED MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." | ||
![]() | D | e | 128.4 | ![]() |
hetero RAE1L_HUMAN | D |
MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." DISORDER predicted by DISOPRED MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." MUTAGEN /note="Missing: Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell." |