[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[30 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
25525 98 20 P59636(ORF9B_SARS) RecName: Full=ORF9b protein;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b;
QUERYSEQ
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 98
Buired or ExposedBuried 13.3 (%) [13]
Exposed 86.7 (%) [85]
Ave relacc 51.2 %
SD relacc 27.28 %
Contact Molhetero 53.1 (%) [52]
nucleotide 0.0 (%) [0]
compound 11.2 (%) [11]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 44.9 (%) [44]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)