Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2634797 | 165 | 40 | P05161(ISG15_HUMAN) | RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor; |
QUERYSEQ |
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGGGTEPGGRS |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
INIT_MET /note="Removed" INIT_MET /note="Removed" DISORDER predicted by DISOPRED | ||
2 | G | E | e | 72.6 | 7rbs_B | hetero R1A_SARS2 | GAT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
3 | W | E | b | 11.2 | 7rbs_B | WMGI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
4 | D | E | e | 47.5 | 7rbs_B | DQ |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
5 | L | E | b | 0.0 | 7rbs_B | LVI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
6 | T | E | b | 13.0 | 7rbs_B | TFKY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
7 | V | E | b | 0.0 | 7rbs_B | VAI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
8 | K | E | e | 22.2 | 7rbs_B | hetero NS1_INBLE | KQER |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
9 | M | E | b | 16.4 | 7rbs_B | hetero NS1_INBLE metal OS4 | MTQAPE |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
10 | L | T | e | 70.2 | 7rbs_B | hetero NS1_INBLE | LWR |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
11 | A | T | e | 76.8 | 7rbs_B | hetero NS1_INBLE | GTQKA |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
12 | G | S | e | 52.4 | 7rbs_B | hetero NS1_INBLE metal OS4 | GHYER |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
13 | N | e | 52.1 | 7rbs_B | metal OS4 | KPNRQS |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
14 | E | E | e | 56.8 | 7rbs_B | EDT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
15 | F | E | b | 16.3 | 7rbs_B | IFCLA |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
16 | Q | E | e | 50.5 | 7rbs_B | NTLSIQA |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
17 | V | E | b | 0.7 | 7rbs_B | LVFI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
18 | S | E | e | 58.6 | 7rbs_B | hetero R1A_SARS2 | QWESIPD |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
19 | L | E | b | 5.6 | 7rbs_B | hetero R1A_SARS2 | VL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
20 | S | E | e | 39.1 | 7rbs_B | hetero R1A_SARS2 | NETSRAP |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
21 | S | T | e | 49.2 | 7rbs_B | hetero R1A_SARS2 | EPSDNT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
22 | S | T | e | 81.2 | 7rbs_B | hetero R1A_SARS2 | SYDGN |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
23 | M | e | 22.7 | 7rbs_B | hetero R1A_SARS2 | EDM |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
24 | S | b | 4.7 | 7rbs_B | TPSKLQ |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
25 | V | H | b | 2.0 | 7rbs_B | VIT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
26 | S | H | e | 50.0 | 7rbs_B | SKDRLEHQ |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
27 | E | H | e | 37.7 | 7rbs_B | hetero R1A_SARS2 | KENTAM |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
28 | L | H | b | 0.0 | 7rbs_B | LVI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
29 | K | H | e | 20.8 | 7rbs_B | compound SIN | K |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
30 | A | H | e | 46.4 | 7rbs_B | EAQKHR |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
31 | Q | H | e | 30.6 | 7rbs_B | hetero R1A_SARS2 | KLQHFV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
32 | I | H | b | 0.0 | 7rbs_B | IV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
33 | T | H | e | 27.9 | 7rbs_B | RQSAET |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
34 | Q | H | e | 79.6 | 7rbs_B | hetero K4LC41_9BETC | EQLDKRSN |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
35 | K | H | e | 64.2 | 7rbs_B | KSRT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
36 | I | H | e | 34.5 | 7rbs_B | hetero NS1_INBLE | ILREQT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
37 | G | e | 70.2 | 7rbs_B | hetero NS1_INBLE | GNK |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
38 | V | b | 6.7 | 7rbs_B | hetero NS1_INBLE | VYIE |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
39 | H | e | 42.9 | 7rbs_B | PSHL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
40 | A | G | b | 11.6 | 7rbs_B | compound SIN | AGVPIL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
41 | F | G | b | 17.7 | 7rbs_B | compound SIN | LFRDQSN |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
42 | Q | G | b | 5.6 | 7rbs_B | hetero NS1_INBLE | QSD |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
43 | Q | E | b | 0.0 | 7rbs_B | QRAEGKLSTV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
44 | R | E | e | 47.8 | 7rbs_B | hetero NS1_INBLE | RLKV |
MUTAGEN /note="R->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 1" MUTAGEN /note="R->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 1" | |
45 | L | E | b | 10.1 | 7rbs_B | LSV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
46 | A | E | b | 19.6 | 7rbs_B | hetero NS1_INBLE | LASFI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
47 | V | E | b | 20.0 | 7rbs_B | FQVYLHA |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
48 | H | E | e | 35.6 | 7rbs_B | hetero NS1_INBLE | QEHLRAGSVDFIKNPTCMWY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
49 | P | T | e | 87.6 | 7rbs_B | hetero NS1_INBLE | PDVQALEGKSTFINRCHMWY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
50 | S | T | e | 66.4 | 7rbs_B | hetero NS1_INBLE | GKASQPT |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
51 | G | e | 65.5 | 7rbs_B | hetero NS1_INBLE | GIRSA |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
52 | V | e | 56.0 | 7rbs_B | KEVLSQ |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
53 | A | B | e | 64.3 | 7rbs_B | hetero NS1_INBLE | ARQLEIV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
54 | L | b | 14.0 | 7rbs_B | LI |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
55 | Q | e | 63.3 | 7rbs_B | QARESDK |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
56 | D | S | e | 69.1 | 7rbs_B | compound SIN | DSEP |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
57 | R | S | e | 88.9 | 7rbs_B | hetero R1A_SARS2 | GREKHQ |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
58 | V | S | e | 39.3 | 7rbs_B | CRVHILKY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
59 | P | e | 28.7 | 7rbs_B | TSRPKC |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
60 | L | T | b | 0.0 | 7rbs_B | L |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
61 | A | T | e | 43.8 | 7rbs_B | ASV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
62 | S | T | e | 67.2 | 7rbs_B | DSYLKH |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
63 | Q | S | b | 19.9 | 7rbs_B | YQL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
64 | G | S | e | 95.2 | 7rbs_B | GSN |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
65 | L | b | 2.8 | 7rbs_B | IL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
66 | G | e | 31.0 | 7rbs_B | GFQDR |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
67 | P | T | e | 82.9 | 7rbs_B | PKCAS |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
68 | G | T | e | 85.7 | 7rbs_B | EGDHNS |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
69 | S | e | 25.0 | 7rbs_B | STAKN |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |||
70 | T | E | e | 21.4 | 7rbs_B | TKHQR |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
71 | V | E | b | 0.0 | 7rbs_B | LIV |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
72 | L | E | e | 25.8 | 7rbs_B | hetero NS1_INBLE | LNHCMY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
73 | L | E | b | 0.0 | 7rbs_B | hetero NS1_INBLE | LK |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
74 | V | E | e | 38.0 | 7rbs_B | hetero NS1_INBLE | VLM |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
75 | V | E | e | 26.7 | 7rbs_B | hetero NS1_INBLE | VLIAGSDEFKNPQRTY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | |
76 | D | e | 48.8 | 7rbs_B | hetero NS1_INBLE | DKQREAGLSFINPTVY |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
77 | K | e | 62.7 | 7rbs_B | hetero NS1_INBLE | PRTNKL |
DOMAIN /note="Ubiquitin-like 1" DOMAIN /note="Ubiquitin-like 1" | ||
78 | C | e | 51.3 | 7rbs_B | hetero NS1_INBLE | CLISA |
MOD_RES /note="S-nitrosocysteine; alternate" DISULFID /note="Interchain (with C-87 in UBE2N); alternate" DISULFID /note="Interchain (with C-87 in UBE2N); alternate" DOMAIN /note="Ubiquitin-like 1" MOD_RES /note="S-nitrosocysteine; alternate" DISULFID /note="Interchain (with C-87 in UBE2N); alternate" DISULFID /note="Interchain (with C-87 in UBE2N); alternate" DOMAIN /note="Ubiquitin-like 1" | ||
79 | D | e | 25.9 | 7rbs_B | DRSGPAELV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |||
80 | E | e | 73.4 | 7rbs_B | hetero NS1_INBLE | EGPSADIKLNQRTV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
81 | P | e | 35.7 | 7rbs_B | PGERALSV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |||
82 | L | E | b | 13.5 | 7rbs_B | MLIST |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
83 | S | E | e | 40.6 | 7rbs_B | QSFMN |
MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" | S->N:(5.0 %):LB/B - dbSNP:rs1921 | |
84 | I | E | b | 0.0 | 7rbs_B | ILVG |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
85 | L | E | e | 21.3 | 7rbs_B | hetero K0BWD0_9BETC | FVLAK |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
86 | V | E | b | 0.0 | 7rbs_B | VEI |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
87 | R | E | e | 36.0 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 R1AB_CVHSA POLG_FMDVO precipitant | KRSNQ |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
88 | N | b | 4.8 | 7rbs_B | hetero UBA7_HUMAN precipitant | NTGAK |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
89 | N | S | e | 55.2 | 7rbs_B | hetero UBA7_HUMAN L_CCHFI Q6TQF5_9VIRU precipitant | LDPNQE |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
90 | K | S | e | 76.9 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN UB2L6_HUMAN L_CCHFI Q6TQF5_9VIRU R1AB_SARS2 | TKEDR |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
91 | G | e | 44.0 | 7rbs_B | hetero R1A_SARS2 L_CCHFI Q6TQF5_9VIRU precipitant | GALS |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
92 | R | e | 53.4 | 7rbs_B | hetero UBA7_HUMAN UB2L6_HUMAN | KGRQHALS |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
93 | S | E | e | 30.5 | 7rbs_B | hetero UBA7_HUMAN | STREL |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
94 | S | E | b | 13.3 | 7rbs_B | hetero UBA7_HUMAN | IHGSNY |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
95 | T | E | e | 56.5 | 7rbs_B | hetero UBA7_HUMAN | TAVLPDIE |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
96 | Y | E | b | 5.7 | 7rbs_B | LYWIAV |
MUTAGEN /note="Y->L: Reduces ISG15 signaling. Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases; when associated with D-102." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="Y->L: Reduces ISG15 signaling. Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases; when associated with D-102." DOMAIN /note="Ubiquitin-like 2" | ||
97 | E | E | e | 68.3 | 7rbs_B | EQADR |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
98 | V | E | b | 0.7 | 7rbs_B | VILT |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
99 | R | e | 43.5 | 7rbs_B | ELRHTNQFK |
MUTAGEN /note="R->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="R->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL." DOMAIN /note="Ubiquitin-like 2" | |||
100 | L | T | e | 23.6 | 7rbs_B | PSLGRAM |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
101 | T | T | e | 29.9 | 7rbs_B | TSLQKNAG |
MUTAGEN /note="T->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="T->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" | ||
102 | Q | S | e | 20.9 | 7rbs_B | DSVEQ |
MUTAGEN /note="Q->D: Reduces ISG15 signaling. Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases; when associated with L-96." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="Q->D: Reduces ISG15 signaling. Strongly reduces ISG15 signaling and abolishes interaction with ITGAL and activation of SRC family tyrosine kinases; when associated with L-96." DOMAIN /note="Ubiquitin-like 2" | ||
103 | T | B | e | 35.1 | 7rbs_B | TLFSYN |
MUTAGEN /note="T->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="T->A: Strongly reduces ISG15 signaling and abolishes interaction with ITGAL." DOMAIN /note="Ubiquitin-like 2" | ||
104 | V | H | b | 0.0 | 7rbs_B | VIA |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
105 | A | H | e | 31.2 | 7rbs_B | ADLKEG |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
106 | H | H | e | 46.6 | 7rbs_B | metal ZN | NQHREGDST |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
107 | L | H | b | 0.0 | 7rbs_B | LVIF |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
108 | K | H | b | 4.2 | 7rbs_B | hetero L_CCHFI Q6TQF5_9VIRU precipitant | K |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
109 | Q | H | e | 55.6 | 7rbs_B | metal ZN | QAEK |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
110 | Q | H | e | 29.1 | 7rbs_B | KQMHR |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
111 | V | H | b | 0.0 | 7rbs_B | IV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
112 | S | H | b | 18.8 | 7rbs_B | EQASC |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
113 | G | H | e | 73.8 | 7rbs_B | DSQEGNT |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
114 | L | H | e | 48.9 | 7rbs_B | hetero UBA7_HUMAN | KRLVQ |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
115 | E | H | b | 13.6 | 7rbs_B | hetero UBA7_HUMAN | EQT |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
116 | G | T | e | 77.4 | 7rbs_B | GRQAS |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
117 | V | e | 24.0 | 7rbs_B | IVL |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |||
118 | Q | e | 64.3 | 7rbs_B | hetero UBA7_HUMAN | PQIAHRSL |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
119 | D | G | e | 42.6 | 7rbs_B | hetero Q6TQF5_9VIRU metal ZN precipitant | PAECKSVD |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
120 | D | G | e | 49.4 | 7rbs_B | hetero UBA7_HUMAN L_CCHFI Q6TQF5_9VIRU precipitant | DEKQVR |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
121 | L | G | e | 29.2 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN POLG_FMDVO R1AB_SARS2 precipitant | QDEKLT |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
122 | F | E | b | 0.0 | 7rbs_B | hetero L_CCHFI Q6TQF5_9VIRU precipitant | QF |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
123 | W | E | e | 36.3 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU POLG_FMDVO precipitant | RWVQI |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
124 | L | E | b | 0.6 | 7rbs_B | LV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
125 | T | E | b | 9.7 | 7rbs_B | hetero UBA7_HUMAN K0BWD0_9BETC K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU POLG_FMDVO | IESLNT |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
126 | F | E | b | 7.2 | 7rbs_B | FCYL |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
127 | E | T | e | 83.9 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 K4LC41_9BETC L_CCHFI metal ZN precipitant | AEQNG |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
128 | G | T | e | 79.8 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU POLG_FMDVO | G |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
129 | K | E | e | 62.3 | 7rbs_B | hetero R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC UBA7_HUMAN precipitant | KRHQASTE |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
130 | P | E | e | 55.0 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN K0BWD0_9BETC R1AB_SARS2 K4LC41_9BETC L_CCHFI compound SIN precipitant | QPVRIK |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
131 | L | b | 7.3 | 7rbs_B | hetero L_CCHFI | LM |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
132 | E | e | 56.3 | 7rbs_B | hetero K0BWD0_9BETC UBA7_HUMAN K4LC41_9BETC R1A_SARS2 L_CCHFI R1AB_SARS2 | EADQ |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
133 | D | T | e | 43.8 | 7rbs_B | hetero K0BWD0_9BETC UBA7_HUMAN L_CCHFI | DE |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
134 | Q | T | e | 63.8 | 7rbs_B | hetero K0BWD0_9BETC K4LC41_9BETC UBA7_HUMAN | GEWDKQASY |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
135 | L | S | e | 28.1 | 7rbs_B | KRAFLEHQY |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
136 | P | B | b | 13.2 | 7rbs_B | TPDILGM |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
137 | L | G | b | 0.0 | 7rbs_B | LMFA |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
138 | G | G | b | 6.0 | 7rbs_B | compound SIN | AGKSEH |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
139 | E | G | e | 44.2 | 7rbs_B | compound SIN | DEQSI |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
140 | Y | G | b | 8.7 | 7rbs_B | YC |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
141 | G | T | e | 39.3 | 7rbs_B | compound SIN | GNKA |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
142 | L | b | 2.2 | 7rbs_B | ILV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |||
143 | K | e | 63.2 | 7rbs_B | hetero K0BWD0_9BETC UBA7_HUMAN L_CCHFI K4LC41_9BETC | QEKMR |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
144 | P | T | e | 72.9 | 7rbs_B | hetero K0BWD0_9BETC K4LC41_9BETC R1AB_CVHSA | KADPSG |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
145 | L | T | e | 62.9 | 7rbs_B | hetero K0BWD0_9BETC K4LC41_9BETC UBA7_HUMAN R1AB_CVHSA | GELSQ |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
146 | S | b | 17.2 | 7rbs_B | SCTDIVN |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |||
147 | T | E | e | 23.4 | 7rbs_B | hetero UBA7_HUMAN | TLV |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
148 | V | E | b | 0.0 | 7rbs_B | LVI |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | ||
149 | F | E | e | 40.2 | 7rbs_B | hetero UBA7_HUMAN R1AB_CVHSA L_CCHFI POLG_FMDVO precipitant | HFIE |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
150 | M | E | b | 4.8 | 7rbs_B | precipitant | LMVK |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
151 | N | E | e | 30.3 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN R1AB_SARS2 R1AB_CVHSA L_CCHFI Q6TQF5_9VIRU precipitant | VASNTH |
DOMAIN /note="Ubiquitin-like 2" DOMAIN /note="Ubiquitin-like 2" | |
152 | L | E | e | 52.8 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC POLG_FMDVO UB2L6_HUMAN precipitant | LGRKCAT |
MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" | |
153 | R | e | 34.4 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU POLG_FMDVO compound SIN precipitant | RHAKTY |
SITE /note="Interacts with activating enzyme" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" SITE /note="Interacts with activating enzyme" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" | ||
154 | L | e | 93.3 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU POLG_FMDVO | LCMRT |
REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" | ||
155 | R | e | 70.8 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 K0BWD0_9BETC R1AB_SARS2 R1AB_CVHSA K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU precipitant | RELITC |
REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" | ||
156 | G | e | 98.8 | 7rbs_B | hetero R1A_SARS2 UBA7_HUMAN K0BWD0_9BETC R1AB_SARS2 UB2L6_HUMAN R1AB_CVHSA K4LC41_9BETC L_CCHFI Q6TQF5_9VIRU compound AMP precipitant | G |
REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" | ||
157 | G | e | 181.0 | 7rbs_B | hetero UBA7_HUMAN R1A_SARS2 UB2L6_HUMAN compound AMP | GKA |
CROSSLNK /note="Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins)" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DOMAIN /note="Ubiquitin-like 2" CROSSLNK /note="Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins)" REGION /note="Involved in the ligation of specific target proteins" MOTIF /note="LRLRGG" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 2" | ||
158 | G | - | - | - | - | GANVI |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
159 | T | - | - | - | - | ITML |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
160 | E | - | - | - | - | ER |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
161 | P | - | - | - | - | PK |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
162 | G | - | - | - | - | GS |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
163 | G | - | - | - | - | GLK |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
164 | R | - | - | - | - | R |
PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED | ||
165 | S | - | - | - | - | PROPEP /note="Removed in mature form" /id="PRO_0000035987" PROPEP /note="Removed in mature form" /id="PRO_0000035987" DISORDER predicted by DISOPRED |