[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[80 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2634797 165 40 P05161(ISG15_HUMAN) RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor;
QUERYSEQ 
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM
NLRLRGGGTEPGGRS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All LB/B (likely benign or benign)
Number of sites 165 1
Buired or ExposedBuried 33.3 (%) [52] 0.0 (%) [0]
Exposed 66.7 (%) [104] 100.0 (%) [1]
Ave relacc 37.1 % 40.6 %
SD relacc 29.07 % 0.00 %
Contact Molhetero 45.5 (%) [75] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0]
compound 6.7 (%) [11] 0.0 (%) [0]
metal 4.2 (%) [7] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 0.0 (%) [0] 0.0 (%) [0]
precipitant 12.1 (%) [20] 0.0 (%) [0]
Number of variants 1 1
N_Freq(AAvariant)==0 % 0.0 % [0]
N_Freq(AAvariant)>0 % 100.0 % [1]
Ave Freq(AAvariant) 5.0 %
SD Freq(AAvariant) 0.00 %

Site Table for OMIM:LB/B [1 variants]

1 sites 83
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
83SEe 40.6 7rbs_B 
QSFMN
 MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" S->N:(5.0 %):LB/B - dbSNP:rs1921