Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2634797 | 165 | 84 | P05161(ISG15_HUMAN) | RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor; |
QUERYSEQ |
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGGGTEPGGRS |
All | LB/B (likely benign or benign) | ||
Number of sites | 165 | 1 | |
Buired or Exposed | Buried | 33.3 (%) [52] | 0.0 (%) [0] |
Exposed | 66.7 (%) [104] | 100.0 (%) [1] | |
Ave relacc | 37.1 % | 40.6 % | |
SD relacc | 29.07 % | 0.00 % | |
Contact Mol | hetero | 55.8 (%) [92] | 100.0 (%) [1] |
nucleotide | 0.0 (%) [0] | 0.0 (%) [0] | |
compound | 6.7 (%) [11] | 0.0 (%) [0] | |
metal | 4.2 (%) [7] | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | 0.0 (%) [0] | |
homo | 0.0 (%) [0] | 0.0 (%) [0] | |
precipitant | 37.6 (%) [62] | 0.0 (%) [0] | |
Number of variants | 1 | 1 | |
N_Freq(AAvariant)==0 % | 0.0 % [0] | ||
N_Freq(AAvariant)>0 % | 100.0 % [1] | ||
Ave Freq(AAvariant) | 5.0 % | ||
SD Freq(AAvariant) | 0.00 % |
1 sites | 83 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | S | E | e | 40.6 | ![]() |
hetero UBP18_MOUSE | QSFMN |
MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" MUTAGEN /note="S->A: Does not affect ISG15 signaling, interaction with ITGAL or activation of SRC family tyrosine kinases." DOMAIN /note="Ubiquitin-like 2" | S->N:(5.0 %):LB/B - dbSNP:rs1921 |