Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2624989 | 215 | 33 | P09429(HMGB1_HUMAN) | RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | S | e | 77.8 | ![]() |
ML |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | G | S | e | 73.8 | ![]() |
GAIK |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | S | e | 88.2 | ![]() |
KE |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | G | e | 63.1 | ![]() |
KGQRNE |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | D | e | 63.0 | ![]() |
DGLFYI |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | P | S | e | 84.5 | ![]() |
hetero P53_HUMAN | PSQETN |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | S | e | 62.3 | ![]() |
hetero P53_HUMAN | NKLEDAHPSGR |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | S | e | 47.2 | ![]() |
hetero P53_HUMAN nucleotide homo | KARGPYET |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | P | b | 11.6 | ![]() |
P |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | R | e | 60.9 | ![]() |
hetero P53_HUMAN nucleotide | KRSADEGILNPQTV |
SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | G | e | 23.8 | ![]() |
nucleotide | RGAPHQSVDEFIKLNT |
SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | G->R:(51.0 %):US Gastric-carcinoma cell line | |
![]() | K | b | 19.8 | ![]() |
nucleotide | PANKGRSYDEFILQTV |
MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | M | b | 11.6 | ![]() |
hetero P53_HUMAN nucleotide | MLVPTKRAIS |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | S | e | 50.0 | ![]() |
nucleotide | ST |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | S | H | b | 13.3 | ![]() |
nucleotide | ASGP |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | Y | H | e | 21.7 | ![]() |
hetero P53_HUMAN nucleotide | YFM |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | A | H | e | 29.5 | ![]() |
hetero P53_HUMAN nucleotide | MFLAVING |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | F | H | b | 17.7 | ![]() |
FLVRIYH |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | F | H | b | 0.0 | ![]() |
FWYL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | V | H | b | 16.7 | ![]() |
hetero P53_HUMAN nucleotide | SVLAMCFK |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | Q | H | e | 45.9 | ![]() |
hetero P53_HUMAN nucleotide | QNEKADLMGTI |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | T | H | e | 34.4 | ![]() |
EDATSHMNP |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | C | H | b | 16.0 | ![]() |
NCFQKRHISEYALM |
MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | R | H | e | 47.4 | ![]() |
hetero P53_HUMAN nucleotide | RLYH |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | E | H | e | 48.7 | ![]() |
EDNPAKRSVCGQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | E | H | e | 60.8 | ![]() |
EQKINSVRTA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | H | H | b | 12.6 | ![]() |
ILFHVYMN |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 51.4 | ![]() |
hetero P53_HUMAN nucleotide | KRVQGILN |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | H | e | 83.0 | ![]() |
KAESTNQGR |
MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 73.1 | ![]() |
EKDQSALNRT |
MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | H | e | 51.3 | ![]() |
NHRYQMFG |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | P | T | e | 75.2 | ![]() |
PDKS |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | D | T | e | 97.5 | ![]() |
DNEGKALFIPQRSTVY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | A | e | 30.4 | ![]() |
AILVKSTCEFNDGPRHMQY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | S | e | 89.8 | ![]() |
hetero P53_HUMAN nucleotide homo | KSGTNPEYADFILQRV |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | V | e | 47.3 | ![]() |
hetero P53_HUMAN nucleotide | VILEKPAMNTDFGQRSY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | N | e | 53.9 | ![]() |
homo | SNPQRGTAKDHILEVCFMWY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | F | H | e | 75.6 | ![]() |
hetero P53_HUMAN nucleotide homo | FVNLPAMDEGIKRSTCHQY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | S | H | e | 53.1 | ![]() |
hetero P53_HUMAN nucleotide | SGTAPRKIVL |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | E | H | e | 52.8 | ![]() |
EQADV |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | F | H | b | 10.0 | ![]() |
nucleotide | VILF |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | S | H | e | 43.8 | ![]() |
hetero P53_HUMAN nucleotide | GSTAINLM |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | H | e | 67.9 | ![]() |
nucleotide | KRSQVN |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | H | e | 50.0 | ![]() |
KLMAITHVD |
CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | C | H | b | 0.0 | ![]() |
nucleotide | LCIAGVT |
MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | S | H | e | 47.7 | ![]() |
hetero P53_HUMAN nucleotide | GSAQR |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | E | H | e | 58.8 | ![]() |
EAQKRCDISN |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | R | H | e | 51.0 | ![]() |
KREMLDIQSA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | W | H | b | 14.7 | ![]() |
nucleotide | WY |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | H | e | 68.9 | ![]() |
KRSNQA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | T | H | e | 74.7 | ![]() |
EATKNSDGLHQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | M | S | b | 8.7 | ![]() |
LMIVA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | S | e | 62.5 | ![]() |
STPENVFGQ |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | A | H | e | 74.1 | ![]() |
AEDKNPSTQGLRY |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 87.7 | ![]() |
KEDANSHT |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | E | H | e | 45.7 | ![]() |
EDKQYIVG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 25.5 | ![]() |
KR |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | G | H | e | 41.7 | ![]() |
KAEGSQNRDVMIL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 44.8 | ![]() |
KPREVHIAQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | F | H | b | 2.9 | ![]() |
YFLW |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | E | H | e | 52.8 | ![]() |
EQDYHILNVKR |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | D | H | e | 60.5 | ![]() |
DAEKRSQGNTV |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | M | H | e | 35.7 | ![]() |
KMLEQRAIVD |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | A | H | b | 4.5 | ![]() |
ASFRVYCEQG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 60.4 | ![]() |
KADEQRLNTSVM |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | A | H | e | 50.0 | ![]() |
AKEQTDNRLVGS |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | D | H | b | 4.9 | ![]() |
DAELKNRM |
MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 46.2 | ![]() |
KWRATEY |
CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | A | H | e | 50.9 | ![]() |
EKAQTVRGSL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | R | H | e | 71.5 | ![]() |
REKSDQVHNITAGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | Y | T | b | 7.8 | ![]() |
YFTASWGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | E | H | e | 55.8 | ![]() |
EKDQLMRHTINAGSV |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | R | H | e | 96.0 | ![]() |
RKEQADVLSIG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | E | H | e | 44.2 | ![]() |
EAKDTSNQRGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | M | H | e | 30.0 | ![]() |
MLKIVTNSRADEGPQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | H | e | 72.2 | ![]() |
KQAELSMRNDTGIPV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | T | H | e | 67.5 | ![]() |
EASNTDKLVGPQRI |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | Y | e | 21.7 | ![]() |
nucleotide | YFRSHKADEGILNPQTV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | I | e | 119.3 | ![]() |
AEFGIKLMPTVS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | P | e | 46.5 | ![]() |
homo | PRGEKADNSFQTLV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | P | e | 83.7 | ![]() |
KPYSTGQRVADEL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | K | e | 92.9 | ![]() |
AGKLQRSTDEIPV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | G | e | 76.2 | ![]() |
GAEKPDRSVL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | E | e | 56.8 | ![]() |
EKLADRGQSNIPTV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | T | S | e | 81.2 | ![]() |
AEGIKLNQRSTV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | S | e | 85.8 | ![]() |
nucleotide | KREGSNQYAT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |
![]() | K | e | 61.8 | ![]() |
hetero RAG1_MOUSE | KREYGSDLTA |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | K | S | e | 67.5 | ![]() |
KRAQSTEPINGL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | F | e | 69.9 | ![]() |
KLGAEFTVISNPYR |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | K | e | 66.0 | ![]() |
hetero RAG1_MOUSE | KRTEILNADHS |
MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | D | e | 46.3 | ![]() |
hetero RAG1_MOUSE | DLKMSETVAH |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | P | S | e | 89.9 | ![]() |
PLSEKGNT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | N | S | e | 96.4 | ![]() |
NGESDAHLPVKQ |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | A | S | e | 23.2 | ![]() |
AKSEHPVMQGRT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | P | e | 23.3 | ![]() |
PILRV |
REGION /note="LPS binding (Lipid A)" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | |||
![]() | K | e | 61.8 | ![]() |
nucleotide | KRQ |
REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | R | e | 64.0 | ![]() |
nucleotide | RKSAIP |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | ||
![]() | P | e | 26.4 | ![]() |
PANQGISY |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |||
![]() | P | e | 31.8 | ![]() |
LMPRTEVSIAQ |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |||
![]() | S | e | 49.2 | ![]() |
nucleotide | STNEGAL |
MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
![]() | A | H | b | 0.0 | ![]() |
nucleotide | AGSIPM |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | F | H | e | 39.2 | ![]() |
hetero RAGE_HUMAN nucleotide | FYML |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | F | H | e | 48.8 | ![]() |
nucleotide precipitant | FMNLIVAQ |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | L | H | e | 21.3 | ![]() |
LFVIRQYW |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
![]() | F | H | b | 1.9 | ![]() |
hetero RAGE_HUMAN | FWYL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | C | H | b | 8.7 | ![]() |
nucleotide precipitant | SCLAMVFIKQTY |
MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | S | H | e | 31.2 | ![]() |
nucleotide precipitant | QNSKAERDGMYIL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
![]() | E | H | e | 52.3 | ![]() |
EDAMINHRSTL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
![]() | Y | H | e | 33.0 | ![]() |
ENFQHARWYKLSTVIM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | R | H | e | 46.2 | ![]() |
nucleotide precipitant | RQFYSHK |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | P | H | e | 60.5 | ![]() |
EQAPKRSVDGN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | K | H | e | 58.5 | ![]() |
KQSERNTAIVLM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | I | H | e | 21.1 | ![]() |
IVLFAMYR |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | K | H | e | 41.5 | ![]() |
nucleotide | KRIAQMVLNCT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | G | H | e | 70.2 | ![]() |
AGEKDSTQLNRP |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | E | H | e | 78.4 | ![]() |
EDQKAGLSRNTV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | H | e | 45.0 | ![]() |
NHYRCLPFKTWS |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |||
![]() | P | S | e | 85.3 | ![]() |
nucleotide | PLSADGKN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | G | S | e | 86.9 | ![]() |
nucleotide | GDNAESTHQR |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | L | S | e | 32.0 | ![]() |
LIVRAKMWTQFNSYCD |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | S | e | 50.8 | ![]() |
SKTHDFPAGNRL |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |||
![]() | I | H | e | 95.9 | ![]() |
nucleotide precipitant | VFNIKALTQEMP |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | G | H | e | 48.8 | ![]() |
nucleotide | GATSPNVKIRQD |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | D | H | e | 57.4 | ![]() |
EDQKAGTSNV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | V | H | b | 0.7 | ![]() |
VILRAMKT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | A | H | e | 29.5 | ![]() |
nucleotide precipitant | SAGTVLNPI |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 80.2 | ![]() |
nucleotide | KRSAQ |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 40.6 | ![]() |
AKILMTENRVDHQS |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | ||
![]() | L | H | b | 1.1 | ![]() |
LIAVGMFCST |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | G | H | e | 28.6 | ![]() |
nucleotide | GAKNSHV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | E | H | e | 45.2 | ![]() |
nucleotide | EAKDQRSNGLITVY |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | M | H | e | 25.6 | ![]() |
MKREALNDGWIPQV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | W | H | b | 9.2 | ![]() |
nucleotide | WFYC |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | N | H | e | 91.5 | ![]() |
nucleotide | KNRSQDAGTM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | N | H | e | 89.7 | ![]() |
NSEKALDTGQVHM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | T | S | e | 20.1 | ![]() |
LMVITCQYAK |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | A | e | 42.9 | ![]() |
STPEGANDKQL |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |||
![]() | A | G | e | 67.9 | ![]() |
EADKPQGLNSHIMRTY |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | D | G | e | 82.7 | ![]() |
hetero RAGE_HUMAN | EKDSANQTGRHLV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | D | G | e | 49.4 | ![]() |
hetero RAGE_HUMAN | EDKQNTIV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 21.7 | ![]() |
KRPV |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | ||
![]() | Q | H | e | 73.0 | ![]() |
hetero RAGE_HUMAN | QKALERIHSDVTW |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | P | H | e | 52.7 | ![]() |
PVKEMARFGHILT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | Y | H | b | 19.1 | ![]() |
YWFLG |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
![]() | E | H | e | 52.8 | ![]() |
hetero RAGE_HUMAN | EIVKYLNDFTQ |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 64.2 | ![]() |
hetero RAGE_HUMAN | QEKDARSGTILN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 41.5 | ![]() |
hetero RAGE_HUMAN | KELRMAQGI |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | A | H | b | 10.7 | ![]() |
hetero RAGE_HUMAN | ASYLQTERV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
![]() | A | H | e | 50.9 | ![]() |
hetero RAGE_HUMAN | AEQKSRDVNTGILM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | A->E:(23.0 %):US Gastric-carcinoma cell line |
![]() | K | H | e | 68.9 | ![]() |
KEARDYLVQST |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | L | H | e | 37.1 | ![]() |
DLAERKMVYS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | K | H | e | 40.6 | ![]() |
KRQAGMYS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | E | H | e | 52.3 | ![]() |
hetero RAGE_HUMAN | EKAVDIQSLHRTGM |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
![]() | K | H | e | 69.8 | ![]() |
hetero RAGE_HUMAN | RKEAQDLTIN |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
![]() | Y | H | b | 14.8 | ![]() |
hetero RAGE_HUMAN | YHFQSAW |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
![]() | E | H | e | 44.2 | ![]() |
hetero RAGE_HUMAN | EKMDQNTYAGILFHR |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | E->Q:(7.0 %):LB/B - |
![]() | K | H | e | 67.9 | ![]() |
KREDNAMYISTV |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | D | H | e | 66.0 | ![]() |
EADNQTS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | I | H | b | 18.1 | ![]() |
MLIYVHKNRSQ |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | A | H | e | 49.1 | ![]() |
AKEPQSRTVLDW |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
![]() | A | H | e | 62.5 | ![]() |
AEDQNSGLVIK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | ||
![]() | Y | H | e | 59.1 | ![]() |
YMWLQDF |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | ||
![]() | R | H | e | 56.1 | ![]() |
RKNEQDIS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | ||
![]() | A | e | 66.1 | ![]() |
AKYESGTRNQLPV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | e | 77.4 | ![]() |
KQRSNALEGDFIPTVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | e | 147.6 | ![]() |
GAKSMFPNYELVDHIQRT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | e | 59.4 | ![]() |
KRGEANTPQLMDFISVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | P | S | e | 70.5 | ![]() |
PSTGEMNKVFADILQR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | T | e | 77.8 | ![]() |
DEPRNAVTFGIKLQSY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | T | e | 101.8 | ![]() |
ASVLGRYDEFIKNPQT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | e | 139.3 | ![]() |
AGIYLSRVEDKPT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | - | - | - | - | KRAELQDFGINPSTV |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KGRIVDMQEPSTAL |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | - | - | - | - | GSVATCFKYREL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | V | - | - | - | - | VAKSTIPRCEGL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | V | - | - | - | - | VARLEPISDGN |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KRTQE |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | - | - | - | - | AEDKRPISVGL |
MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | AEQSTMRGL |
MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KGAEDQSR |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | - | - | - | - | STKPRADN |
MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KSQRGNVL |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KTAEGQDIPS |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KGSCNAEV |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | - | - | - | - | KEARGPISN |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EQSKALNPD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ESDFAHQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EDRTKP |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | QEADKSV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DEKAG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | D->G:(6.0 %):US Gastric-carcinoma cell line | |
![]() | E | - | - | - | - | EDKAS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | SAED |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DSANKVG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ETSQK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ESQTK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DENGSK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ESL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EGALV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EFNI |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | KDEN |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EDS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DKAE |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EAD |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EDY |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DEI |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ES |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DEG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EDS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ED |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | ES |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DT |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | DS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | D |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | - | - | - | - | D |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | - | - | - | - | EQ |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" |