Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2624989 | 215 | 66 | P09429(HMGB1_HUMAN) | RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | S | e | 77.8 | 2yrq_A | ML |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
2 | G | S | e | 73.8 | 2yrq_A | GAIK |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
3 | K | S | e | 88.2 | 2yrq_A | KE |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | ||
4 | G | e | 63.1 | 2yrq_A | KGQRNE |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |||
5 | D | e | 63.0 | 2yrq_A | DGLFYI |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |||
6 | P | S | e | 84.5 | 2yrq_A | hetero P53_HUMAN | PSQETN |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
7 | K | S | e | 62.3 | 2yrq_A | hetero P53_HUMAN nucleotide | NKLEDAHPSGR |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
8 | K | S | e | 47.2 | 2yrq_A | hetero P53_HUMAN nucleotide homo | KARGPYET |
MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2" | |
9 | P | b | 11.6 | 2yrq_A | nucleotide | P |
BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
10 | R | e | 60.9 | 2yrq_A | hetero P53_HUMAN nucleotide | KRSADEGILNPQTV |
SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
11 | G | e | 23.8 | 2yrq_A | nucleotide | RGAPHQSVDEFIKLNT |
SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | G->R:(51.0 %):US Gastric-carcinoma cell line | |
12 | K | b | 19.8 | 2yrq_A | nucleotide | PANKGRSYDEFILQTV |
MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
13 | M | b | 11.6 | 2yrq_A | hetero P53_HUMAN nucleotide | MLVPTKRAIS |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
14 | S | e | 50.0 | 2yrq_A | nucleotide | ST |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
15 | S | H | b | 13.3 | 2yrq_A | nucleotide | ASGP |
REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
16 | Y | H | e | 21.7 | 2yrq_A | hetero P53_HUMAN nucleotide | YFM |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
17 | A | H | e | 29.5 | 2yrq_A | hetero P53_HUMAN nucleotide | MFLAVING |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
18 | F | H | b | 17.7 | 2yrq_A | nucleotide | FLVRIYH |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
19 | F | H | b | 0.0 | 2yrq_A | nucleotide | FWYL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
20 | V | H | b | 16.7 | 2yrq_A | hetero P53_HUMAN nucleotide | SVLAMCFK |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
21 | Q | H | e | 45.9 | 2yrq_A | hetero P53_HUMAN nucleotide | QNEKADLMGTI |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
22 | T | H | e | 34.4 | 2yrq_A | EDATSHMNP |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
23 | C | H | b | 16.0 | 2yrq_A | nucleotide | NCFQKRHISEYALM |
MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
24 | R | H | e | 47.4 | 2yrq_A | hetero P53_HUMAN nucleotide | RLYH |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
25 | E | H | e | 48.7 | 2yrq_A | EDNPAKRSVCGQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
26 | E | H | e | 60.8 | 2yrq_A | nucleotide | EQKINSVRTA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
27 | H | H | b | 12.6 | 2yrq_A | nucleotide | ILFHVYMN |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
28 | K | H | e | 51.4 | 2yrq_A | hetero P53_HUMAN nucleotide | KRVQGILN |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
29 | K | H | e | 83.0 | 2yrq_A | KAESTNQGR |
MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
30 | K | H | e | 73.1 | 2yrq_A | nucleotide | EKDQSALNRT |
MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
31 | H | e | 51.3 | 2yrq_A | NHRYQMFG |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
32 | P | T | e | 75.2 | 2yrq_A | precipitant | PDKS |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
33 | D | T | e | 97.5 | 2yrq_A | DNEGKALFIPQRSTVY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
34 | A | e | 30.4 | 2yrq_A | AILVKSTCEFNDGPRHMQY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
35 | S | e | 89.8 | 2yrq_A | hetero P53_HUMAN nucleotide homo | KSGTNPEYADFILQRV |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
36 | V | e | 47.3 | 2yrq_A | hetero P53_HUMAN nucleotide | VILEKPAMNTDFGQRSY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
37 | N | e | 53.9 | 2yrq_A | nucleotide homo | SNPQRGTAKDHILEVCFMWY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
38 | F | H | e | 75.6 | 2yrq_A | hetero P53_HUMAN nucleotide homo | FVNLPAMDEGIKRSTCHQY |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
39 | S | H | e | 53.1 | 2yrq_A | hetero P53_HUMAN nucleotide | SGTAPRKIVL |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
40 | E | H | e | 52.8 | 2yrq_A | nucleotide | EQADV |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
41 | F | H | b | 10.0 | 2yrq_A | nucleotide | VILF |
MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
42 | S | H | e | 43.8 | 2yrq_A | hetero P53_HUMAN nucleotide | GSTAINLM |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
43 | K | H | e | 67.9 | 2yrq_A | nucleotide | KRSQVN |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
44 | K | H | e | 50.0 | 2yrq_A | KLMAITHVD |
CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
45 | C | H | b | 0.0 | 2yrq_A | nucleotide | LCIAGVT |
MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
46 | S | H | e | 47.7 | 2yrq_A | hetero P53_HUMAN nucleotide | GSAQR |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
47 | E | H | e | 58.8 | 2yrq_A | nucleotide | EAQKRCDISN |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
48 | R | H | e | 51.0 | 2yrq_A | KREMLDIQSA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
49 | W | H | b | 14.7 | 2yrq_A | nucleotide | WY |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
50 | K | H | e | 68.9 | 2yrq_A | nucleotide | KRSNQA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
51 | T | H | e | 74.7 | 2yrq_A | EATKNSDGLHQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
52 | M | S | b | 8.7 | 2yrq_A | LMIVA |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
53 | S | e | 62.5 | 2yrq_A | STPENVFGQ |
MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
54 | A | H | e | 74.1 | 2yrq_A | AEDKNPSTQGLRY |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
55 | K | H | e | 87.7 | 2yrq_A | KEDANSHT |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
56 | E | H | e | 45.7 | 2yrq_A | EDKQYIVG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
57 | K | H | e | 25.5 | 2yrq_A | KR |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
58 | G | H | e | 41.7 | 2yrq_A | KAEGSQNRDVMIL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
59 | K | H | e | 44.8 | 2yrq_A | KPREVHIAQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
60 | F | H | b | 2.9 | 2yrq_A | YFLW |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
61 | E | H | e | 52.8 | 2yrq_A | nucleotide | EQDYHILNVKR |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
62 | D | H | e | 60.5 | 2yrq_A | DAEKRSQGNTV |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
63 | M | H | e | 35.7 | 2yrq_A | KMLEQRAIVD |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
64 | A | H | b | 4.5 | 2yrq_A | nucleotide | ASFRVYCEQG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
65 | K | H | e | 60.4 | 2yrq_A | KADEQRLNTSVM |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
66 | A | H | e | 50.0 | 2yrq_A | AKEQTDNRLVGS |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
67 | D | H | b | 4.9 | 2yrq_A | DAELKNRM |
MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
68 | K | H | e | 46.2 | 2yrq_A | nucleotide | KWRATEY |
CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
69 | A | H | e | 50.9 | 2yrq_A | EKAQTVRGSL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
70 | R | H | e | 71.5 | 2yrq_A | REKSDQVHNITAGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
71 | Y | T | b | 7.8 | 2yrq_A | nucleotide | YFTASWGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
72 | E | H | e | 55.8 | 2yrq_A | nucleotide | EKDQLMRHTINAGSV |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |
73 | R | H | e | 96.0 | 2yrq_A | RKEQADVLSIG |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
74 | E | H | e | 44.2 | 2yrq_A | EAKDTSNQRGL |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
75 | M | H | e | 30.0 | 2yrq_A | MLKIVTNSRADEGPQ |
DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
76 | K | H | e | 72.2 | 2yrq_A | KQAELSMRNDTGIPV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
77 | T | H | e | 67.5 | 2yrq_A | EASNTDKLVGPQRI |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
78 | Y | e | 21.7 | 2yrq_A | nucleotide | YFRSHKADEGILNPQTV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | ||
79 | I | e | 119.3 | 2yrq_A | AEFGIKLMPTVS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" | |||
80 | P | e | 46.5 | 2yrq_A | nucleotide homo | PRGEKADNSFQTLV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
81 | P | e | 83.7 | 2yrq_A | KPYSTGQRVADEL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |||
82 | K | e | 92.9 | 2yrq_A | nucleotide | AGKLQRSTDEIPV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
83 | G | e | 76.2 | 2yrq_A | nucleotide | GAEKPDRSVL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
84 | E | e | 56.8 | 2yrq_A | nucleotide | EKLADRGQSNIPTV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
85 | T | S | e | 81.2 | 2yrq_A | nucleotide | AEGIKLNQRSTV |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |
86 | K | S | e | 85.8 | 2yrq_A | nucleotide | KREGSNQYAT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | |
87 | K | e | 61.8 | 2yrq_A | hetero RAG1_MOUSE nucleotide | KREYGSDLTA |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
88 | K | S | e | 67.5 | 2yrq_A | KRAQSTEPINGL |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" | ||
89 | F | e | 69.9 | 2yrq_A | KLGAEFTVISNPYR |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | |||
90 | K | e | 66.0 | 2yrq_A | hetero RAG1_MOUSE nucleotide | KRTEILNADHS |
MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
91 | D | e | 46.3 | 2yrq_A | hetero RAG1_MOUSE nucleotide | DLKMSETVAH |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
92 | P | S | e | 89.9 | 2yrq_A | PLSEKGNT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
93 | N | S | e | 96.4 | 2yrq_A | NGESDAHLPVKQ |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
94 | A | S | e | 23.2 | 2yrq_A | AKSEHPVMQGRT |
REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" | ||
95 | P | e | 23.3 | 2yrq_A | nucleotide | PILRV |
REGION /note="LPS binding (Lipid A)" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | ||
96 | K | e | 61.8 | 2yrq_A | nucleotide homo | KRQ |
REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | ||
97 | R | e | 64.0 | 2yrq_A | nucleotide homo | RKSAIP |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" | ||
98 | P | e | 26.4 | 2yrq_A | nucleotide homo precipitant | PANQGISY |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
99 | P | e | 31.8 | 2yrq_A | nucleotide homo precipitant | LMPRTEVSIAQ |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
100 | S | e | 49.2 | 2yrq_A | nucleotide precipitant | STNEGAL |
MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
101 | A | H | b | 0.0 | 2yrq_A | nucleotide | AGSIPM |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
102 | F | H | e | 39.2 | 2yrq_A | hetero RAGE_HUMAN nucleotide | FYML |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
103 | F | H | e | 48.8 | 2yrq_A | nucleotide precipitant | FMNLIVAQ |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
104 | L | H | e | 21.3 | 2yrq_A | homo | LFVIRQYW |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
105 | F | H | b | 1.9 | 2yrq_A | hetero RAGE_HUMAN | FWYL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
106 | C | H | b | 8.7 | 2yrq_A | nucleotide precipitant | SCLAMVFIKQTY |
MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
107 | S | H | e | 31.2 | 2yrq_A | nucleotide precipitant | QNSKAERDGMYIL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | |
108 | E | H | e | 52.3 | 2yrq_A | EDAMINHRSTL |
REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" | ||
109 | Y | H | e | 33.0 | 2yrq_A | ENFQHARWYKLSTVIM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
110 | R | H | e | 46.2 | 2yrq_A | nucleotide precipitant | RQFYSHK |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
111 | P | H | e | 60.5 | 2yrq_A | EQAPKRSVDGN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
112 | K | H | e | 58.5 | 2yrq_A | KQSERNTAIVLM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
113 | I | H | e | 21.1 | 2yrq_A | IVLFAMYR |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
114 | K | H | e | 41.5 | 2yrq_A | nucleotide | KRIAQMVLNCT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
115 | G | H | e | 70.2 | 2yrq_A | nucleotide homo | AGEKDSTQLNRP |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
116 | E | H | e | 78.4 | 2yrq_A | homo | EDQKAGLSRNTV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
117 | H | e | 45.0 | 2yrq_A | NHYRCLPFKTWS |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |||
118 | P | S | e | 85.3 | 2yrq_A | nucleotide homo | PLSADGKN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
119 | G | S | e | 86.9 | 2yrq_A | nucleotide homo | GDNAESTHQR |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
120 | L | S | e | 32.0 | 2yrq_A | nucleotide | LIVRAKMWTQFNSYCD |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
121 | S | e | 50.8 | 2yrq_A | nucleotide | SKTHDFPAGNRL |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
122 | I | H | e | 95.9 | 2yrq_A | nucleotide precipitant | VFNIKALTQEMP |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
123 | G | H | e | 48.8 | 2yrq_A | nucleotide | GATSPNVKIRQD |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
124 | D | H | e | 57.4 | 2yrq_A | EDQKAGTSNV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
125 | V | H | b | 0.7 | 2yrq_A | VILRAMKT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
126 | A | H | e | 29.5 | 2yrq_A | nucleotide precipitant | SAGTVLNPI |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
127 | K | H | e | 80.2 | 2yrq_A | nucleotide | KRSAQ |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | |
128 | K | H | e | 40.6 | 2yrq_A | AKILMTENRVDHQS |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | ||
129 | L | H | b | 1.1 | 2yrq_A | LIAVGMFCST |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
130 | G | H | e | 28.6 | 2yrq_A | nucleotide | GAKNSHV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
131 | E | H | e | 45.2 | 2yrq_A | nucleotide | EAKDQRSNGLITVY |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
132 | M | H | e | 25.6 | 2yrq_A | MKREALNDGWIPQV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
133 | W | H | b | 9.2 | 2yrq_A | nucleotide | WFYC |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
134 | N | H | e | 91.5 | 2yrq_A | nucleotide metal NA homo | KNRSQDAGTM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
135 | N | H | e | 89.7 | 2yrq_A | NSEKALDTGQVHM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
136 | T | S | e | 20.1 | 2yrq_A | LMVITCQYAK |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
137 | A | e | 42.9 | 2yrq_A | homo | STPEGANDKQL |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
138 | A | G | e | 67.9 | 2yrq_A | homo | EADKPQGLNSHIMRTY |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
139 | D | G | e | 82.7 | 2yrq_A | hetero RAGE_HUMAN homo | EKDSANQTGRHLV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
140 | D | G | e | 49.4 | 2yrq_A | hetero RAGE_HUMAN homo | EDKQNTIV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
141 | K | H | e | 21.7 | 2yrq_A | nucleotide homo | KRPV |
MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" | |
142 | Q | H | e | 73.0 | 2yrq_A | hetero RAGE_HUMAN | QKALERIHSDVTW |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
143 | P | H | e | 52.7 | 2yrq_A | PVKEMARFGHILT |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
144 | Y | H | b | 19.1 | 2yrq_A | YWFLG |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | ||
145 | E | H | e | 52.8 | 2yrq_A | hetero RAGE_HUMAN nucleotide homo | EIVKYLNDFTQ |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
146 | K | H | e | 64.2 | 2yrq_A | hetero RAGE_HUMAN | QEKDARSGTILN |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
147 | K | H | e | 41.5 | 2yrq_A | hetero RAGE_HUMAN homo | KELRMAQGI |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
148 | A | H | b | 10.7 | 2yrq_A | hetero RAGE_HUMAN nucleotide | ASYLQTERV |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | |
149 | A | H | e | 50.9 | 2yrq_A | hetero RAGE_HUMAN homo | AEQKSRDVNTGILM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" | A->E:(23.0 %):US Gastric-carcinoma cell line |
150 | K | H | e | 68.9 | 2yrq_A | homo | KEARDYLVQST |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
151 | L | H | e | 37.1 | 2yrq_A | homo | DLAERKMVYS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
152 | K | H | e | 40.6 | 2yrq_A | nucleotide | KRQAGMYS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
153 | E | H | e | 52.3 | 2yrq_A | hetero RAGE_HUMAN homo | EKAVDIQSLHRTGM |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
154 | K | H | e | 69.8 | 2yrq_A | hetero RAGE_HUMAN | RKEAQDLTIN |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
155 | Y | H | b | 14.8 | 2yrq_A | hetero RAGE_HUMAN nucleotide precipitant | YHFQSAW |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
156 | E | H | e | 44.2 | 2yrq_A | hetero RAGE_HUMAN nucleotide | EKMDQNTYAGILFHR |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | E->Q:(7.0 %):LB/B - |
157 | K | H | e | 67.9 | 2yrq_A | homo | KREDNAMYISTV |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
158 | D | H | e | 66.0 | 2yrq_A | EADNQTS |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
159 | I | H | b | 18.1 | 2yrq_A | nucleotide | MLIYVHKNRSQ |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | |
160 | A | H | e | 49.1 | 2yrq_A | AKEPQSRTVLDW |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" | ||
161 | A | H | e | 62.5 | 2yrq_A | AEDQNSGLVIK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | ||
162 | Y | H | e | 59.1 | 2yrq_A | YMWLQDF |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | ||
163 | R | H | e | 56.1 | 2yrq_A | nucleotide | RKNEQDIS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" | |
164 | A | e | 66.1 | 2yrq_A | nucleotide | AKYESGTRNQLPV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
165 | K | e | 77.4 | 2yrq_A | KQRSNALEGDFIPTVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
166 | G | e | 147.6 | 2yrq_A | GAKSMFPNYELVDHIQRT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
167 | K | T | e | 39.6 | 1hsm_A | KRGEANTPQLMDFISVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
168 | P | T | e | 52.7 | 1hsm_A | PSTGEMNKVFADILQR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
169 | D | T | e | 86.4 | 1hsm_A | DEPRNAVTFGIKLQSY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
170 | A | T | b | 16.1 | 1hsm_A | ASVLGRYDEFIKNPQT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
171 | A | e | 110.7 | 1hsm_A | AGIYLSRVEDKPT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
172 | K | - | - | - | - | KRAELQDFGINPSTV |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
173 | K | - | - | - | - | KGRIVDMQEPSTAL |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
174 | G | - | - | - | - | GSVATCFKYREL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
175 | V | - | - | - | - | VAKSTIPRCEGL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
176 | V | - | - | - | - | VARLEPISDGN |
COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
177 | K | - | - | - | - | KRTQE |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
178 | A | - | - | - | - | AEDKRPISVGL |
MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
179 | E | - | - | - | - | AEQSTMRGL |
MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
180 | K | - | - | - | - | KGAEDQSR |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
181 | S | - | - | - | - | STKPRADN |
MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
182 | K | - | - | - | - | KSQRGNVL |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
183 | K | - | - | - | - | KTAEGQDIPS |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
184 | K | - | - | - | - | KGSCNAEV |
MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
185 | K | - | - | - | - | KEARGPISN |
MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
186 | E | - | - | - | - | EQSKALNPD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
187 | E | - | - | - | - | ESDFAHQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
188 | E | - | - | - | - | EDRTKP |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
189 | E | - | - | - | - | QEADKSV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
190 | D | - | - | - | - | DEKAG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | D->G:(6.0 %):US Gastric-carcinoma cell line | |
191 | E | - | - | - | - | EDKAS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
192 | E | - | - | - | - | SAED |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
193 | D | - | - | - | - | DSANKVG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
194 | E | - | - | - | - | ETSQK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
195 | E | - | - | - | - | ESQTK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
196 | D | - | - | - | - | DENGSK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
197 | E | - | - | - | - | ESL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
198 | E | - | - | - | - | EGALV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
199 | E | - | - | - | - | EFNI |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
200 | E | - | - | - | - | KDEN |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
201 | E | - | - | - | - | EDS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
202 | D | - | - | - | - | DKAE |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
203 | E | - | - | - | - | EAD |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
204 | E | - | - | - | - | EDY |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
205 | D | - | - | - | - | DEI |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
206 | E | - | - | - | - | ES |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
207 | D | - | - | - | - | DEG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
208 | E | - | - | - | - | EDS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
209 | E | - | - | - | - | ED |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
210 | E | - | - | - | - | ES |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
211 | D | - | - | - | - | DT |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
212 | D | - | - | - | - | DS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
213 | D | - | - | - | - | D |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
214 | D | - | - | - | - | D |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
215 | E | - | - | - | - | EQ |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" |