Summary for the 1-st Site(M)

PID QueryLength FocusSite TITLE
11199 492 1 M RecName: Full=Transmembrane protease serine 2 ; EC=3.4.21.122 ;AltName: Full=Serine protease 10 ;Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor;
UniProt Information
AC/IDAC:O15393 ID:TMPS2_HUMAN
Feature Table for 1-th site VAR_SEQ: /note="M -> MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKM (in isoform 2)" /id="VSP_045083"
TOPO_DOM: /note="Cytoplasmic"
CHAIN: /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
M:100% 


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]