|
|
| PID | QueryLength | FocusSite | TITLE |
| 20585 | 425 | 43 K | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
| AC/ID | AC:P84022 ID:SMAD3_HUMAN |
| Feature Table for 43-th site |
MUTAGEN: /note="K->A: Little effect on interaction with DNA or JUN. Abolishes interaction with DNA and JUN; when associated with A-40; A-41 and A-44." HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
K:94% I:6% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 1ozj |
H (alpha-helix) | e (exposed) | 58.5 |
| Predicted Bind Molecules |
| homo:2 |
| Templates for 3D complexes |
|
homo [31552:SMAD5_HUMAN
] 6fzs_A_1_B_2 6fzs_B_2_A_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 43-rd Site(K)