|
|
| PID | QueryLength | FocusSite | TITLE |
| 20585 | 425 | 40 K | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
| AC/ID | AC:P84022 ID:SMAD3_HUMAN |
| Feature Table for 40-th site |
SITE: /note="Required for trimerization" MUTAGEN: /note="K->A: Little effect on interaction with DNA or JUN. Abolishes interaction with DNA and JUN; when associated with A-41; A-43 and A-44." HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
K:86% R:14% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 1ozj |
H (alpha-helix) | e (exposed) | 56.1 |
| Predicted Bind Molecules |
| nucleotide:15 |
| Templates for 3D complexes |
|
nucleotide [gtatgtctagactgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1ozj_C_1_B_1 [tgcagtctagactgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 3qsv_A_1_F_1 3qsv_B_1_H_1 3qsv_C_1_G_1 3qsv_D_1_E_1 [atgcgggcgcgcccgcatxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5mey_A_1_B_2 5mey_A_2_B_1 5nm9_A_1_D_1 5nm9_A_3_D_3 5nm9_B_1_C_3 5nm9_B_2_C_1 [xgcaggctagcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5mez_A_1_D_1 [tgcaggcgcgcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5od6_A_1_C_1 6tbz_A_1_C_1 6zmn_B_1_D_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 40-th Site(K)