|
|
| PID | QueryLength | FocusSite | TITLE |
| 20585 | 425 | 33 K | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
| AC/ID | AC:P84022 ID:SMAD3_HUMAN |
| Feature Table for 33-th site |
CROSSLNK: /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)" MUTAGEN: /note="K->R: Slightly decreased monoubiquitination." HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
K:69% T:13% R:10% A:9% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 1ozj |
H (alpha-helix) | e (exposed) | 39.6 |
| Predicted Bind Molecules |
| nucleotide:13 precipitant:2 |
| Templates for 3D complexes |
|
nucleotide [cagtctagacataxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1mhd_C_1_A_1 [tcagtctagacatacxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1ozj_C_1_A_1 [tgcagtctagactgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 3qsv_A_1_E_1 3qsv_B_1_G_1 3qsv_C_1_H_1 3qsv_D_1_F_1 [xgcaggctagcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5mez_A_1_C_1 [acgggccgcggcccgtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5mf0_A_1_C_1 5mf0_B_2_D_1 [atgcgggcgcgcccgcatxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5nm9_A_1_C_1 5nm9_A_3_C_3 [tgcaggctagcctxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5odg_B_1_D_3 5odg_B_2_D_1
precipitant [GOL ] 3kmp_A_1_F_1 3kmp_B_1_H_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 33-rd Site(K)