Summary for the 676-th Site(D) |
PID | QueryLength | FocusSite | TITLE |
11352 | 740 | 676 D | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
AC/ID | AC:Q92499 ID:DDX1_HUMAN |
Feature Table for 676-th site |
VAR_SEQ: /note="VCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPV DEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF -> MVQRDAVTI (in isoform 2)" /id="VSP_055455" DOMAIN: /note="Helicase C-terminal" REGION: /note="Necessary for interaction with HNRNPK" CHAIN: /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
D:39% E:19% S:14% K:6% T:6% P:5% N:4% Q:4% V:4% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
6b4i | S (bend) | e (exposed) | 65.4 |
Predicted Bind Molecules |
hetero:1 |
Templates for 3D complexes |
hetero [72178:GLE1_HUMAN ] 6b4j_F_1_A_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |