|
|
| PID | QueryLength | FocusSite | TITLE |
| 27536 | 63 | 61 D | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
| AC/ID | AC:P59634 ID:NS6_SARS |
| Feature Table for 61-th site |
REGION: /note="Critical for disrupting nuclear import" VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
D:100% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 7f90 |
(coil) | e (exposed) | 91.4 |
| Predicted Bind Molecules |
| hetero:6 |
| Templates for 3D complexes |
|
hetero [75050:RAE1L_HUMAN
] 7f90_A_1_C_1 7f90_B_1_D_1 7vpg_I_1_A_1 7vpg_J_1_C_1 7vpg_K_1_E_1 7vpg_L_1_G_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 61-st Site(D)