|
|
| PID | QueryLength | FocusSite | TITLE |
| 27536 | 63 | 59 E | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
| AC/ID | AC:P59634 ID:NS6_SARS |
| Feature Table for 59-th site |
REGION: /note="Critical for disrupting nuclear import" VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
E:100% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 7vpg |
(coil) | e (exposed) | 96.5 |
| Predicted Bind Molecules |
| hetero:8 |
| Templates for 3D complexes |
|
hetero [75050:RAE1L_HUMAN
] 7f90_A_1_C_1 7f90_B_1_D_1 7vpg_I_1_A_1 7vpg_J_1_C_1 7vpg_K_1_E_1 7vpg_L_1_G_1 [15740:NUP98_HUMAN
] 7vpg_K_1_F_1 7vpg_L_1_H_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 59-th Site(E)