|
|
| PID | QueryLength | FocusSite | TITLE |
| 27536 | 63 | 42 K | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
| AC/ID | AC:P59634 ID:NS6_SARS |
| Feature Table for 42-th site |
VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
K:100% |
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 42-nd Site(K)