|
|
| PID | QueryLength | FocusSite | TITLE |
| 22598 | 425 | 41 K | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
| AC/ID | AC:P84022 ID:SMAD3_HUMAN |
| Feature Table for 41-th site |
SITE: /note="Required for interaction with DNA and JUN and for functional cooperation with JUN" MUTAGEN: /note="K->A: Greatly reduced interaction with DNA and JUN. Abolishes interaction with DNA and JUN; when associated with A-40; A-44 and A-43." HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
K:68% R:18% V:14% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 1ozj |
H (alpha-helix) | e (exposed) | 28.3 |
| Predicted Bind Molecules |
| nucleotide:2 |
| Templates for 3D complexes |
|
nucleotide [tgcaggctagcctxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5odg_B_1_D_3 5odg_B_2_D_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 41-st Site(K)