Summary for the 40-th Site(K) |
PID | QueryLength | FocusSite | TITLE |
22598 | 425 | 40 K | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
AC/ID | AC:P84022 ID:SMAD3_HUMAN |
Feature Table for 40-th site |
SITE: /note="Required for trimerization" MUTAGEN: /note="K->A: Little effect on interaction with DNA or JUN. Abolishes interaction with DNA and JUN; when associated with A-41; A-43 and A-44." HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
K:86% R:14% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
1ozj | H (alpha-helix) | e (exposed) | 56.1 |
Predicted Bind Molecules |
nucleotide:3 |
Templates for 3D complexes |
nucleotide [gtatgtctagactgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1ozj_C_1_B_1 [tgcaggcgcgcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5od6_A_1_C_1 6zmn_B_1_D_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |