Summary for the 59-th Site(E) |
PID | QueryLength | FocusSite | TITLE |
3542 | 63 | 59 E | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
AC/ID | AC:P59634 ID:NS6_SARS |
Feature Table for 59-th site |
REGION: /note="Critical for disrupting nuclear import" VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
E:100% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
7f90 | (coil) | e (exposed) | 100.0 |
Predicted Bind Molecules |
hetero:8 |
Templates for 3D complexes |
hetero [75775:RAE1L_HUMAN ] 7f90_A_1_C_1 7f90_B_1_D_1 7vpg_I_1_A_1 7vpg_J_1_C_1 7vpg_K_1_E_1 7vpg_L_1_G_1 [15869:NUP98_HUMAN ] 7vpg_K_1_F_1 7vpg_L_1_H_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |