Summary for the 37-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
30181 | 425 | 37 S | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
AC/ID | AC:P84022 ID:SMAD3_HUMAN |
Feature Table for 37-th site |
HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
S:58% A:21% L:14% N:6% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
1ozj | H (alpha-helix) | e (exposed) | 21.9 |
Predicted Bind Molecules |
nucleotide:12 |
Templates for 3D complexes |
nucleotide [cagtctagacataxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1mhd_C_1_A_1 [tatgtctagactgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1mhd_D_1_B_1 [tcagtctagacatacxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1ozj_C_1_A_1 [gtatgtctagactgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 1ozj_D_1_B_1 [atcagtctagacataxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 3kmp_A_1_C_1 [tgcaggctagcctxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5odg_B_1_D_3 5odg_B_2_D_1 [atcagtctagacataxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5x6g_A_1_C_1 [xgtatgtctagactgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5x6g_B_1_D_1 [tgcaggcgcgcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 6fzs_B_2_D_2 [tgcaggctagcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 6tce_A_1_B_1 6tce_A_2_B_2 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |