Summary for the 954-th Site(Q) |
PID | QueryLength | FocusSite | TITLE |
29474 | 1170 | 954 Q | RecName: Full=Integrin alpha-L ;AltName: Full=CD11 antigen-like family member A;AltName: Full=Leukocyte adhesion glycoprotein LFA-1 alpha chain; Short=LFA-1A;AltName: Full=Leukocyte function-associated molecule 1 alpha chain;AltName: CD_antigen=CD11a;Flags: Precursor; |
AC/ID | AC:P20701 ID:ITAL_HUMAN |
Feature Table for 954-th site |
VAR_SEQ: /note="Q -> QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDN IRAGPCR (in isoform 2)" /id="VSP_002738" TOPO_DOM: /note="Extracellular" CHAIN: /note="Integrin alpha-L" /id="PRO_0000016292" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
Q:31% E:22% R:10% L:10% S:7% T:7% G:6% I:5% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
3k6s | E (beta-strand) | e (exposed) | 21.9 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |