Summary for the 49-th Site(Y) |
PID | QueryLength | FocusSite | TITLE |
27536 | 63 | 49 Y | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
AC/ID | AC:P59634 ID:NS6_SARS |
Feature Table for 49-th site |
MUTAGEN: /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
Y:100% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |