|
PID | QueryLength | FocusSite | TITLE |
27536 | 63 | 54 D | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
AC/ID | AC:P59634 ID:NS6_SARS |
Feature Table for 54-th site |
MUTAGEN: /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION: /note="Critical for disrupting nuclear import" VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)" CHAIN: /note="ORF6 protein" /id="PRO_0000106134" |
Percentages of Amino Acids in Homologous Proteins
![]() |
D:62% E:38% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
![]() |
(coil) | e (exposed) | 96.3 |
Predicted Bind Molecules |
hetero:5 |
Templates for 3D complexes |
hetero [75775:RAE1L_HUMAN
] ![]() ![]() ![]() ![]() ![]() |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |