Summary for the 41-st Site(K)

PID QueryLength FocusSite TITLE
1590160 425 41 K RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3;
UniProt Information
AC/IDAC:P84022 ID:SMAD3_HUMAN
Feature Table for 41-th site SITE: /note="Required for interaction with DNA and JUN and for functional cooperation with JUN"
MUTAGEN: /note="K->A: Greatly reduced interaction with DNA and JUN. Abolishes interaction with DNA and JUN; when associated with A-40; A-44 and A-43."
HELIX:
VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900"
VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793"
DOMAIN: /note="MH1"
VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348"
CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
K:68% R:18% V:14% 
3D Structure Information
Template For Monomer predicted SecStr predicted ExpBur Predicted Relative Acc(%)
1ozj H (alpha-helix) e (exposed) 28.3
3D Complex Information
Predicted Bind Molecules
nucleotide:12 metal:2
Templates for 3D complexes
nucleotide [acgggccgcggcccgtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5mf0_A_1_C_1 5mf0_B_2_D_1 [tgcaggctagcctxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5odg_B_1_D_3 5odg_B_2_D_1 [ttatagactgccggcagtctgaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5x6m_A_1_C_1 5x6m_E_1_G_1 [atcagactgccggcagtctataxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 5x6m_D_1_B_1 [tgcaggcgcgcctgcaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 6fzs_A_1_C_1 6fzs_B_2_D_2 6tbz_A_1_B_1 [gagtgtctgcagacactcxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx ] 6h3r_A_1_C_1 6h3r_B_1_D_2 metal [CL ] 5mey_A_1_E_1 5mey_A_2_E_2


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]