Summary for the 26-th Site(Q) |
PID | QueryLength | FocusSite | TITLE |
1590160 | 425 | 26 Q | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
AC/ID | AC:P84022 ID:SMAD3_HUMAN |
Feature Table for 26-th site |
HELIX: VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" DOMAIN: /note="MH1" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
E:29% Q:16% I:16% A:4% L:4% G:3% K:3% S:3% T:3% V:3% R:2% N:2% D:2% F:2% P:2% C:1% H:1% M:1% W:1% Y:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
1ozj | H (alpha-helix) | e (exposed) | 79.6 |
Predicted Bind Molecules |
metal:5 |
Templates for 3D complexes |
metal [CL ] 5mey_A_1_D_1 5mey_A_2_D_2 5mey_A_1_G_1 5mey_A_2_G_2 5mez_A_1_F_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |