Summary for the 631-st Site(C) |
PID | QueryLength | FocusSite | TITLE |
10705 | 740 | 631 C | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
AC/ID | AC:Q92499 ID:DDX1_HUMAN |
Feature Table for 631-th site |
REGION: /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" VAR_SEQ: /note="VCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPV DEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF -> MVQRDAVTI (in isoform 2)" /id="VSP_055455" DOMAIN: /note="Helicase C-terminal" REGION: /note="Necessary for interaction with HNRNPK" CHAIN: /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
L:16% E:12% A:11% I:11% C:8% T:8% K:5% V:5% D:4% M:4% S:3% R:2% Q:2% G:2% P:2% N:1% F:1% Y:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
8tbx | S (bend) | e (exposed) | 24.0 |
Predicted Bind Molecules |
metal:1 |
Templates for 3D complexes |
metal [ZN ] 8tbx_A_1_D_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |