Summary for the 281-st Site(T) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 281 T | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 281-th site |
VARIANT: /note="T -> P (found in hematological malignancies; uncertain significance; somatic mutation; no effect on NF- kappaB complex activation)" /id="VAR_073263" HELIX: DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 281-th site |
T->P US " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
T:30% Q:29% G:15% S:11% L:8% H:3% A:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | T (Hbond turn) | b (buried) | 12.3 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |