Summary for the 252-nd Site(L) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 252 L | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 252-th site |
VARIANT: /note="L -> P (in WM1; uncertain significance; somatic mutation; constitutively activates NF-kappaB complex activation; gain-of-function mutation; does not affect interaction with IRAK4; dbSNP:rs387907272)" ECO:0000269|PubMed:22931316, ECO:0000269|PubMed:24366360" /id="VAR_073262" STRAND: DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 252-th site |
L->P US dbSNP:rs3879072 " Macroglobulinemia, Waldenstrom, 1 (WM1) " [MIM:153600] |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
L:52% I:28% T:12% V:9% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | E (beta-strand) | b (buried) | 0.0 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |