Summary for the 230-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 230 S | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 230-th site |
VARIANT: /note="S -> N (found in hematological malignancies; uncertain significance; somatic mutation; constitutively activates NF-kappaB complex activation; dbSNP:rs1353791431)" /id="VAR_073261" DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 230-th site |
S->N US dbSNP:rs1353791 " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
S:72% D:12% R:8% G:5% N:4% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | S (bend) | b (buried) | 18.0 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |