Summary for the 219-th Site(M) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 219 M | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 219-th site |
VARIANT: /note="M -> T (found in hematological malignancies; uncertain significance; somatic mutation; constitutively activates NF-kappaB complex activation)" /id="VAR_073260" STRAND: DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 219-th site |
M->T US " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
T:33% L:21% M:20% V:17% A:1% R:1% N:1% D:1% E:1% G:1% I:1% K:1% P:1% S:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | E (beta-strand) | b (buried) | 0.0 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |