Summary for the 178-th Site(M) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 178 M | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 178-th site |
VARIANT: /note="M -> I (found in hematological malignancies; uncertain significance; somatic mutation; no effect on NF- kappaB complex activation; dbSNP:rs41285117)" ECO:0000269|PubMed:24316379" /id="VAR_072896" HELIX: DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 178-th site |
M->I US dbSNP:rs4128511 " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
M:39% L:34% I:19% T:9% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | H (alpha-helix) | b (buried) | 0.0 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |